Release Notes For GenBank Release 218

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2017

               NCBI-GenBank Flat File Release 218.0

                    Distribution Release Notes

 199341377 loci, 228719437638 bases, from 199341377 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 218.0
1.2 Cutoff Date
1.3 Important Changes in Release 218.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 218.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 218.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 218.0, incorporates data processed by the INSDC databases
as of Monday, February 13, 2017 at approximately 1:33am EST.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 218.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 39 with this release:

  - the BCT division is now composed of 330 files (+26)
  - the CON division is now composed of 356 files (-1)
  - the ENV division is now composed of  95 files (+1)
  - the INV division is now composed of 152 files (+1)
  - the PAT division is now composed of 283 files (+3)
  - the PLN division is now composed of 143 files (+6)
  - the VRL division is now composed of  47 files (+2)
  - the VRT division is now composed of  64 files (+1)

  The number of CON division files decreased due to the re-assembly or
re-submission of underlying WGS projects, and to the suppression of an
incomplete genome assembly, impacting approximately 142,000 records:

	File     Accession Range     Records
	------   -----------------   -------
	con166   HG826010-HG850177   24168
	con167   HG850178-HG915294   65117
	con241   KI478696-KI503496   24801
	con242   KI503497-KI515612   12116
	con353   LN913085-LN929547   16463

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 218.0. Consider gbgss174.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2017

                NCBI-GenBank Flat File Release 218.0

                           GSS Sequences (Part 1)

   87032 loci,    63853715 bases, from    87032 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "174" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 GI sequence identifiers to be removed from GenBank/GenPept/FASTA formats
      and FASTA header to be simplified

  As of March 15 2017, the integer sequence identifiers known as "GIs" will
no longer be included in the GenBank, GenPept, and FASTA formats for GenBank
Release and GenBank Update products. The FASTA header will be further simplified,
to report only the sequence Accession.Version for records that originate within
the International Sequence Database Collaboration (INSDC).

      ******************************************************
      ** GenBank 218.0 is the FINAL release that includes **
      ** NCBI 'GI' sequence identifiers.                  **
      ******************************************************

  As first described in the Release Notes for GenBank 199.0 in December 2013,
NCBI is in the process of moving to storage solutions which utilize only
Accession.Version identifiers. See Section 1.4.2 of these release notes for
additional background information about those developments.

  Given this shift to non-GI-based systems, the importance of using
Accession.Version identifiers cannot be overstated. As early as October 2016,
NCBI will cease displaying GI identifiers in the flatfile and FASTA views
generated within the Entrez:Nucleotide and Entrez:Protein resources. So
any web-related processes solely dependent on GIs will need to be adjusted
before that time or they will cease to work.  

  Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to begin planning to use Accession.Version identifiers instead.

  The FASTA format will also be changed for all sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.

  At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC sources of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.

Example 1 : An INSDC nucleotide record

  In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  As of March 15 2017, the Accession.Version will be the sole sequence
version identifier. The GI value on the VERSION line and the GI /db_xref
qualifier for the coding region feature will no longer be visible:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

Example 2 : A GenPept record for an INSDC sequence

The current GenPept display format includes GI identifiers in the VERSION lines
(note that the coding region feature for GenPept has never included the display
of GI identifiers) :

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

As of March 15 2017, the VERSION line will no longer include the GI value:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

Example 3: FASTA format for an INSDC nucleotide and protein sequence

The current FASTA display, for most products, includes GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

As of March 15 2017, just the Accession.Version will be provided:

>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info@ncbi.nlm.nih.gov

1.4.2 GI sequence identifiers are being phased out at NCBI

  The numeric GI sequence identifier that NCBI used to assign to all
nucleotide and protein sequences was first introduced for GenBank Release
products as of GenBank 81.0, in February 1994. See:

     ftp://ftp.ncbi.nih.gov/genbank/release.notes/gb81.release.notes

 These simple, uniform, integer-based unique identifiers (which predated the
introduction of Accession.Version sequence identifiers) were crucial to the
development of NCBI's Entrez retrieval system, and have served their purpose
very well for over 20 years. 

  However, as NCBI considers how best to address the expected increase in the
volume of submitted sequence data, it is clear that prior practices will need
to be re-thought. As an example, imagine 100,000 pathogen-related
genomes/samples, each with 5000 proteins, most of which are common to all. We
will be moving toward solutions that represent each unique protein *once*.
The coding region protein products for each genome will likely continue to be
assigned their own Accession.Version identifiers, but (within the NCBI data
model) they will simply *reference* the unique proteins. And, they will no
longer be issued GIs of their own.

  Such a change will likely have a significant impact on NCBI users who
utilize GIs in their own information systems and analysis pipelines, so it is
being implemented gradually. Unannotated WGS projects consisting of millions
of contigs and scaffolds, and unannotated TSA projects, are the first two
classes of records for which GIs are no longer being assigned. But the practice
will ultimately expand to include other classes of records.

  If GIs are central to your operations, NCBI strongly urges that you begin
planning a switch to the use of Accession.Version identifiers instead.

  The contigs and scaffolds of the ALWZ04 WGS project are good examples of
sequences that lack GIs. Below are excerpts from the flatfile representation
of the first ALWZ04 contig, and the 'singleton scaffold' which is constructed
from it. Note the absence of a GI value on the VERSION line of these two
records:

LOCUS       ALWZ040000001           1191 bp    DNA     linear   PLN 13-MAR-2015
DEFINITION  Picea glauca, whole genome shotgun sequence.
ACCESSION   ALWZ040000001 ALWZ040000000
VERSION     ALWZ040000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
ORIGIN      
        1 ctataatacc cctatgccaa acgaacccaa ttgtaaatgt aaatgcaaat gtacttaggc
       61 tggttagttg tttaatatca ttttttgtat gcaccttcca tggtataatg cgcacatgta
      121 tagcgcacta aaattatgaa gtgtgcccat tccaagatat tgcgcgtaaa aaacttaagt
      181 gtgcatgatt ttgagactag ggagactttg tgtatatgtt gtgttttata tgctggagag
      241 acaattatta ttagttagga ggattatgtt ttgtactagg caagagagcc tagatgttaa
      301 aggctagtga gcctattttt gtatatgtct catcattaat ataatacatc attgtgtgta
....
      901 ttgttgggaa ttgatttcct gaatgtgtta aactgcattg atagggatct gagaattcct
      961 ttctggccta ttgctgaagc tttggaaggg aggtggggca accgagggac tgttgagaag
     1021 agaagggtca cacttcctgg ggtgggacaa gcatgtgggg aattagggat tgcaggatgt
     1081 tagtttgaat tggcacctat gacagagtct ttcctattgt ctgagatatg tcagcttggt
     1141 taggaaaccc tttacctggg tagagtttag tcccagctcg ggggtgaccc a
//

LOCUS       ALWZ04S0000001          1191 bp    DNA     linear   CON 13-MAR-2015
DEFINITION  Picea glauca Pg-01r141201s0000001, whole genome shotgun sequence.
ACCESSION   ALWZ04S0000001 ALWZ0400000000
VERSION     ALWZ04S0000001.1
DBLINK      BioProject: PRJNA83435
            BioSample: SAMN01120252
....
CONTIG      join(ALWZ040000001.1:1..1191)
//

Sample URLs from which ALWZ04 data may be obtained include:

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#contigs
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?val=ALWZ04#scaffolds

  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04.gbff.1.gz
  http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/Traces/wgs/?download=ALWZ04S.gbff.1.gz

  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.*.gbff.gz
  ftp://ftp.ncbi.nlm.nih.gov/genbank/wgs/wgs.ALWZ.scflds.*.gbff.gz

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2813 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct34.seq - Bacterial sequence entries, part 34.
260. gbbct35.seq - Bacterial sequence entries, part 35.
261. gbbct36.seq - Bacterial sequence entries, part 36.
262. gbbct37.seq - Bacterial sequence entries, part 37.
263. gbbct38.seq - Bacterial sequence entries, part 38.
264. gbbct39.seq - Bacterial sequence entries, part 39.
265. gbbct4.seq - Bacterial sequence entries, part 4.
266. gbbct40.seq - Bacterial sequence entries, part 40.
267. gbbct41.seq - Bacterial sequence entries, part 41.
268. gbbct42.seq - Bacterial sequence entries, part 42.
269. gbbct43.seq - Bacterial sequence entries, part 43.
270. gbbct44.seq - Bacterial sequence entries, part 44.
271. gbbct45.seq - Bacterial sequence entries, part 45.
272. gbbct46.seq - Bacterial sequence entries, part 46.
273. gbbct47.seq - Bacterial sequence entries, part 47.
274. gbbct48.seq - Bacterial sequence entries, part 48.
275. gbbct49.seq - Bacterial sequence entries, part 49.
276. gbbct5.seq - Bacterial sequence entries, part 5.
277. gbbct50.seq - Bacterial sequence entries, part 50.
278. gbbct51.seq - Bacterial sequence entries, part 51.
279. gbbct52.seq - Bacterial sequence entries, part 52.
280. gbbct53.seq - Bacterial sequence entries, part 53.
281. gbbct54.seq - Bacterial sequence entries, part 54.
282. gbbct55.seq - Bacterial sequence entries, part 55.
283. gbbct56.seq - Bacterial sequence entries, part 56.
284. gbbct57.seq - Bacterial sequence entries, part 57.
285. gbbct58.seq - Bacterial sequence entries, part 58.
286. gbbct59.seq - Bacterial sequence entries, part 59.
287. gbbct6.seq - Bacterial sequence entries, part 6.
288. gbbct60.seq - Bacterial sequence entries, part 60.
289. gbbct61.seq - Bacterial sequence entries, part 61.
290. gbbct62.seq - Bacterial sequence entries, part 62.
291. gbbct63.seq - Bacterial sequence entries, part 63.
292. gbbct64.seq - Bacterial sequence entries, part 64.
293. gbbct65.seq - Bacterial sequence entries, part 65.
294. gbbct66.seq - Bacterial sequence entries, part 66.
295. gbbct67.seq - Bacterial sequence entries, part 67.
296. gbbct68.seq - Bacterial sequence entries, part 68.
297. gbbct69.seq - Bacterial sequence entries, part 69.
298. gbbct7.seq - Bacterial sequence entries, part 7.
299. gbbct70.seq - Bacterial sequence entries, part 70.
300. gbbct71.seq - Bacterial sequence entries, part 71.
301. gbbct72.seq - Bacterial sequence entries, part 72.
302. gbbct73.seq - Bacterial sequence entries, part 73.
303. gbbct74.seq - Bacterial sequence entries, part 74.
304. gbbct75.seq - Bacterial sequence entries, part 75.
305. gbbct76.seq - Bacterial sequence entries, part 76.
306. gbbct77.seq - Bacterial sequence entries, part 77.
307. gbbct78.seq - Bacterial sequence entries, part 78.
308. gbbct79.seq - Bacterial sequence entries, part 79.
309. gbbct8.seq - Bacterial sequence entries, part 8.
310. gbbct80.seq - Bacterial sequence entries, part 80.
311. gbbct81.seq - Bacterial sequence entries, part 81.
312. gbbct82.seq - Bacterial sequence entries, part 82.
313. gbbct83.seq - Bacterial sequence entries, part 83.
314. gbbct84.seq - Bacterial sequence entries, part 84.
315. gbbct85.seq - Bacterial sequence entries, part 85.
316. gbbct86.seq - Bacterial sequence entries, part 86.
317. gbbct87.seq - Bacterial sequence entries, part 87.
318. gbbct88.seq - Bacterial sequence entries, part 88.
319. gbbct89.seq - Bacterial sequence entries, part 89.
320. gbbct9.seq - Bacterial sequence entries, part 9.
321. gbbct90.seq - Bacterial sequence entries, part 90.
322. gbbct91.seq - Bacterial sequence entries, part 91.
323. gbbct92.seq - Bacterial sequence entries, part 92.
324. gbbct93.seq - Bacterial sequence entries, part 93.
325. gbbct94.seq - Bacterial sequence entries, part 94.
326. gbbct95.seq - Bacterial sequence entries, part 95.
327. gbbct96.seq - Bacterial sequence entries, part 96.
328. gbbct97.seq - Bacterial sequence entries, part 97.
329. gbbct98.seq - Bacterial sequence entries, part 98.
330. gbbct99.seq - Bacterial sequence entries, part 99.
331. gbchg.txt - Accession numbers of entries updated since the previous release.
332. gbcon1.seq - Constructed sequence entries, part 1.
333. gbcon10.seq - Constructed sequence entries, part 10.
334. gbcon100.seq - Constructed sequence entries, part 100.
335. gbcon101.seq - Constructed sequence entries, part 101.
336. gbcon102.seq - Constructed sequence entries, part 102.
337. gbcon103.seq - Constructed sequence entries, part 103.
338. gbcon104.seq - Constructed sequence entries, part 104.
339. gbcon105.seq - Constructed sequence entries, part 105.
340. gbcon106.seq - Constructed sequence entries, part 106.
341. gbcon107.seq - Constructed sequence entries, part 107.
342. gbcon108.seq - Constructed sequence entries, part 108.
343. gbcon109.seq - Constructed sequence entries, part 109.
344. gbcon11.seq - Constructed sequence entries, part 11.
345. gbcon110.seq - Constructed sequence entries, part 110.
346. gbcon111.seq - Constructed sequence entries, part 111.
347. gbcon112.seq - Constructed sequence entries, part 112.
348. gbcon113.seq - Constructed sequence entries, part 113.
349. gbcon114.seq - Constructed sequence entries, part 114.
350. gbcon115.seq - Constructed sequence entries, part 115.
351. gbcon116.seq - Constructed sequence entries, part 116.
352. gbcon117.seq - Constructed sequence entries, part 117.
353. gbcon118.seq - Constructed sequence entries, part 118.
354. gbcon119.seq - Constructed sequence entries, part 119.
355. gbcon12.seq - Constructed sequence entries, part 12.
356. gbcon120.seq - Constructed sequence entries, part 120.
357. gbcon121.seq - Constructed sequence entries, part 121.
358. gbcon122.seq - Constructed sequence entries, part 122.
359. gbcon123.seq - Constructed sequence entries, part 123.
360. gbcon124.seq - Constructed sequence entries, part 124.
361. gbcon125.seq - Constructed sequence entries, part 125.
362. gbcon126.seq - Constructed sequence entries, part 126.
363. gbcon127.seq - Constructed sequence entries, part 127.
364. gbcon128.seq - Constructed sequence entries, part 128.
365. gbcon129.seq - Constructed sequence entries, part 129.
366. gbcon13.seq - Constructed sequence entries, part 13.
367. gbcon130.seq - Constructed sequence entries, part 130.
368. gbcon131.seq - Constructed sequence entries, part 131.
369. gbcon132.seq - Constructed sequence entries, part 132.
370. gbcon133.seq - Constructed sequence entries, part 133.
371. gbcon134.seq - Constructed sequence entries, part 134.
372. gbcon135.seq - Constructed sequence entries, part 135.
373. gbcon136.seq - Constructed sequence entries, part 136.
374. gbcon137.seq - Constructed sequence entries, part 137.
375. gbcon138.seq - Constructed sequence entries, part 138.
376. gbcon139.seq - Constructed sequence entries, part 139.
377. gbcon14.seq - Constructed sequence entries, part 14.
378. gbcon140.seq - Constructed sequence entries, part 140.
379. gbcon141.seq - Constructed sequence entries, part 141.
380. gbcon142.seq - Constructed sequence entries, part 142.
381. gbcon143.seq - Constructed sequence entries, part 143.
382. gbcon144.seq - Constructed sequence entries, part 144.
383. gbcon145.seq - Constructed sequence entries, part 145.
384. gbcon146.seq - Constructed sequence entries, part 146.
385. gbcon147.seq - Constructed sequence entries, part 147.
386. gbcon148.seq - Constructed sequence entries, part 148.
387. gbcon149.seq - Constructed sequence entries, part 149.
388. gbcon15.seq - Constructed sequence entries, part 15.
389. gbcon150.seq - Constructed sequence entries, part 150.
390. gbcon151.seq - Constructed sequence entries, part 151.
391. gbcon152.seq - Constructed sequence entries, part 152.
392. gbcon153.seq - Constructed sequence entries, part 153.
393. gbcon154.seq - Constructed sequence entries, part 154.
394. gbcon155.seq - Constructed sequence entries, part 155.
395. gbcon156.seq - Constructed sequence entries, part 156.
396. gbcon157.seq - Constructed sequence entries, part 157.
397. gbcon158.seq - Constructed sequence entries, part 158.
398. gbcon159.seq - Constructed sequence entries, part 159.
399. gbcon16.seq - Constructed sequence entries, part 16.
400. gbcon160.seq - Constructed sequence entries, part 160.
401. gbcon161.seq - Constructed sequence entries, part 161.
402. gbcon162.seq - Constructed sequence entries, part 162.
403. gbcon163.seq - Constructed sequence entries, part 163.
404. gbcon164.seq - Constructed sequence entries, part 164.
405. gbcon165.seq - Constructed sequence entries, part 165.
406. gbcon166.seq - Constructed sequence entries, part 166.
407. gbcon167.seq - Constructed sequence entries, part 167.
408. gbcon168.seq - Constructed sequence entries, part 168.
409. gbcon169.seq - Constructed sequence entries, part 169.
410. gbcon17.seq - Constructed sequence entries, part 17.
411. gbcon170.seq - Constructed sequence entries, part 170.
412. gbcon171.seq - Constructed sequence entries, part 171.
413. gbcon172.seq - Constructed sequence entries, part 172.
414. gbcon173.seq - Constructed sequence entries, part 173.
415. gbcon174.seq - Constructed sequence entries, part 174.
416. gbcon175.seq - Constructed sequence entries, part 175.
417. gbcon176.seq - Constructed sequence entries, part 176.
418. gbcon177.seq - Constructed sequence entries, part 177.
419. gbcon178.seq - Constructed sequence entries, part 178.
420. gbcon179.seq - Constructed sequence entries, part 179.
421. gbcon18.seq - Constructed sequence entries, part 18.
422. gbcon180.seq - Constructed sequence entries, part 180.
423. gbcon181.seq - Constructed sequence entries, part 181.
424. gbcon182.seq - Constructed sequence entries, part 182.
425. gbcon183.seq - Constructed sequence entries, part 183.
426. gbcon184.seq - Constructed sequence entries, part 184.
427. gbcon185.seq - Constructed sequence entries, part 185.
428. gbcon186.seq - Constructed sequence entries, part 186.
429. gbcon187.seq - Constructed sequence entries, part 187.
430. gbcon188.seq - Constructed sequence entries, part 188.
431. gbcon189.seq - Constructed sequence entries, part 189.
432. gbcon19.seq - Constructed sequence entries, part 19.
433. gbcon190.seq - Constructed sequence entries, part 190.
434. gbcon191.seq - Constructed sequence entries, part 191.
435. gbcon192.seq - Constructed sequence entries, part 192.
436. gbcon193.seq - Constructed sequence entries, part 193.
437. gbcon194.seq - Constructed sequence entries, part 194.
438. gbcon195.seq - Constructed sequence entries, part 195.
439. gbcon196.seq - Constructed sequence entries, part 196.
440. gbcon197.seq - Constructed sequence entries, part 197.
441. gbcon198.seq - Constructed sequence entries, part 198.
442. gbcon199.seq - Constructed sequence entries, part 199.
443. gbcon2.seq - Constructed sequence entries, part 2.
444. gbcon20.seq - Constructed sequence entries, part 20.
445. gbcon200.seq - Constructed sequence entries, part 200.
446. gbcon201.seq - Constructed sequence entries, part 201.
447. gbcon202.seq - Constructed sequence entries, part 202.
448. gbcon203.seq - Constructed sequence entries, part 203.
449. gbcon204.seq - Constructed sequence entries, part 204.
450. gbcon205.seq - Constructed sequence entries, part 205.
451. gbcon206.seq - Constructed sequence entries, part 206.
452. gbcon207.seq - Constructed sequence entries, part 207.
453. gbcon208.seq - Constructed sequence entries, part 208.
454. gbcon209.seq - Constructed sequence entries, part 209.
455. gbcon21.seq - Constructed sequence entries, part 21.
456. gbcon210.seq - Constructed sequence entries, part 210.
457. gbcon211.seq - Constructed sequence entries, part 211.
458. gbcon212.seq - Constructed sequence entries, part 212.
459. gbcon213.seq - Constructed sequence entries, part 213.
460. gbcon214.seq - Constructed sequence entries, part 214.
461. gbcon215.seq - Constructed sequence entries, part 215.
462. gbcon216.seq - Constructed sequence entries, part 216.
463. gbcon217.seq - Constructed sequence entries, part 217.
464. gbcon218.seq - Constructed sequence entries, part 218.
465. gbcon219.seq - Constructed sequence entries, part 219.
466. gbcon22.seq - Constructed sequence entries, part 22.
467. gbcon220.seq - Constructed sequence entries, part 220.
468. gbcon221.seq - Constructed sequence entries, part 221.
469. gbcon222.seq - Constructed sequence entries, part 222.
470. gbcon223.seq - Constructed sequence entries, part 223.
471. gbcon224.seq - Constructed sequence entries, part 224.
472. gbcon225.seq - Constructed sequence entries, part 225.
473. gbcon226.seq - Constructed sequence entries, part 226.
474. gbcon227.seq - Constructed sequence entries, part 227.
475. gbcon228.seq - Constructed sequence entries, part 228.
476. gbcon229.seq - Constructed sequence entries, part 229.
477. gbcon23.seq - Constructed sequence entries, part 23.
478. gbcon230.seq - Constructed sequence entries, part 230.
479. gbcon231.seq - Constructed sequence entries, part 231.
480. gbcon232.seq - Constructed sequence entries, part 232.
481. gbcon233.seq - Constructed sequence entries, part 233.
482. gbcon234.seq - Constructed sequence entries, part 234.
483. gbcon235.seq - Constructed sequence entries, part 235.
484. gbcon236.seq - Constructed sequence entries, part 236.
485. gbcon237.seq - Constructed sequence entries, part 237.
486. gbcon238.seq - Constructed sequence entries, part 238.
487. gbcon239.seq - Constructed sequence entries, part 239.
488. gbcon24.seq - Constructed sequence entries, part 24.
489. gbcon240.seq - Constructed sequence entries, part 240.
490. gbcon241.seq - Constructed sequence entries, part 241.
491. gbcon242.seq - Constructed sequence entries, part 242.
492. gbcon243.seq - Constructed sequence entries, part 243.
493. gbcon244.seq - Constructed sequence entries, part 244.
494. gbcon245.seq - Constructed sequence entries, part 245.
495. gbcon246.seq - Constructed sequence entries, part 246.
496. gbcon247.seq - Constructed sequence entries, part 247.
497. gbcon248.seq - Constructed sequence entries, part 248.
498. gbcon249.seq - Constructed sequence entries, part 249.
499. gbcon25.seq - Constructed sequence entries, part 25.
500. gbcon250.seq - Constructed sequence entries, part 250.
501. gbcon251.seq - Constructed sequence entries, part 251.
502. gbcon252.seq - Constructed sequence entries, part 252.
503. gbcon253.seq - Constructed sequence entries, part 253.
504. gbcon254.seq - Constructed sequence entries, part 254.
505. gbcon255.seq - Constructed sequence entries, part 255.
506. gbcon256.seq - Constructed sequence entries, part 256.
507. gbcon257.seq - Constructed sequence entries, part 257.
508. gbcon258.seq - Constructed sequence entries, part 258.
509. gbcon259.seq - Constructed sequence entries, part 259.
510. gbcon26.seq - Constructed sequence entries, part 26.
511. gbcon260.seq - Constructed sequence entries, part 260.
512. gbcon261.seq - Constructed sequence entries, part 261.
513. gbcon262.seq - Constructed sequence entries, part 262.
514. gbcon263.seq - Constructed sequence entries, part 263.
515. gbcon264.seq - Constructed sequence entries, part 264.
516. gbcon265.seq - Constructed sequence entries, part 265.
517. gbcon266.seq - Constructed sequence entries, part 266.
518. gbcon267.seq - Constructed sequence entries, part 267.
519. gbcon268.seq - Constructed sequence entries, part 268.
520. gbcon269.seq - Constructed sequence entries, part 269.
521. gbcon27.seq - Constructed sequence entries, part 27.
522. gbcon270.seq - Constructed sequence entries, part 270.
523. gbcon271.seq - Constructed sequence entries, part 271.
524. gbcon272.seq - Constructed sequence entries, part 272.
525. gbcon273.seq - Constructed sequence entries, part 273.
526. gbcon274.seq - Constructed sequence entries, part 274.
527. gbcon275.seq - Constructed sequence entries, part 275.
528. gbcon276.seq - Constructed sequence entries, part 276.
529. gbcon277.seq - Constructed sequence entries, part 277.
530. gbcon278.seq - Constructed sequence entries, part 278.
531. gbcon279.seq - Constructed sequence entries, part 279.
532. gbcon28.seq - Constructed sequence entries, part 28.
533. gbcon280.seq - Constructed sequence entries, part 280.
534. gbcon281.seq - Constructed sequence entries, part 281.
535. gbcon282.seq - Constructed sequence entries, part 282.
536. gbcon283.seq - Constructed sequence entries, part 283.
537. gbcon284.seq - Constructed sequence entries, part 284.
538. gbcon285.seq - Constructed sequence entries, part 285.
539. gbcon286.seq - Constructed sequence entries, part 286.
540. gbcon287.seq - Constructed sequence entries, part 287.
541. gbcon288.seq - Constructed sequence entries, part 288.
542. gbcon289.seq - Constructed sequence entries, part 289.
543. gbcon29.seq - Constructed sequence entries, part 29.
544. gbcon290.seq - Constructed sequence entries, part 290.
545. gbcon291.seq - Constructed sequence entries, part 291.
546. gbcon292.seq - Constructed sequence entries, part 292.
547. gbcon293.seq - Constructed sequence entries, part 293.
548. gbcon294.seq - Constructed sequence entries, part 294.
549. gbcon295.seq - Constructed sequence entries, part 295.
550. gbcon296.seq - Constructed sequence entries, part 296.
551. gbcon297.seq - Constructed sequence entries, part 297.
552. gbcon298.seq - Constructed sequence entries, part 298.
553. gbcon299.seq - Constructed sequence entries, part 299.
554. gbcon3.seq - Constructed sequence entries, part 3.
555. gbcon30.seq - Constructed sequence entries, part 30.
556. gbcon300.seq - Constructed sequence entries, part 300.
557. gbcon301.seq - Constructed sequence entries, part 301.
558. gbcon302.seq - Constructed sequence entries, part 302.
559. gbcon303.seq - Constructed sequence entries, part 303.
560. gbcon304.seq - Constructed sequence entries, part 304.
561. gbcon305.seq - Constructed sequence entries, part 305.
562. gbcon306.seq - Constructed sequence entries, part 306.
563. gbcon307.seq - Constructed sequence entries, part 307.
564. gbcon308.seq - Constructed sequence entries, part 308.
565. gbcon309.seq - Constructed sequence entries, part 309.
566. gbcon31.seq - Constructed sequence entries, part 31.
567. gbcon310.seq - Constructed sequence entries, part 310.
568. gbcon311.seq - Constructed sequence entries, part 311.
569. gbcon312.seq - Constructed sequence entries, part 312.
570. gbcon313.seq - Constructed sequence entries, part 313.
571. gbcon314.seq - Constructed sequence entries, part 314.
572. gbcon315.seq - Constructed sequence entries, part 315.
573. gbcon316.seq - Constructed sequence entries, part 316.
574. gbcon317.seq - Constructed sequence entries, part 317.
575. gbcon318.seq - Constructed sequence entries, part 318.
576. gbcon319.seq - Constructed sequence entries, part 319.
577. gbcon32.seq - Constructed sequence entries, part 32.
578. gbcon320.seq - Constructed sequence entries, part 320.
579. gbcon321.seq - Constructed sequence entries, part 321.
580. gbcon322.seq - Constructed sequence entries, part 322.
581. gbcon323.seq - Constructed sequence entries, part 323.
582. gbcon324.seq - Constructed sequence entries, part 324.
583. gbcon325.seq - Constructed sequence entries, part 325.
584. gbcon326.seq - Constructed sequence entries, part 326.
585. gbcon327.seq - Constructed sequence entries, part 327.
586. gbcon328.seq - Constructed sequence entries, part 328.
587. gbcon329.seq - Constructed sequence entries, part 329.
588. gbcon33.seq - Constructed sequence entries, part 33.
589. gbcon330.seq - Constructed sequence entries, part 330.
590. gbcon331.seq - Constructed sequence entries, part 331.
591. gbcon332.seq - Constructed sequence entries, part 332.
592. gbcon333.seq - Constructed sequence entries, part 333.
593. gbcon334.seq - Constructed sequence entries, part 334.
594. gbcon335.seq - Constructed sequence entries, part 335.
595. gbcon336.seq - Constructed sequence entries, part 336.
596. gbcon337.seq - Constructed sequence entries, part 337.
597. gbcon338.seq - Constructed sequence entries, part 338.
598. gbcon339.seq - Constructed sequence entries, part 339.
599. gbcon34.seq - Constructed sequence entries, part 34.
600. gbcon340.seq - Constructed sequence entries, part 340.
601. gbcon341.seq - Constructed sequence entries, part 341.
602. gbcon342.seq - Constructed sequence entries, part 342.
603. gbcon343.seq - Constructed sequence entries, part 343.
604. gbcon344.seq - Constructed sequence entries, part 344.
605. gbcon345.seq - Constructed sequence entries, part 345.
606. gbcon346.seq - Constructed sequence entries, part 346.
607. gbcon347.seq - Constructed sequence entries, part 347.
608. gbcon348.seq - Constructed sequence entries, part 348.
609. gbcon349.seq - Constructed sequence entries, part 349.
610. gbcon35.seq - Constructed sequence entries, part 35.
611. gbcon350.seq - Constructed sequence entries, part 350.
612. gbcon351.seq - Constructed sequence entries, part 351.
613. gbcon352.seq - Constructed sequence entries, part 352.
614. gbcon353.seq - Constructed sequence entries, part 353.
615. gbcon354.seq - Constructed sequence entries, part 354.
616. gbcon355.seq - Constructed sequence entries, part 355.
617. gbcon356.seq - Constructed sequence entries, part 356.
618. gbcon36.seq - Constructed sequence entries, part 36.
619. gbcon37.seq - Constructed sequence entries, part 37.
620. gbcon38.seq - Constructed sequence entries, part 38.
621. gbcon39.seq - Constructed sequence entries, part 39.
622. gbcon4.seq - Constructed sequence entries, part 4.
623. gbcon40.seq - Constructed sequence entries, part 40.
624. gbcon41.seq - Constructed sequence entries, part 41.
625. gbcon42.seq - Constructed sequence entries, part 42.
626. gbcon43.seq - Constructed sequence entries, part 43.
627. gbcon44.seq - Constructed sequence entries, part 44.
628. gbcon45.seq - Constructed sequence entries, part 45.
629. gbcon46.seq - Constructed sequence entries, part 46.
630. gbcon47.seq - Constructed sequence entries, part 47.
631. gbcon48.seq - Constructed sequence entries, part 48.
632. gbcon49.seq - Constructed sequence entries, part 49.
633. gbcon5.seq - Constructed sequence entries, part 5.
634. gbcon50.seq - Constructed sequence entries, part 50.
635. gbcon51.seq - Constructed sequence entries, part 51.
636. gbcon52.seq - Constructed sequence entries, part 52.
637. gbcon53.seq - Constructed sequence entries, part 53.
638. gbcon54.seq - Constructed sequence entries, part 54.
639. gbcon55.seq - Constructed sequence entries, part 55.
640. gbcon56.seq - Constructed sequence entries, part 56.
641. gbcon57.seq - Constructed sequence entries, part 57.
642. gbcon58.seq - Constructed sequence entries, part 58.
643. gbcon59.seq - Constructed sequence entries, part 59.
644. gbcon6.seq - Constructed sequence entries, part 6.
645. gbcon60.seq - Constructed sequence entries, part 60.
646. gbcon61.seq - Constructed sequence entries, part 61.
647. gbcon62.seq - Constructed sequence entries, part 62.
648. gbcon63.seq - Constructed sequence entries, part 63.
649. gbcon64.seq - Constructed sequence entries, part 64.
650. gbcon65.seq - Constructed sequence entries, part 65.
651. gbcon66.seq - Constructed sequence entries, part 66.
652. gbcon67.seq - Constructed sequence entries, part 67.
653. gbcon68.seq - Constructed sequence entries, part 68.
654. gbcon69.seq - Constructed sequence entries, part 69.
655. gbcon7.seq - Constructed sequence entries, part 7.
656. gbcon70.seq - Constructed sequence entries, part 70.
657. gbcon71.seq - Constructed sequence entries, part 71.
658. gbcon72.seq - Constructed sequence entries, part 72.
659. gbcon73.seq - Constructed sequence entries, part 73.
660. gbcon74.seq - Constructed sequence entries, part 74.
661. gbcon75.seq - Constructed sequence entries, part 75.
662. gbcon76.seq - Constructed sequence entries, part 76.
663. gbcon77.seq - Constructed sequence entries, part 77.
664. gbcon78.seq - Constructed sequence entries, part 78.
665. gbcon79.seq - Constructed sequence entries, part 79.
666. gbcon8.seq - Constructed sequence entries, part 8.
667. gbcon80.seq - Constructed sequence entries, part 80.
668. gbcon81.seq - Constructed sequence entries, part 81.
669. gbcon82.seq - Constructed sequence entries, part 82.
670. gbcon83.seq - Constructed sequence entries, part 83.
671. gbcon84.seq - Constructed sequence entries, part 84.
672. gbcon85.seq - Constructed sequence entries, part 85.
673. gbcon86.seq - Constructed sequence entries, part 86.
674. gbcon87.seq - Constructed sequence entries, part 87.
675. gbcon88.seq - Constructed sequence entries, part 88.
676. gbcon89.seq - Constructed sequence entries, part 89.
677. gbcon9.seq - Constructed sequence entries, part 9.
678. gbcon90.seq - Constructed sequence entries, part 90.
679. gbcon91.seq - Constructed sequence entries, part 91.
680. gbcon92.seq - Constructed sequence entries, part 92.
681. gbcon93.seq - Constructed sequence entries, part 93.
682. gbcon94.seq - Constructed sequence entries, part 94.
683. gbcon95.seq - Constructed sequence entries, part 95.
684. gbcon96.seq - Constructed sequence entries, part 96.
685. gbcon97.seq - Constructed sequence entries, part 97.
686. gbcon98.seq - Constructed sequence entries, part 98.
687. gbcon99.seq - Constructed sequence entries, part 99.
688. gbdel.txt - Accession numbers of entries deleted since the previous release.
689. gbenv1.seq - Environmental sampling sequence entries, part 1.
690. gbenv10.seq - Environmental sampling sequence entries, part 10.
691. gbenv11.seq - Environmental sampling sequence entries, part 11.
692. gbenv12.seq - Environmental sampling sequence entries, part 12.
693. gbenv13.seq - Environmental sampling sequence entries, part 13.
694. gbenv14.seq - Environmental sampling sequence entries, part 14.
695. gbenv15.seq - Environmental sampling sequence entries, part 15.
696. gbenv16.seq - Environmental sampling sequence entries, part 16.
697. gbenv17.seq - Environmental sampling sequence entries, part 17.
698. gbenv18.seq - Environmental sampling sequence entries, part 18.
699. gbenv19.seq - Environmental sampling sequence entries, part 19.
700. gbenv2.seq - Environmental sampling sequence entries, part 2.
701. gbenv20.seq - Environmental sampling sequence entries, part 20.
702. gbenv21.seq - Environmental sampling sequence entries, part 21.
703. gbenv22.seq - Environmental sampling sequence entries, part 22.
704. gbenv23.seq - Environmental sampling sequence entries, part 23.
705. gbenv24.seq - Environmental sampling sequence entries, part 24.
706. gbenv25.seq - Environmental sampling sequence entries, part 25.
707. gbenv26.seq - Environmental sampling sequence entries, part 26.
708. gbenv27.seq - Environmental sampling sequence entries, part 27.
709. gbenv28.seq - Environmental sampling sequence entries, part 28.
710. gbenv29.seq - Environmental sampling sequence entries, part 29.
711. gbenv3.seq - Environmental sampling sequence entries, part 3.
712. gbenv30.seq - Environmental sampling sequence entries, part 30.
713. gbenv31.seq - Environmental sampling sequence entries, part 31.
714. gbenv32.seq - Environmental sampling sequence entries, part 32.
715. gbenv33.seq - Environmental sampling sequence entries, part 33.
716. gbenv34.seq - Environmental sampling sequence entries, part 34.
717. gbenv35.seq - Environmental sampling sequence entries, part 35.
718. gbenv36.seq - Environmental sampling sequence entries, part 36.
719. gbenv37.seq - Environmental sampling sequence entries, part 37.
720. gbenv38.seq - Environmental sampling sequence entries, part 38.
721. gbenv39.seq - Environmental sampling sequence entries, part 39.
722. gbenv4.seq - Environmental sampling sequence entries, part 4.
723. gbenv40.seq - Environmental sampling sequence entries, part 40.
724. gbenv41.seq - Environmental sampling sequence entries, part 41.
725. gbenv42.seq - Environmental sampling sequence entries, part 42.
726. gbenv43.seq - Environmental sampling sequence entries, part 43.
727. gbenv44.seq - Environmental sampling sequence entries, part 44.
728. gbenv45.seq - Environmental sampling sequence entries, part 45.
729. gbenv46.seq - Environmental sampling sequence entries, part 46.
730. gbenv47.seq - Environmental sampling sequence entries, part 47.
731. gbenv48.seq - Environmental sampling sequence entries, part 48.
732. gbenv49.seq - Environmental sampling sequence entries, part 49.
733. gbenv5.seq - Environmental sampling sequence entries, part 5.
734. gbenv50.seq - Environmental sampling sequence entries, part 50.
735. gbenv51.seq - Environmental sampling sequence entries, part 51.
736. gbenv52.seq - Environmental sampling sequence entries, part 52.
737. gbenv53.seq - Environmental sampling sequence entries, part 53.
738. gbenv54.seq - Environmental sampling sequence entries, part 54.
739. gbenv55.seq - Environmental sampling sequence entries, part 55.
740. gbenv56.seq - Environmental sampling sequence entries, part 56.
741. gbenv57.seq - Environmental sampling sequence entries, part 57.
742. gbenv58.seq - Environmental sampling sequence entries, part 58.
743. gbenv59.seq - Environmental sampling sequence entries, part 59.
744. gbenv6.seq - Environmental sampling sequence entries, part 6.
745. gbenv60.seq - Environmental sampling sequence entries, part 60.
746. gbenv61.seq - Environmental sampling sequence entries, part 61.
747. gbenv62.seq - Environmental sampling sequence entries, part 62.
748. gbenv63.seq - Environmental sampling sequence entries, part 63.
749. gbenv64.seq - Environmental sampling sequence entries, part 64.
750. gbenv65.seq - Environmental sampling sequence entries, part 65.
751. gbenv66.seq - Environmental sampling sequence entries, part 66.
752. gbenv67.seq - Environmental sampling sequence entries, part 67.
753. gbenv68.seq - Environmental sampling sequence entries, part 68.
754. gbenv69.seq - Environmental sampling sequence entries, part 69.
755. gbenv7.seq - Environmental sampling sequence entries, part 7.
756. gbenv70.seq - Environmental sampling sequence entries, part 70.
757. gbenv71.seq - Environmental sampling sequence entries, part 71.
758. gbenv72.seq - Environmental sampling sequence entries, part 72.
759. gbenv73.seq - Environmental sampling sequence entries, part 73.
760. gbenv74.seq - Environmental sampling sequence entries, part 74.
761. gbenv75.seq - Environmental sampling sequence entries, part 75.
762. gbenv76.seq - Environmental sampling sequence entries, part 76.
763. gbenv77.seq - Environmental sampling sequence entries, part 77.
764. gbenv78.seq - Environmental sampling sequence entries, part 78.
765. gbenv79.seq - Environmental sampling sequence entries, part 79.
766. gbenv8.seq - Environmental sampling sequence entries, part 8.
767. gbenv80.seq - Environmental sampling sequence entries, part 80.
768. gbenv81.seq - Environmental sampling sequence entries, part 81.
769. gbenv82.seq - Environmental sampling sequence entries, part 82.
770. gbenv83.seq - Environmental sampling sequence entries, part 83.
771. gbenv84.seq - Environmental sampling sequence entries, part 84.
772. gbenv85.seq - Environmental sampling sequence entries, part 85.
773. gbenv86.seq - Environmental sampling sequence entries, part 86.
774. gbenv87.seq - Environmental sampling sequence entries, part 87.
775. gbenv88.seq - Environmental sampling sequence entries, part 88.
776. gbenv89.seq - Environmental sampling sequence entries, part 89.
777. gbenv9.seq - Environmental sampling sequence entries, part 9.
778. gbenv90.seq - Environmental sampling sequence entries, part 90.
779. gbenv91.seq - Environmental sampling sequence entries, part 91.
780. gbenv92.seq - Environmental sampling sequence entries, part 92.
781. gbenv93.seq - Environmental sampling sequence entries, part 93.
782. gbenv94.seq - Environmental sampling sequence entries, part 94.
783. gbenv95.seq - Environmental sampling sequence entries, part 95.
784. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
785. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
786. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
787. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
788. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
789. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
790. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
791. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
792. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
793. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
794. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
795. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
796. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
797. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
798. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
799. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
800. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
801. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
802. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
803. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
804. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
805. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
806. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
807. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
808. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
809. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
810. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
811. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
812. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
813. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
814. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
815. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
816. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
817. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
818. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
819. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
820. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
821. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
822. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
823. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
824. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
825. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
826. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
827. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
828. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
829. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
830. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
831. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
832. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
833. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
834. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
835. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
836. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
837. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
838. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
839. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
840. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
841. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
842. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
843. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
844. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
845. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
846. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
847. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
848. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
849. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
850. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
851. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
852. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
853. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
854. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
855. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
856. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
857. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
858. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
859. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
860. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
861. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
862. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
863. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
864. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
865. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
866. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
867. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
868. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
869. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
870. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
871. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
872. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
873. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
874. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
875. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
876. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
877. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
878. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
879. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
880. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
881. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
882. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
883. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
884. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
885. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
886. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
887. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
888. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
889. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
890. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
891. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
892. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
893. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
894. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
895. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
896. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
897. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
898. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
899. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
900. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
901. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
902. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
903. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
904. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
905. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
906. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
907. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
908. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
909. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
910. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
911. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
912. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
913. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
914. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
915. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
916. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
917. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
918. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
919. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
920. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
921. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
922. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
923. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
924. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
925. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
926. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
927. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
928. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
929. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
930. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
931. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
932. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
933. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
934. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
935. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
936. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
937. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
938. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
939. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
940. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
941. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
942. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
943. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
944. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
945. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
946. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
947. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
948. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
949. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
950. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
951. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
952. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
953. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
954. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
955. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
956. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
957. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
958. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
959. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
960. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
961. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
962. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
963. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
964. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
965. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
966. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
967. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
968. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
969. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
970. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
971. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
972. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
973. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
974. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
975. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
976. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
977. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
978. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
979. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
980. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
981. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
982. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
983. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
984. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
985. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
986. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
987. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
988. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
989. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
990. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
991. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
992. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
993. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
994. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
995. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
996. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
997. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
998. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
999. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1000. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1001. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1002. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1003. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1004. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1005. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1006. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1007. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1008. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1009. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1010. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1011. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1012. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1013. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1014. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1015. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1016. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1017. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1018. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1019. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1020. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1021. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1022. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1023. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1024. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1025. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1026. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1027. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1028. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1029. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1030. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1031. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1032. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1033. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1034. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1035. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1036. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1037. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1038. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1039. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1040. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1041. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1042. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1043. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1044. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1045. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1046. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1047. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1048. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1049. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1050. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1051. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1052. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1053. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1054. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1055. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1056. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1057. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1058. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1059. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1060. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1061. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1062. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1063. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1064. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1065. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1066. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1067. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1068. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1069. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1070. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1071. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1072. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1073. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1074. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1075. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1076. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1077. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1078. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1079. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1080. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1081. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1082. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1083. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1084. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1085. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1086. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1087. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1088. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1089. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1090. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1091. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1092. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1093. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1094. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1095. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1096. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1097. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1098. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1099. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1100. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1101. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1102. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1103. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1104. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1105. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1106. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1107. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1108. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1109. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1110. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1111. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1112. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1113. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1114. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1115. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1116. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1117. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1118. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1119. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1120. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1121. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1122. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1123. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1124. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1125. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1126. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1127. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1128. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1129. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1130. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1131. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1132. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1133. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1134. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1135. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1136. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1137. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1138. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1139. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1140. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1141. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1142. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1143. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1144. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1145. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1146. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1147. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1148. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1149. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1150. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1151. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1152. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1153. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1154. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1155. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1156. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1157. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1158. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1159. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1160. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1161. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1162. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1163. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1164. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1165. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1166. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1167. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1168. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1169. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1170. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1171. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1172. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1173. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1174. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1175. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1176. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1177. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1178. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1179. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1180. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1181. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1182. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1183. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1184. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1185. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1186. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1187. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1188. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1189. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1190. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1191. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1192. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1193. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1194. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1195. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1196. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1197. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1198. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1199. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1200. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1201. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1202. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1203. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1204. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1205. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1206. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1207. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1208. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1209. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1210. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1211. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1212. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1213. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1214. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1215. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1216. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1217. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1218. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1219. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1220. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1221. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1222. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1223. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1224. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1225. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1226. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1227. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1228. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1229. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1230. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1231. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1232. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1233. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1234. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1235. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1236. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1237. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1238. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1239. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1240. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1241. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1242. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1243. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1244. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1245. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1246. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1247. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1248. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1249. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1250. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1251. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1252. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1253. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1254. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1255. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1256. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1257. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1258. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1259. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1260. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1261. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1262. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1263. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1264. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1265. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1266. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1267. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1268. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1269. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1270. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1271. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1272. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1273. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1274. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1275. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1276. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1277. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1278. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1279. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1280. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1281. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1282. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1283. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1284. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1285. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1286. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1287. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1288. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1289. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1290. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1291. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1292. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1293. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1294. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1295. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1296. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1297. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1298. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1299. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1300. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1301. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1302. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1303. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1304. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1305. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1306. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1307. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1308. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1309. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1310. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1311. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1312. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1313. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1314. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1315. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1316. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1317. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1318. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1319. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1320. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1321. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1322. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1323. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1324. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1325. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1326. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1327. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1328. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1329. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1330. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1331. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1332. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1333. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1334. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1335. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1336. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1337. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1338. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1339. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1340. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1341. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1342. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1343. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1344. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1345. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1346. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1347. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1348. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1349. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1350. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1351. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1352. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1353. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1354. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1355. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1356. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1357. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1358. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1359. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1360. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1361. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1362. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1363. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1364. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1365. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1366. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1367. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1368. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1369. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1370. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1371. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1372. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1373. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1374. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1375. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1376. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1377. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1378. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1379. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1380. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1381. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1382. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1383. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1384. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1385. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1386. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1387. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1388. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1389. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1390. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1391. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1392. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1393. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1394. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1395. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1396. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1397. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1398. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1399. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1400. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1401. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1402. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1403. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1404. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1405. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1406. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1407. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1408. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1409. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1410. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1411. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1412. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1413. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1414. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1415. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1416. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1417. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1418. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1419. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1420. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1421. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1422. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1423. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1424. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1425. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1426. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1427. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1428. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1429. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1430. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1431. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1432. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1433. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1434. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1435. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1436. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1437. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1438. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1439. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1440. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1441. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1442. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1443. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1444. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1445. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1446. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1447. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1448. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1449. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1450. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1451. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1452. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1453. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1454. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1455. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1456. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1457. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1458. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1459. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1460. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1461. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1462. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1463. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1464. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1465. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1466. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1467. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1468. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1469. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1470. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1471. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1472. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1473. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1474. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1475. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1476. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1477. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1478. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1479. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1480. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1481. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1482. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1483. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1484. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1485. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1486. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1487. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1488. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1489. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1490. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1491. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1492. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1493. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1494. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1495. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1496. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1497. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1498. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1499. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1500. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1501. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1502. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1503. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1504. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1505. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1506. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1507. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1508. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1509. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1510. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1511. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1512. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1513. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1514. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1515. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1516. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1517. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1518. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1519. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1520. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1521. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1522. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1523. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1524. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1525. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1526. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1527. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1528. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1529. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1530. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1531. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1532. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1533. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1534. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1535. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1536. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1537. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1538. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1539. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1540. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1541. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1542. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1543. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1544. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1545. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1546. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1547. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1548. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1549. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1550. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1551. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1552. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1553. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1554. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1555. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1556. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1557. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1558. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1559. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1560. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1561. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1562. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1563. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1564. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1565. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1566. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1567. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1568. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1569. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1570. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1571. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1572. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1573. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1574. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1575. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1576. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1577. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1578. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1579. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1580. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1581. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1582. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1583. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1584. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1585. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1586. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1587. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1588. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1589. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1590. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1591. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1592. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1593. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1594. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1595. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1596. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1597. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1598. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1599. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1600. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1601. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1602. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1603. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1604. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1605. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1606. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1607. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1608. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1609. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1610. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1611. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1612. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1613. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1614. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1615. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1616. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1617. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1618. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1619. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1620. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1621. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1622. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1623. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1624. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1625. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1626. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1627. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1628. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1629. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1630. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1631. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1632. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1633. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1634. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1635. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1636. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1637. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1638. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1639. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1640. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1641. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1642. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1643. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1644. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1645. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1646. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1647. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1648. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1649. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1650. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1651. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1652. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1653. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1654. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1655. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1656. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1657. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1658. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1659. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1660. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1661. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1662. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1663. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1664. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1665. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1666. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1667. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1668. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1669. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1670. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1671. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1672. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1673. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1674. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1675. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1676. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1677. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1678. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1679. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1680. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1681. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1682. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1683. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1684. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1685. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1686. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1687. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1688. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1689. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1690. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1691. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1692. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1693. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1694. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1695. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1696. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1697. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1698. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1699. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1700. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1701. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1702. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1703. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1704. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1705. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1706. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1707. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1708. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1709. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1710. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1711. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1712. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1713. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1714. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1715. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1716. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1717. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1718. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1719. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1720. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1721. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1722. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1723. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1724. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1725. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1726. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1727. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1728. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1729. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1730. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1731. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1732. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1733. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1734. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1735. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1736. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1737. gbinv1.seq - Invertebrate sequence entries, part 1.
1738. gbinv10.seq - Invertebrate sequence entries, part 10.
1739. gbinv100.seq - Invertebrate sequence entries, part 100.
1740. gbinv101.seq - Invertebrate sequence entries, part 101.
1741. gbinv102.seq - Invertebrate sequence entries, part 102.
1742. gbinv103.seq - Invertebrate sequence entries, part 103.
1743. gbinv104.seq - Invertebrate sequence entries, part 104.
1744. gbinv105.seq - Invertebrate sequence entries, part 105.
1745. gbinv106.seq - Invertebrate sequence entries, part 106.
1746. gbinv107.seq - Invertebrate sequence entries, part 107.
1747. gbinv108.seq - Invertebrate sequence entries, part 108.
1748. gbinv109.seq - Invertebrate sequence entries, part 109.
1749. gbinv11.seq - Invertebrate sequence entries, part 11.
1750. gbinv110.seq - Invertebrate sequence entries, part 110.
1751. gbinv111.seq - Invertebrate sequence entries, part 111.
1752. gbinv112.seq - Invertebrate sequence entries, part 112.
1753. gbinv113.seq - Invertebrate sequence entries, part 113.
1754. gbinv114.seq - Invertebrate sequence entries, part 114.
1755. gbinv115.seq - Invertebrate sequence entries, part 115.
1756. gbinv116.seq - Invertebrate sequence entries, part 116.
1757. gbinv117.seq - Invertebrate sequence entries, part 117.
1758. gbinv118.seq - Invertebrate sequence entries, part 118.
1759. gbinv119.seq - Invertebrate sequence entries, part 119.
1760. gbinv12.seq - Invertebrate sequence entries, part 12.
1761. gbinv120.seq - Invertebrate sequence entries, part 120.
1762. gbinv121.seq - Invertebrate sequence entries, part 121.
1763. gbinv122.seq - Invertebrate sequence entries, part 122.
1764. gbinv123.seq - Invertebrate sequence entries, part 123.
1765. gbinv124.seq - Invertebrate sequence entries, part 124.
1766. gbinv125.seq - Invertebrate sequence entries, part 125.
1767. gbinv126.seq - Invertebrate sequence entries, part 126.
1768. gbinv127.seq - Invertebrate sequence entries, part 127.
1769. gbinv128.seq - Invertebrate sequence entries, part 128.
1770. gbinv129.seq - Invertebrate sequence entries, part 129.
1771. gbinv13.seq - Invertebrate sequence entries, part 13.
1772. gbinv130.seq - Invertebrate sequence entries, part 130.
1773. gbinv131.seq - Invertebrate sequence entries, part 131.
1774. gbinv132.seq - Invertebrate sequence entries, part 132.
1775. gbinv133.seq - Invertebrate sequence entries, part 133.
1776. gbinv134.seq - Invertebrate sequence entries, part 134.
1777. gbinv135.seq - Invertebrate sequence entries, part 135.
1778. gbinv136.seq - Invertebrate sequence entries, part 136.
1779. gbinv137.seq - Invertebrate sequence entries, part 137.
1780. gbinv138.seq - Invertebrate sequence entries, part 138.
1781. gbinv139.seq - Invertebrate sequence entries, part 139.
1782. gbinv14.seq - Invertebrate sequence entries, part 14.
1783. gbinv140.seq - Invertebrate sequence entries, part 140.
1784. gbinv141.seq - Invertebrate sequence entries, part 141.
1785. gbinv142.seq - Invertebrate sequence entries, part 142.
1786. gbinv143.seq - Invertebrate sequence entries, part 143.
1787. gbinv144.seq - Invertebrate sequence entries, part 144.
1788. gbinv145.seq - Invertebrate sequence entries, part 145.
1789. gbinv146.seq - Invertebrate sequence entries, part 146.
1790. gbinv147.seq - Invertebrate sequence entries, part 147.
1791. gbinv148.seq - Invertebrate sequence entries, part 148.
1792. gbinv149.seq - Invertebrate sequence entries, part 149.
1793. gbinv15.seq - Invertebrate sequence entries, part 15.
1794. gbinv150.seq - Invertebrate sequence entries, part 150.
1795. gbinv151.seq - Invertebrate sequence entries, part 151.
1796. gbinv152.seq - Invertebrate sequence entries, part 152.
1797. gbinv16.seq - Invertebrate sequence entries, part 16.
1798. gbinv17.seq - Invertebrate sequence entries, part 17.
1799. gbinv18.seq - Invertebrate sequence entries, part 18.
1800. gbinv19.seq - Invertebrate sequence entries, part 19.
1801. gbinv2.seq - Invertebrate sequence entries, part 2.
1802. gbinv20.seq - Invertebrate sequence entries, part 20.
1803. gbinv21.seq - Invertebrate sequence entries, part 21.
1804. gbinv22.seq - Invertebrate sequence entries, part 22.
1805. gbinv23.seq - Invertebrate sequence entries, part 23.
1806. gbinv24.seq - Invertebrate sequence entries, part 24.
1807. gbinv25.seq - Invertebrate sequence entries, part 25.
1808. gbinv26.seq - Invertebrate sequence entries, part 26.
1809. gbinv27.seq - Invertebrate sequence entries, part 27.
1810. gbinv28.seq - Invertebrate sequence entries, part 28.
1811. gbinv29.seq - Invertebrate sequence entries, part 29.
1812. gbinv3.seq - Invertebrate sequence entries, part 3.
1813. gbinv30.seq - Invertebrate sequence entries, part 30.
1814. gbinv31.seq - Invertebrate sequence entries, part 31.
1815. gbinv32.seq - Invertebrate sequence entries, part 32.
1816. gbinv33.seq - Invertebrate sequence entries, part 33.
1817. gbinv34.seq - Invertebrate sequence entries, part 34.
1818. gbinv35.seq - Invertebrate sequence entries, part 35.
1819. gbinv36.seq - Invertebrate sequence entries, part 36.
1820. gbinv37.seq - Invertebrate sequence entries, part 37.
1821. gbinv38.seq - Invertebrate sequence entries, part 38.
1822. gbinv39.seq - Invertebrate sequence entries, part 39.
1823. gbinv4.seq - Invertebrate sequence entries, part 4.
1824. gbinv40.seq - Invertebrate sequence entries, part 40.
1825. gbinv41.seq - Invertebrate sequence entries, part 41.
1826. gbinv42.seq - Invertebrate sequence entries, part 42.
1827. gbinv43.seq - Invertebrate sequence entries, part 43.
1828. gbinv44.seq - Invertebrate sequence entries, part 44.
1829. gbinv45.seq - Invertebrate sequence entries, part 45.
1830. gbinv46.seq - Invertebrate sequence entries, part 46.
1831. gbinv47.seq - Invertebrate sequence entries, part 47.
1832. gbinv48.seq - Invertebrate sequence entries, part 48.
1833. gbinv49.seq - Invertebrate sequence entries, part 49.
1834. gbinv5.seq - Invertebrate sequence entries, part 5.
1835. gbinv50.seq - Invertebrate sequence entries, part 50.
1836. gbinv51.seq - Invertebrate sequence entries, part 51.
1837. gbinv52.seq - Invertebrate sequence entries, part 52.
1838. gbinv53.seq - Invertebrate sequence entries, part 53.
1839. gbinv54.seq - Invertebrate sequence entries, part 54.
1840. gbinv55.seq - Invertebrate sequence entries, part 55.
1841. gbinv56.seq - Invertebrate sequence entries, part 56.
1842. gbinv57.seq - Invertebrate sequence entries, part 57.
1843. gbinv58.seq - Invertebrate sequence entries, part 58.
1844. gbinv59.seq - Invertebrate sequence entries, part 59.
1845. gbinv6.seq - Invertebrate sequence entries, part 6.
1846. gbinv60.seq - Invertebrate sequence entries, part 60.
1847. gbinv61.seq - Invertebrate sequence entries, part 61.
1848. gbinv62.seq - Invertebrate sequence entries, part 62.
1849. gbinv63.seq - Invertebrate sequence entries, part 63.
1850. gbinv64.seq - Invertebrate sequence entries, part 64.
1851. gbinv65.seq - Invertebrate sequence entries, part 65.
1852. gbinv66.seq - Invertebrate sequence entries, part 66.
1853. gbinv67.seq - Invertebrate sequence entries, part 67.
1854. gbinv68.seq - Invertebrate sequence entries, part 68.
1855. gbinv69.seq - Invertebrate sequence entries, part 69.
1856. gbinv7.seq - Invertebrate sequence entries, part 7.
1857. gbinv70.seq - Invertebrate sequence entries, part 70.
1858. gbinv71.seq - Invertebrate sequence entries, part 71.
1859. gbinv72.seq - Invertebrate sequence entries, part 72.
1860. gbinv73.seq - Invertebrate sequence entries, part 73.
1861. gbinv74.seq - Invertebrate sequence entries, part 74.
1862. gbinv75.seq - Invertebrate sequence entries, part 75.
1863. gbinv76.seq - Invertebrate sequence entries, part 76.
1864. gbinv77.seq - Invertebrate sequence entries, part 77.
1865. gbinv78.seq - Invertebrate sequence entries, part 78.
1866. gbinv79.seq - Invertebrate sequence entries, part 79.
1867. gbinv8.seq - Invertebrate sequence entries, part 8.
1868. gbinv80.seq - Invertebrate sequence entries, part 80.
1869. gbinv81.seq - Invertebrate sequence entries, part 81.
1870. gbinv82.seq - Invertebrate sequence entries, part 82.
1871. gbinv83.seq - Invertebrate sequence entries, part 83.
1872. gbinv84.seq - Invertebrate sequence entries, part 84.
1873. gbinv85.seq - Invertebrate sequence entries, part 85.
1874. gbinv86.seq - Invertebrate sequence entries, part 86.
1875. gbinv87.seq - Invertebrate sequence entries, part 87.
1876. gbinv88.seq - Invertebrate sequence entries, part 88.
1877. gbinv89.seq - Invertebrate sequence entries, part 89.
1878. gbinv9.seq - Invertebrate sequence entries, part 9.
1879. gbinv90.seq - Invertebrate sequence entries, part 90.
1880. gbinv91.seq - Invertebrate sequence entries, part 91.
1881. gbinv92.seq - Invertebrate sequence entries, part 92.
1882. gbinv93.seq - Invertebrate sequence entries, part 93.
1883. gbinv94.seq - Invertebrate sequence entries, part 94.
1884. gbinv95.seq - Invertebrate sequence entries, part 95.
1885. gbinv96.seq - Invertebrate sequence entries, part 96.
1886. gbinv97.seq - Invertebrate sequence entries, part 97.
1887. gbinv98.seq - Invertebrate sequence entries, part 98.
1888. gbinv99.seq - Invertebrate sequence entries, part 99.
1889. gbmam1.seq - Other mammalian sequence entries, part 1.
1890. gbmam10.seq - Other mammalian sequence entries, part 10.
1891. gbmam11.seq - Other mammalian sequence entries, part 11.
1892. gbmam12.seq - Other mammalian sequence entries, part 12.
1893. gbmam13.seq - Other mammalian sequence entries, part 13.
1894. gbmam14.seq - Other mammalian sequence entries, part 14.
1895. gbmam15.seq - Other mammalian sequence entries, part 15.
1896. gbmam16.seq - Other mammalian sequence entries, part 16.
1897. gbmam17.seq - Other mammalian sequence entries, part 17.
1898. gbmam18.seq - Other mammalian sequence entries, part 18.
1899. gbmam19.seq - Other mammalian sequence entries, part 19.
1900. gbmam2.seq - Other mammalian sequence entries, part 2.
1901. gbmam20.seq - Other mammalian sequence entries, part 20.
1902. gbmam21.seq - Other mammalian sequence entries, part 21.
1903. gbmam22.seq - Other mammalian sequence entries, part 22.
1904. gbmam23.seq - Other mammalian sequence entries, part 23.
1905. gbmam24.seq - Other mammalian sequence entries, part 24.
1906. gbmam25.seq - Other mammalian sequence entries, part 25.
1907. gbmam26.seq - Other mammalian sequence entries, part 26.
1908. gbmam27.seq - Other mammalian sequence entries, part 27.
1909. gbmam28.seq - Other mammalian sequence entries, part 28.
1910. gbmam29.seq - Other mammalian sequence entries, part 29.
1911. gbmam3.seq - Other mammalian sequence entries, part 3.
1912. gbmam30.seq - Other mammalian sequence entries, part 30.
1913. gbmam31.seq - Other mammalian sequence entries, part 31.
1914. gbmam32.seq - Other mammalian sequence entries, part 32.
1915. gbmam33.seq - Other mammalian sequence entries, part 33.
1916. gbmam34.seq - Other mammalian sequence entries, part 34.
1917. gbmam35.seq - Other mammalian sequence entries, part 35.
1918. gbmam36.seq - Other mammalian sequence entries, part 36.
1919. gbmam37.seq - Other mammalian sequence entries, part 37.
1920. gbmam38.seq - Other mammalian sequence entries, part 38.
1921. gbmam39.seq - Other mammalian sequence entries, part 39.
1922. gbmam4.seq - Other mammalian sequence entries, part 4.
1923. gbmam5.seq - Other mammalian sequence entries, part 5.
1924. gbmam6.seq - Other mammalian sequence entries, part 6.
1925. gbmam7.seq - Other mammalian sequence entries, part 7.
1926. gbmam8.seq - Other mammalian sequence entries, part 8.
1927. gbmam9.seq - Other mammalian sequence entries, part 9.
1928. gbnew.txt - Accession numbers of entries new since the previous release.
1929. gbpat1.seq - Patent sequence entries, part 1.
1930. gbpat10.seq - Patent sequence entries, part 10.
1931. gbpat100.seq - Patent sequence entries, part 100.
1932. gbpat101.seq - Patent sequence entries, part 101.
1933. gbpat102.seq - Patent sequence entries, part 102.
1934. gbpat103.seq - Patent sequence entries, part 103.
1935. gbpat104.seq - Patent sequence entries, part 104.
1936. gbpat105.seq - Patent sequence entries, part 105.
1937. gbpat106.seq - Patent sequence entries, part 106.
1938. gbpat107.seq - Patent sequence entries, part 107.
1939. gbpat108.seq - Patent sequence entries, part 108.
1940. gbpat109.seq - Patent sequence entries, part 109.
1941. gbpat11.seq - Patent sequence entries, part 11.
1942. gbpat110.seq - Patent sequence entries, part 110.
1943. gbpat111.seq - Patent sequence entries, part 111.
1944. gbpat112.seq - Patent sequence entries, part 112.
1945. gbpat113.seq - Patent sequence entries, part 113.
1946. gbpat114.seq - Patent sequence entries, part 114.
1947. gbpat115.seq - Patent sequence entries, part 115.
1948. gbpat116.seq - Patent sequence entries, part 116.
1949. gbpat117.seq - Patent sequence entries, part 117.
1950. gbpat118.seq - Patent sequence entries, part 118.
1951. gbpat119.seq - Patent sequence entries, part 119.
1952. gbpat12.seq - Patent sequence entries, part 12.
1953. gbpat120.seq - Patent sequence entries, part 120.
1954. gbpat121.seq - Patent sequence entries, part 121.
1955. gbpat122.seq - Patent sequence entries, part 122.
1956. gbpat123.seq - Patent sequence entries, part 123.
1957. gbpat124.seq - Patent sequence entries, part 124.
1958. gbpat125.seq - Patent sequence entries, part 125.
1959. gbpat126.seq - Patent sequence entries, part 126.
1960. gbpat127.seq - Patent sequence entries, part 127.
1961. gbpat128.seq - Patent sequence entries, part 128.
1962. gbpat129.seq - Patent sequence entries, part 129.
1963. gbpat13.seq - Patent sequence entries, part 13.
1964. gbpat130.seq - Patent sequence entries, part 130.
1965. gbpat131.seq - Patent sequence entries, part 131.
1966. gbpat132.seq - Patent sequence entries, part 132.
1967. gbpat133.seq - Patent sequence entries, part 133.
1968. gbpat134.seq - Patent sequence entries, part 134.
1969. gbpat135.seq - Patent sequence entries, part 135.
1970. gbpat136.seq - Patent sequence entries, part 136.
1971. gbpat137.seq - Patent sequence entries, part 137.
1972. gbpat138.seq - Patent sequence entries, part 138.
1973. gbpat139.seq - Patent sequence entries, part 139.
1974. gbpat14.seq - Patent sequence entries, part 14.
1975. gbpat140.seq - Patent sequence entries, part 140.
1976. gbpat141.seq - Patent sequence entries, part 141.
1977. gbpat142.seq - Patent sequence entries, part 142.
1978. gbpat143.seq - Patent sequence entries, part 143.
1979. gbpat144.seq - Patent sequence entries, part 144.
1980. gbpat145.seq - Patent sequence entries, part 145.
1981. gbpat146.seq - Patent sequence entries, part 146.
1982. gbpat147.seq - Patent sequence entries, part 147.
1983. gbpat148.seq - Patent sequence entries, part 148.
1984. gbpat149.seq - Patent sequence entries, part 149.
1985. gbpat15.seq - Patent sequence entries, part 15.
1986. gbpat150.seq - Patent sequence entries, part 150.
1987. gbpat151.seq - Patent sequence entries, part 151.
1988. gbpat152.seq - Patent sequence entries, part 152.
1989. gbpat153.seq - Patent sequence entries, part 153.
1990. gbpat154.seq - Patent sequence entries, part 154.
1991. gbpat155.seq - Patent sequence entries, part 155.
1992. gbpat156.seq - Patent sequence entries, part 156.
1993. gbpat157.seq - Patent sequence entries, part 157.
1994. gbpat158.seq - Patent sequence entries, part 158.
1995. gbpat159.seq - Patent sequence entries, part 159.
1996. gbpat16.seq - Patent sequence entries, part 16.
1997. gbpat160.seq - Patent sequence entries, part 160.
1998. gbpat161.seq - Patent sequence entries, part 161.
1999. gbpat162.seq - Patent sequence entries, part 162.
2000. gbpat163.seq - Patent sequence entries, part 163.
2001. gbpat164.seq - Patent sequence entries, part 164.
2002. gbpat165.seq - Patent sequence entries, part 165.
2003. gbpat166.seq - Patent sequence entries, part 166.
2004. gbpat167.seq - Patent sequence entries, part 167.
2005. gbpat168.seq - Patent sequence entries, part 168.
2006. gbpat169.seq - Patent sequence entries, part 169.
2007. gbpat17.seq - Patent sequence entries, part 17.
2008. gbpat170.seq - Patent sequence entries, part 170.
2009. gbpat171.seq - Patent sequence entries, part 171.
2010. gbpat172.seq - Patent sequence entries, part 172.
2011. gbpat173.seq - Patent sequence entries, part 173.
2012. gbpat174.seq - Patent sequence entries, part 174.
2013. gbpat175.seq - Patent sequence entries, part 175.
2014. gbpat176.seq - Patent sequence entries, part 176.
2015. gbpat177.seq - Patent sequence entries, part 177.
2016. gbpat178.seq - Patent sequence entries, part 178.
2017. gbpat179.seq - Patent sequence entries, part 179.
2018. gbpat18.seq - Patent sequence entries, part 18.
2019. gbpat180.seq - Patent sequence entries, part 180.
2020. gbpat181.seq - Patent sequence entries, part 181.
2021. gbpat182.seq - Patent sequence entries, part 182.
2022. gbpat183.seq - Patent sequence entries, part 183.
2023. gbpat184.seq - Patent sequence entries, part 184.
2024. gbpat185.seq - Patent sequence entries, part 185.
2025. gbpat186.seq - Patent sequence entries, part 186.
2026. gbpat187.seq - Patent sequence entries, part 187.
2027. gbpat188.seq - Patent sequence entries, part 188.
2028. gbpat189.seq - Patent sequence entries, part 189.
2029. gbpat19.seq - Patent sequence entries, part 19.
2030. gbpat190.seq - Patent sequence entries, part 190.
2031. gbpat191.seq - Patent sequence entries, part 191.
2032. gbpat192.seq - Patent sequence entries, part 192.
2033. gbpat193.seq - Patent sequence entries, part 193.
2034. gbpat194.seq - Patent sequence entries, part 194.
2035. gbpat195.seq - Patent sequence entries, part 195.
2036. gbpat196.seq - Patent sequence entries, part 196.
2037. gbpat197.seq - Patent sequence entries, part 197.
2038. gbpat198.seq - Patent sequence entries, part 198.
2039. gbpat199.seq - Patent sequence entries, part 199.
2040. gbpat2.seq - Patent sequence entries, part 2.
2041. gbpat20.seq - Patent sequence entries, part 20.
2042. gbpat200.seq - Patent sequence entries, part 200.
2043. gbpat201.seq - Patent sequence entries, part 201.
2044. gbpat202.seq - Patent sequence entries, part 202.
2045. gbpat203.seq - Patent sequence entries, part 203.
2046. gbpat204.seq - Patent sequence entries, part 204.
2047. gbpat205.seq - Patent sequence entries, part 205.
2048. gbpat206.seq - Patent sequence entries, part 206.
2049. gbpat207.seq - Patent sequence entries, part 207.
2050. gbpat208.seq - Patent sequence entries, part 208.
2051. gbpat209.seq - Patent sequence entries, part 209.
2052. gbpat21.seq - Patent sequence entries, part 21.
2053. gbpat210.seq - Patent sequence entries, part 210.
2054. gbpat211.seq - Patent sequence entries, part 211.
2055. gbpat212.seq - Patent sequence entries, part 212.
2056. gbpat213.seq - Patent sequence entries, part 213.
2057. gbpat214.seq - Patent sequence entries, part 214.
2058. gbpat215.seq - Patent sequence entries, part 215.
2059. gbpat216.seq - Patent sequence entries, part 216.
2060. gbpat217.seq - Patent sequence entries, part 217.
2061. gbpat218.seq - Patent sequence entries, part 218.
2062. gbpat219.seq - Patent sequence entries, part 219.
2063. gbpat22.seq - Patent sequence entries, part 22.
2064. gbpat220.seq - Patent sequence entries, part 220.
2065. gbpat221.seq - Patent sequence entries, part 221.
2066. gbpat222.seq - Patent sequence entries, part 222.
2067. gbpat223.seq - Patent sequence entries, part 223.
2068. gbpat224.seq - Patent sequence entries, part 224.
2069. gbpat225.seq - Patent sequence entries, part 225.
2070. gbpat226.seq - Patent sequence entries, part 226.
2071. gbpat227.seq - Patent sequence entries, part 227.
2072. gbpat228.seq - Patent sequence entries, part 228.
2073. gbpat229.seq - Patent sequence entries, part 229.
2074. gbpat23.seq - Patent sequence entries, part 23.
2075. gbpat230.seq - Patent sequence entries, part 230.
2076. gbpat231.seq - Patent sequence entries, part 231.
2077. gbpat232.seq - Patent sequence entries, part 232.
2078. gbpat233.seq - Patent sequence entries, part 233.
2079. gbpat234.seq - Patent sequence entries, part 234.
2080. gbpat235.seq - Patent sequence entries, part 235.
2081. gbpat236.seq - Patent sequence entries, part 236.
2082. gbpat237.seq - Patent sequence entries, part 237.
2083. gbpat238.seq - Patent sequence entries, part 238.
2084. gbpat239.seq - Patent sequence entries, part 239.
2085. gbpat24.seq - Patent sequence entries, part 24.
2086. gbpat240.seq - Patent sequence entries, part 240.
2087. gbpat241.seq - Patent sequence entries, part 241.
2088. gbpat242.seq - Patent sequence entries, part 242.
2089. gbpat243.seq - Patent sequence entries, part 243.
2090. gbpat244.seq - Patent sequence entries, part 244.
2091. gbpat245.seq - Patent sequence entries, part 245.
2092. gbpat246.seq - Patent sequence entries, part 246.
2093. gbpat247.seq - Patent sequence entries, part 247.
2094. gbpat248.seq - Patent sequence entries, part 248.
2095. gbpat249.seq - Patent sequence entries, part 249.
2096. gbpat25.seq - Patent sequence entries, part 25.
2097. gbpat250.seq - Patent sequence entries, part 250.
2098. gbpat251.seq - Patent sequence entries, part 251.
2099. gbpat252.seq - Patent sequence entries, part 252.
2100. gbpat253.seq - Patent sequence entries, part 253.
2101. gbpat254.seq - Patent sequence entries, part 254.
2102. gbpat255.seq - Patent sequence entries, part 255.
2103. gbpat256.seq - Patent sequence entries, part 256.
2104. gbpat257.seq - Patent sequence entries, part 257.
2105. gbpat258.seq - Patent sequence entries, part 258.
2106. gbpat259.seq - Patent sequence entries, part 259.
2107. gbpat26.seq - Patent sequence entries, part 26.
2108. gbpat260.seq - Patent sequence entries, part 260.
2109. gbpat261.seq - Patent sequence entries, part 261.
2110. gbpat262.seq - Patent sequence entries, part 262.
2111. gbpat263.seq - Patent sequence entries, part 263.
2112. gbpat264.seq - Patent sequence entries, part 264.
2113. gbpat265.seq - Patent sequence entries, part 265.
2114. gbpat266.seq - Patent sequence entries, part 266.
2115. gbpat267.seq - Patent sequence entries, part 267.
2116. gbpat268.seq - Patent sequence entries, part 268.
2117. gbpat269.seq - Patent sequence entries, part 269.
2118. gbpat27.seq - Patent sequence entries, part 27.
2119. gbpat270.seq - Patent sequence entries, part 270.
2120. gbpat271.seq - Patent sequence entries, part 271.
2121. gbpat272.seq - Patent sequence entries, part 272.
2122. gbpat273.seq - Patent sequence entries, part 273.
2123. gbpat274.seq - Patent sequence entries, part 274.
2124. gbpat275.seq - Patent sequence entries, part 275.
2125. gbpat276.seq - Patent sequence entries, part 276.
2126. gbpat277.seq - Patent sequence entries, part 277.
2127. gbpat278.seq - Patent sequence entries, part 278.
2128. gbpat279.seq - Patent sequence entries, part 279.
2129. gbpat28.seq - Patent sequence entries, part 28.
2130. gbpat280.seq - Patent sequence entries, part 280.
2131. gbpat281.seq - Patent sequence entries, part 281.
2132. gbpat282.seq - Patent sequence entries, part 282.
2133. gbpat283.seq - Patent sequence entries, part 283.
2134. gbpat29.seq - Patent sequence entries, part 29.
2135. gbpat3.seq - Patent sequence entries, part 3.
2136. gbpat30.seq - Patent sequence entries, part 30.
2137. gbpat31.seq - Patent sequence entries, part 31.
2138. gbpat32.seq - Patent sequence entries, part 32.
2139. gbpat33.seq - Patent sequence entries, part 33.
2140. gbpat34.seq - Patent sequence entries, part 34.
2141. gbpat35.seq - Patent sequence entries, part 35.
2142. gbpat36.seq - Patent sequence entries, part 36.
2143. gbpat37.seq - Patent sequence entries, part 37.
2144. gbpat38.seq - Patent sequence entries, part 38.
2145. gbpat39.seq - Patent sequence entries, part 39.
2146. gbpat4.seq - Patent sequence entries, part 4.
2147. gbpat40.seq - Patent sequence entries, part 40.
2148. gbpat41.seq - Patent sequence entries, part 41.
2149. gbpat42.seq - Patent sequence entries, part 42.
2150. gbpat43.seq - Patent sequence entries, part 43.
2151. gbpat44.seq - Patent sequence entries, part 44.
2152. gbpat45.seq - Patent sequence entries, part 45.
2153. gbpat46.seq - Patent sequence entries, part 46.
2154. gbpat47.seq - Patent sequence entries, part 47.
2155. gbpat48.seq - Patent sequence entries, part 48.
2156. gbpat49.seq - Patent sequence entries, part 49.
2157. gbpat5.seq - Patent sequence entries, part 5.
2158. gbpat50.seq - Patent sequence entries, part 50.
2159. gbpat51.seq - Patent sequence entries, part 51.
2160. gbpat52.seq - Patent sequence entries, part 52.
2161. gbpat53.seq - Patent sequence entries, part 53.
2162. gbpat54.seq - Patent sequence entries, part 54.
2163. gbpat55.seq - Patent sequence entries, part 55.
2164. gbpat56.seq - Patent sequence entries, part 56.
2165. gbpat57.seq - Patent sequence entries, part 57.
2166. gbpat58.seq - Patent sequence entries, part 58.
2167. gbpat59.seq - Patent sequence entries, part 59.
2168. gbpat6.seq - Patent sequence entries, part 6.
2169. gbpat60.seq - Patent sequence entries, part 60.
2170. gbpat61.seq - Patent sequence entries, part 61.
2171. gbpat62.seq - Patent sequence entries, part 62.
2172. gbpat63.seq - Patent sequence entries, part 63.
2173. gbpat64.seq - Patent sequence entries, part 64.
2174. gbpat65.seq - Patent sequence entries, part 65.
2175. gbpat66.seq - Patent sequence entries, part 66.
2176. gbpat67.seq - Patent sequence entries, part 67.
2177. gbpat68.seq - Patent sequence entries, part 68.
2178. gbpat69.seq - Patent sequence entries, part 69.
2179. gbpat7.seq - Patent sequence entries, part 7.
2180. gbpat70.seq - Patent sequence entries, part 70.
2181. gbpat71.seq - Patent sequence entries, part 71.
2182. gbpat72.seq - Patent sequence entries, part 72.
2183. gbpat73.seq - Patent sequence entries, part 73.
2184. gbpat74.seq - Patent sequence entries, part 74.
2185. gbpat75.seq - Patent sequence entries, part 75.
2186. gbpat76.seq - Patent sequence entries, part 76.
2187. gbpat77.seq - Patent sequence entries, part 77.
2188. gbpat78.seq - Patent sequence entries, part 78.
2189. gbpat79.seq - Patent sequence entries, part 79.
2190. gbpat8.seq - Patent sequence entries, part 8.
2191. gbpat80.seq - Patent sequence entries, part 80.
2192. gbpat81.seq - Patent sequence entries, part 81.
2193. gbpat82.seq - Patent sequence entries, part 82.
2194. gbpat83.seq - Patent sequence entries, part 83.
2195. gbpat84.seq - Patent sequence entries, part 84.
2196. gbpat85.seq - Patent sequence entries, part 85.
2197. gbpat86.seq - Patent sequence entries, part 86.
2198. gbpat87.seq - Patent sequence entries, part 87.
2199. gbpat88.seq - Patent sequence entries, part 88.
2200. gbpat89.seq - Patent sequence entries, part 89.
2201. gbpat9.seq - Patent sequence entries, part 9.
2202. gbpat90.seq - Patent sequence entries, part 90.
2203. gbpat91.seq - Patent sequence entries, part 91.
2204. gbpat92.seq - Patent sequence entries, part 92.
2205. gbpat93.seq - Patent sequence entries, part 93.
2206. gbpat94.seq - Patent sequence entries, part 94.
2207. gbpat95.seq - Patent sequence entries, part 95.
2208. gbpat96.seq - Patent sequence entries, part 96.
2209. gbpat97.seq - Patent sequence entries, part 97.
2210. gbpat98.seq - Patent sequence entries, part 98.
2211. gbpat99.seq - Patent sequence entries, part 99.
2212. gbphg1.seq - Phage sequence entries, part 1.
2213. gbphg2.seq - Phage sequence entries, part 2.
2214. gbphg3.seq - Phage sequence entries, part 3.
2215. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2216. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2217. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2218. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2219. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2220. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2221. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2222. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2223. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2224. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2225. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2226. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2227. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2228. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2229. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2230. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2231. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2232. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2233. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2234. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2235. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2236. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2237. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2238. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2239. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2240. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2241. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2242. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2243. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2244. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2245. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2246. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2247. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2248. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2249. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2250. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2251. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2252. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2253. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2254. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2255. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2256. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2257. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2258. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2259. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2260. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2261. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2262. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2263. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2264. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2265. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2266. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2267. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2268. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2269. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2270. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2271. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2272. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2273. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2274. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2275. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2276. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2277. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2278. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2279. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2280. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2281. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2282. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2283. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2284. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2285. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2286. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2287. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2288. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2289. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2290. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2291. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2292. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2293. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2294. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2295. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2296. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2297. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2298. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2299. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2300. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2301. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2302. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2303. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2304. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2305. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2306. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2307. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2308. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2309. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2310. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2311. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2312. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2313. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2314. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2315. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2316. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2317. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2318. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2319. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2320. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2321. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2322. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2323. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2324. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2325. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2326. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2327. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2328. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2329. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2330. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2331. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2332. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2333. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2334. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2335. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2336. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2337. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2338. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2339. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2340. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2341. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2342. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2343. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2344. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2345. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2346. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2347. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2348. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2349. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2350. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2351. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2352. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2353. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2354. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2355. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2356. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2357. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2358. gbpri1.seq - Primate sequence entries, part 1.
2359. gbpri10.seq - Primate sequence entries, part 10.
2360. gbpri11.seq - Primate sequence entries, part 11.
2361. gbpri12.seq - Primate sequence entries, part 12.
2362. gbpri13.seq - Primate sequence entries, part 13.
2363. gbpri14.seq - Primate sequence entries, part 14.
2364. gbpri15.seq - Primate sequence entries, part 15.
2365. gbpri16.seq - Primate sequence entries, part 16.
2366. gbpri17.seq - Primate sequence entries, part 17.
2367. gbpri18.seq - Primate sequence entries, part 18.
2368. gbpri19.seq - Primate sequence entries, part 19.
2369. gbpri2.seq - Primate sequence entries, part 2.
2370. gbpri20.seq - Primate sequence entries, part 20.
2371. gbpri21.seq - Primate sequence entries, part 21.
2372. gbpri22.seq - Primate sequence entries, part 22.
2373. gbpri23.seq - Primate sequence entries, part 23.
2374. gbpri24.seq - Primate sequence entries, part 24.
2375. gbpri25.seq - Primate sequence entries, part 25.
2376. gbpri26.seq - Primate sequence entries, part 26.
2377. gbpri27.seq - Primate sequence entries, part 27.
2378. gbpri28.seq - Primate sequence entries, part 28.
2379. gbpri29.seq - Primate sequence entries, part 29.
2380. gbpri3.seq - Primate sequence entries, part 3.
2381. gbpri30.seq - Primate sequence entries, part 30.
2382. gbpri31.seq - Primate sequence entries, part 31.
2383. gbpri32.seq - Primate sequence entries, part 32.
2384. gbpri33.seq - Primate sequence entries, part 33.
2385. gbpri34.seq - Primate sequence entries, part 34.
2386. gbpri35.seq - Primate sequence entries, part 35.
2387. gbpri36.seq - Primate sequence entries, part 36.
2388. gbpri37.seq - Primate sequence entries, part 37.
2389. gbpri38.seq - Primate sequence entries, part 38.
2390. gbpri39.seq - Primate sequence entries, part 39.
2391. gbpri4.seq - Primate sequence entries, part 4.
2392. gbpri40.seq - Primate sequence entries, part 40.
2393. gbpri41.seq - Primate sequence entries, part 41.
2394. gbpri42.seq - Primate sequence entries, part 42.
2395. gbpri43.seq - Primate sequence entries, part 43.
2396. gbpri44.seq - Primate sequence entries, part 44.
2397. gbpri45.seq - Primate sequence entries, part 45.
2398. gbpri46.seq - Primate sequence entries, part 46.
2399. gbpri47.seq - Primate sequence entries, part 47.
2400. gbpri48.seq - Primate sequence entries, part 48.
2401. gbpri49.seq - Primate sequence entries, part 49.
2402. gbpri5.seq - Primate sequence entries, part 5.
2403. gbpri50.seq - Primate sequence entries, part 50.
2404. gbpri51.seq - Primate sequence entries, part 51.
2405. gbpri52.seq - Primate sequence entries, part 52.
2406. gbpri53.seq - Primate sequence entries, part 53.
2407. gbpri54.seq - Primate sequence entries, part 54.
2408. gbpri55.seq - Primate sequence entries, part 55.
2409. gbpri6.seq - Primate sequence entries, part 6.
2410. gbpri7.seq - Primate sequence entries, part 7.
2411. gbpri8.seq - Primate sequence entries, part 8.
2412. gbpri9.seq - Primate sequence entries, part 9.
2413. gbrel.txt - Release notes (this document).
2414. gbrod1.seq - Rodent sequence entries, part 1.
2415. gbrod10.seq - Rodent sequence entries, part 10.
2416. gbrod11.seq - Rodent sequence entries, part 11.
2417. gbrod12.seq - Rodent sequence entries, part 12.
2418. gbrod13.seq - Rodent sequence entries, part 13.
2419. gbrod14.seq - Rodent sequence entries, part 14.
2420. gbrod15.seq - Rodent sequence entries, part 15.
2421. gbrod16.seq - Rodent sequence entries, part 16.
2422. gbrod17.seq - Rodent sequence entries, part 17.
2423. gbrod18.seq - Rodent sequence entries, part 18.
2424. gbrod19.seq - Rodent sequence entries, part 19.
2425. gbrod2.seq - Rodent sequence entries, part 2.
2426. gbrod20.seq - Rodent sequence entries, part 20.
2427. gbrod21.seq - Rodent sequence entries, part 21.
2428. gbrod22.seq - Rodent sequence entries, part 22.
2429. gbrod23.seq - Rodent sequence entries, part 23.
2430. gbrod24.seq - Rodent sequence entries, part 24.
2431. gbrod25.seq - Rodent sequence entries, part 25.
2432. gbrod26.seq - Rodent sequence entries, part 26.
2433. gbrod27.seq - Rodent sequence entries, part 27.
2434. gbrod28.seq - Rodent sequence entries, part 28.
2435. gbrod29.seq - Rodent sequence entries, part 29.
2436. gbrod3.seq - Rodent sequence entries, part 3.
2437. gbrod30.seq - Rodent sequence entries, part 30.
2438. gbrod4.seq - Rodent sequence entries, part 4.
2439. gbrod5.seq - Rodent sequence entries, part 5.
2440. gbrod6.seq - Rodent sequence entries, part 6.
2441. gbrod7.seq - Rodent sequence entries, part 7.
2442. gbrod8.seq - Rodent sequence entries, part 8.
2443. gbrod9.seq - Rodent sequence entries, part 9.
2444. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2445. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2446. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2447. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2448. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2449. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2450. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2451. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2452. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2453. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2454. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2455. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2456. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2457. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2458. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2459. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2460. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2461. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2462. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2463. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2464. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2465. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2466. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2467. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2468. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2469. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2470. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2471. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2472. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2473. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2474. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2475. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2476. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2477. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2478. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2479. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2480. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2481. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2482. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2483. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2484. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2485. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2486. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2487. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2488. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2489. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2490. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2491. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2492. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2493. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2494. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2495. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2496. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2497. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2498. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2499. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2500. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2501. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2502. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2503. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2504. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2505. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2506. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2507. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2508. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2509. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2510. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2511. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2512. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2513. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2514. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2515. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2516. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2517. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2518. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2519. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2520. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2521. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2522. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2523. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2524. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2525. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2526. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2527. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2528. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2529. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2530. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2531. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2532. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2533. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2534. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2535. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2536. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2537. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2538. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2539. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2540. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2541. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2542. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2543. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2544. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2545. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2546. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2547. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2548. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2549. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2550. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2551. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2552. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2553. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2554. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2555. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2556. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2557. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2558. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2559. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2560. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2561. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2562. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2563. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2564. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2565. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2566. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2567. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2568. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2569. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2570. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2571. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2572. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2573. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2574. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2575. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2576. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2577. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2578. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2579. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2580. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2581. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2582. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2583. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2584. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2585. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2586. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2587. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2588. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2589. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2590. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2591. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2592. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2593. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2594. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2595. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2596. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2597. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2598. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2599. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2600. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2601. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2602. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2603. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2604. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2605. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2606. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2607. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2608. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2609. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2610. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2611. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2612. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2613. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2614. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2615. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2616. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2617. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2618. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2619. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2620. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2621. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2622. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2623. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2624. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2625. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2626. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2627. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2628. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2629. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2630. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2631. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2632. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2633. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2634. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2635. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2636. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2637. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2638. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2639. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2640. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2641. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2642. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2643. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2644. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2645. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2646. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2647. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2648. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2649. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2650. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2651. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2652. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2653. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2654. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2655. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2656. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2657. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2658. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2659. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2660. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2661. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2662. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2663. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2664. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2665. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2666. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2667. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2668. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2669. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2670. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2671. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2672. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2673. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2674. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2675. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2676. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2677. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2678. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2679. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2680. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2681. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2682. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2683. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2684. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2685. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2686. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2687. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2688. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2689. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2690. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2691. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2692. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2693. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2694. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2695. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2696. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2697. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2698. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2699. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2700. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2701. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2702. gbuna1.seq - Unannotated sequence entries, part 1.
2703. gbvrl1.seq - Viral sequence entries, part 1.
2704. gbvrl10.seq - Viral sequence entries, part 10.
2705. gbvrl11.seq - Viral sequence entries, part 11.
2706. gbvrl12.seq - Viral sequence entries, part 12.
2707. gbvrl13.seq - Viral sequence entries, part 13.
2708. gbvrl14.seq - Viral sequence entries, part 14.
2709. gbvrl15.seq - Viral sequence entries, part 15.
2710. gbvrl16.seq - Viral sequence entries, part 16.
2711. gbvrl17.seq - Viral sequence entries, part 17.
2712. gbvrl18.seq - Viral sequence entries, part 18.
2713. gbvrl19.seq - Viral sequence entries, part 19.
2714. gbvrl2.seq - Viral sequence entries, part 2.
2715. gbvrl20.seq - Viral sequence entries, part 20.
2716. gbvrl21.seq - Viral sequence entries, part 21.
2717. gbvrl22.seq - Viral sequence entries, part 22.
2718. gbvrl23.seq - Viral sequence entries, part 23.
2719. gbvrl24.seq - Viral sequence entries, part 24.
2720. gbvrl25.seq - Viral sequence entries, part 25.
2721. gbvrl26.seq - Viral sequence entries, part 26.
2722. gbvrl27.seq - Viral sequence entries, part 27.
2723. gbvrl28.seq - Viral sequence entries, part 28.
2724. gbvrl29.seq - Viral sequence entries, part 29.
2725. gbvrl3.seq - Viral sequence entries, part 3.
2726. gbvrl30.seq - Viral sequence entries, part 30.
2727. gbvrl31.seq - Viral sequence entries, part 31.
2728. gbvrl32.seq - Viral sequence entries, part 32.
2729. gbvrl33.seq - Viral sequence entries, part 33.
2730. gbvrl34.seq - Viral sequence entries, part 34.
2731. gbvrl35.seq - Viral sequence entries, part 35.
2732. gbvrl36.seq - Viral sequence entries, part 36.
2733. gbvrl37.seq - Viral sequence entries, part 37.
2734. gbvrl38.seq - Viral sequence entries, part 38.
2735. gbvrl39.seq - Viral sequence entries, part 39.
2736. gbvrl4.seq - Viral sequence entries, part 4.
2737. gbvrl40.seq - Viral sequence entries, part 40.
2738. gbvrl41.seq - Viral sequence entries, part 41.
2739. gbvrl42.seq - Viral sequence entries, part 42.
2740. gbvrl43.seq - Viral sequence entries, part 43.
2741. gbvrl44.seq - Viral sequence entries, part 44.
2742. gbvrl45.seq - Viral sequence entries, part 45.
2743. gbvrl46.seq - Viral sequence entries, part 46.
2744. gbvrl47.seq - Viral sequence entries, part 47.
2745. gbvrl5.seq - Viral sequence entries, part 5.
2746. gbvrl6.seq - Viral sequence entries, part 6.
2747. gbvrl7.seq - Viral sequence entries, part 7.
2748. gbvrl8.seq - Viral sequence entries, part 8.
2749. gbvrl9.seq - Viral sequence entries, part 9.
2750. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2751. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2752. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2753. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2754. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2755. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2756. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2757. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2758. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2759. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2760. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2761. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2762. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2763. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2764. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2765. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2766. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2767. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2768. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2769. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2770. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2771. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2772. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2773. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2774. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2775. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2776. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2777. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2778. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2779. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2780. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2781. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2782. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2783. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2784. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2785. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2786. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2787. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2788. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2789. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2790. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2791. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2792. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2793. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2794. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2795. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2796. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2797. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2798. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2799. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2800. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2801. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2802. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2803. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2804. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2805. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2806. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2807. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2808. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2809. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2810. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2811. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2812. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2813. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 218.0 flatfiles require roughly 818 GB (sequence
files only) or 818 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999705     gbbct1.seq
 246925985     gbbct10.seq
 245702836     gbbct100.seq
 245862254     gbbct101.seq
 244362573     gbbct102.seq
 241580582     gbbct103.seq
 245706131     gbbct104.seq
 208226544     gbbct105.seq
 249320921     gbbct106.seq
 239666506     gbbct107.seq
 245048917     gbbct108.seq
 247107455     gbbct109.seq
 242157099     gbbct11.seq
 246696518     gbbct110.seq
 246730739     gbbct111.seq
 243321512     gbbct112.seq
 241794792     gbbct113.seq
 249774720     gbbct114.seq
 247057654     gbbct115.seq
 245008732     gbbct116.seq
  36729652     gbbct117.seq
 245339599     gbbct118.seq
 246570708     gbbct119.seq
 243160321     gbbct12.seq
 247975814     gbbct120.seq
 246027520     gbbct121.seq
 242851972     gbbct122.seq
 244775885     gbbct123.seq
 244531304     gbbct124.seq
 236114400     gbbct125.seq
 240476563     gbbct126.seq
 132170845     gbbct127.seq
 247351438     gbbct128.seq
 239848759     gbbct129.seq
 247761146     gbbct13.seq
 247082980     gbbct130.seq
 243703388     gbbct131.seq
 243353512     gbbct132.seq
 249863403     gbbct133.seq
 240031967     gbbct134.seq
 247162900     gbbct135.seq
 248621164     gbbct136.seq
 242264209     gbbct137.seq
 245604736     gbbct138.seq
 245291546     gbbct139.seq
 245875392     gbbct14.seq
 241328980     gbbct140.seq
 246017544     gbbct141.seq
 246742754     gbbct142.seq
 245824666     gbbct143.seq
 247794189     gbbct144.seq
 249447336     gbbct145.seq
 242951591     gbbct146.seq
 243908715     gbbct147.seq
  84660623     gbbct148.seq
 240266950     gbbct149.seq
 244928764     gbbct15.seq
 246082630     gbbct150.seq
 248967278     gbbct151.seq
 248342012     gbbct152.seq
 237421638     gbbct153.seq
 244195366     gbbct154.seq
 244337641     gbbct155.seq
 245765429     gbbct156.seq
  14014518     gbbct157.seq
 246291082     gbbct158.seq
 249992258     gbbct159.seq
 247804675     gbbct16.seq
 240934870     gbbct160.seq
 240972166     gbbct161.seq
 249774017     gbbct162.seq
 247060465     gbbct163.seq
 249310752     gbbct164.seq
  47401592     gbbct165.seq
 247291705     gbbct166.seq
 245205542     gbbct167.seq
 248866126     gbbct168.seq
 244864347     gbbct169.seq
 240182519     gbbct17.seq
 245884971     gbbct170.seq
 247310180     gbbct171.seq
 241474145     gbbct172.seq
 248652492     gbbct173.seq
 121876846     gbbct174.seq
 237250540     gbbct175.seq
 242232185     gbbct176.seq
 246766223     gbbct177.seq
 246703819     gbbct178.seq
 240171177     gbbct179.seq
 242646902     gbbct18.seq
 249653390     gbbct180.seq
 247018508     gbbct181.seq
 243121929     gbbct182.seq
 240599264     gbbct183.seq
 240453538     gbbct184.seq
 248911478     gbbct185.seq
 247935215     gbbct186.seq
 247427101     gbbct187.seq
 218844978     gbbct188.seq
 248475620     gbbct189.seq
 239630840     gbbct19.seq
 248216729     gbbct190.seq
 248786780     gbbct191.seq
 246627735     gbbct192.seq
 245449970     gbbct193.seq
 239343642     gbbct194.seq
 243313494     gbbct195.seq
 239625348     gbbct196.seq
 249383459     gbbct197.seq
 248089119     gbbct198.seq
 239530157     gbbct199.seq
 245283465     gbbct2.seq
 243242234     gbbct20.seq
 241414374     gbbct200.seq
 244122213     gbbct201.seq
 241820967     gbbct202.seq
 248791485     gbbct203.seq
 246014184     gbbct204.seq
 240282774     gbbct205.seq
 249273687     gbbct206.seq
 244110569     gbbct207.seq
 243588224     gbbct208.seq
  48211076     gbbct209.seq
 245878763     gbbct21.seq
 239818633     gbbct210.seq
 246534626     gbbct211.seq
 242736232     gbbct212.seq
 242690993     gbbct213.seq
 240253237     gbbct214.seq
 247115408     gbbct215.seq
 245149931     gbbct216.seq
 243460979     gbbct217.seq
 249245386     gbbct218.seq
 157802118     gbbct219.seq
  83246084     gbbct22.seq
 247901836     gbbct220.seq
 246653098     gbbct221.seq
 242760905     gbbct222.seq
 246187535     gbbct223.seq
 244899970     gbbct224.seq
 240122286     gbbct225.seq
 241472699     gbbct226.seq
 244923101     gbbct227.seq
 249205303     gbbct228.seq
   7189151     gbbct229.seq
 242174100     gbbct23.seq
 247787759     gbbct230.seq
 248147279     gbbct231.seq
 247616247     gbbct232.seq
 249650946     gbbct233.seq
 247835688     gbbct234.seq
 235850528     gbbct235.seq
 248190570     gbbct236.seq
 249703865     gbbct237.seq
 247850685     gbbct238.seq
 241363483     gbbct239.seq
 247364123     gbbct24.seq
 205660238     gbbct240.seq
 240017803     gbbct241.seq
 247700184     gbbct242.seq
 246998288     gbbct243.seq
 243502955     gbbct244.seq
 243606848     gbbct245.seq
 247703388     gbbct246.seq
 247493124     gbbct247.seq
 247097043     gbbct248.seq
 240196612     gbbct249.seq
 243961317     gbbct25.seq
 249136063     gbbct250.seq
 248351929     gbbct251.seq
 240491217     gbbct252.seq
  36514729     gbbct253.seq
 245771882     gbbct254.seq
 241781283     gbbct255.seq
 248622086     gbbct256.seq
 243322423     gbbct257.seq
 244815247     gbbct258.seq
 247949284     gbbct259.seq
 245709446     gbbct26.seq
 243345142     gbbct260.seq
 243552550     gbbct261.seq
 246314913     gbbct262.seq
 244016790     gbbct263.seq
 236775507     gbbct264.seq
 249678326     gbbct265.seq
 248311674     gbbct266.seq
 244372764     gbbct267.seq
 248178766     gbbct268.seq
 248399257     gbbct269.seq
 244061877     gbbct27.seq
 245915011     gbbct270.seq
 244163396     gbbct271.seq
 248598708     gbbct272.seq
  15434626     gbbct273.seq
 237114834     gbbct274.seq
  73334672     gbbct275.seq
   6911592     gbbct276.seq
  14291434     gbbct277.seq
  23055459     gbbct278.seq
  44955057     gbbct279.seq
 245177654     gbbct28.seq
  87619638     gbbct280.seq
 170558106     gbbct281.seq
 249999367     gbbct282.seq
 249999225     gbbct283.seq
 248310757     gbbct284.seq
 246542156     gbbct285.seq
 239903186     gbbct286.seq
 235510850     gbbct287.seq
 246528325     gbbct288.seq
 244732689     gbbct289.seq
 242877044     gbbct29.seq
 249700295     gbbct290.seq
 249999777     gbbct291.seq
  74044948     gbbct292.seq
 245200498     gbbct293.seq
 244535717     gbbct294.seq
 249219995     gbbct295.seq
 247605682     gbbct296.seq
 240219420     gbbct297.seq
 250000092     gbbct298.seq
 249998020     gbbct299.seq
 246565788     gbbct3.seq
 239673850     gbbct30.seq
 250000202     gbbct300.seq
  17570821     gbbct301.seq
 249999995     gbbct302.seq
 249999438     gbbct303.seq
 249945702     gbbct304.seq
  46446988     gbbct305.seq
 249997849     gbbct306.seq
 249998397     gbbct307.seq
  66968770     gbbct308.seq
 249998764     gbbct309.seq
 217808721     gbbct31.seq
 181750762     gbbct310.seq
 249999637     gbbct311.seq
 110855409     gbbct312.seq
 249912356     gbbct313.seq
 249972172     gbbct314.seq
 247709613     gbbct315.seq
 248749335     gbbct316.seq
 245958119     gbbct317.seq
 210670285     gbbct318.seq
 249949186     gbbct319.seq
 242805093     gbbct32.seq
 245357173     gbbct320.seq
 247720725     gbbct321.seq
 239996440     gbbct322.seq
 248335956     gbbct323.seq
 242961791     gbbct324.seq
 248892042     gbbct325.seq
 231392782     gbbct326.seq
 239796232     gbbct327.seq
 249141661     gbbct328.seq
 241145150     gbbct329.seq
 245839027     gbbct33.seq
 227581208     gbbct330.seq
 248682248     gbbct34.seq
 247882843     gbbct35.seq
 249145685     gbbct36.seq
 244437000     gbbct37.seq
 247334111     gbbct38.seq
 249976230     gbbct39.seq
 249515650     gbbct4.seq
 249765555     gbbct40.seq
 240923051     gbbct41.seq
 244794873     gbbct42.seq
 249644022     gbbct43.seq
 165341868     gbbct44.seq
 247483212     gbbct45.seq
 246944380     gbbct46.seq
 248190828     gbbct47.seq
 246578815     gbbct48.seq
 241956782     gbbct49.seq
 249998889     gbbct5.seq
 246672058     gbbct50.seq
 249203001     gbbct51.seq
 246431878     gbbct52.seq
 239781959     gbbct53.seq
 248871193     gbbct54.seq
 248937305     gbbct55.seq
 245189715     gbbct56.seq
  49416022     gbbct57.seq
 244556539     gbbct58.seq
 245263215     gbbct59.seq
  55785024     gbbct6.seq
 239135724     gbbct60.seq
 247756176     gbbct61.seq
 239867034     gbbct62.seq
 247440112     gbbct63.seq
 249952597     gbbct64.seq
 247308442     gbbct65.seq
 247646037     gbbct66.seq
 248873450     gbbct67.seq
 248406441     gbbct68.seq
 247579673     gbbct69.seq
 238862580     gbbct7.seq
 249838403     gbbct70.seq
  63782053     gbbct71.seq
 248758956     gbbct72.seq
 248625210     gbbct73.seq
 249954309     gbbct74.seq
 246771218     gbbct75.seq
 240224060     gbbct76.seq
 243723208     gbbct77.seq
 249623622     gbbct78.seq
 243776697     gbbct79.seq
 161547400     gbbct8.seq
 246916034     gbbct80.seq
 247966596     gbbct81.seq
 244973051     gbbct82.seq
 241930281     gbbct83.seq
 248388744     gbbct84.seq
  93947264     gbbct85.seq
 249871206     gbbct86.seq
 245928064     gbbct87.seq
 245491421     gbbct88.seq
 247030284     gbbct89.seq
 249051128     gbbct9.seq
 249497859     gbbct90.seq
 246724361     gbbct91.seq
 248462275     gbbct92.seq
 241818006     gbbct93.seq
 246928933     gbbct94.seq
 248325202     gbbct95.seq
  26340214     gbbct96.seq
 249007097     gbbct97.seq
 239562960     gbbct98.seq
 249502625     gbbct99.seq
   1041230     gbchg.txt
 249924833     gbcon1.seq
 249996041     gbcon10.seq
 249999421     gbcon100.seq
  73407612     gbcon101.seq
 249998421     gbcon102.seq
 249998946     gbcon103.seq
 249996185     gbcon104.seq
 249995145     gbcon105.seq
 249998953     gbcon106.seq
  32427016     gbcon107.seq
 249994975     gbcon108.seq
 249999581     gbcon109.seq
 249498270     gbcon11.seq
 249997722     gbcon110.seq
 249997541     gbcon111.seq
 208220377     gbcon112.seq
 249992153     gbcon113.seq
 249998787     gbcon114.seq
 249995953     gbcon115.seq
 249999393     gbcon116.seq
 250000027     gbcon117.seq
 143584215     gbcon118.seq
 249995301     gbcon119.seq
 249896120     gbcon12.seq
 249999496     gbcon120.seq
 249998124     gbcon121.seq
 249999708     gbcon122.seq
 249996885     gbcon123.seq
 166460579     gbcon124.seq
 249995504     gbcon125.seq
 249997107     gbcon126.seq
 249999227     gbcon127.seq
 243174054     gbcon128.seq
 174526309     gbcon129.seq
 240208593     gbcon13.seq
 249996492     gbcon130.seq
 249997985     gbcon131.seq
  52243108     gbcon132.seq
 249999899     gbcon133.seq
 249987289     gbcon134.seq
 212159589     gbcon135.seq
 203092435     gbcon136.seq
 249999964     gbcon137.seq
 249123104     gbcon138.seq
 249562162     gbcon139.seq
 245661372     gbcon14.seq
 249996979     gbcon140.seq
 249998104     gbcon141.seq
 154473958     gbcon142.seq
 249997581     gbcon143.seq
 249492030     gbcon144.seq
 246626061     gbcon145.seq
 244014257     gbcon146.seq
 249999386     gbcon147.seq
 249915891     gbcon148.seq
 249999261     gbcon149.seq
 249345769     gbcon15.seq
  93633009     gbcon150.seq
 249999281     gbcon151.seq
 249964686     gbcon152.seq
 249042783     gbcon153.seq
 249997571     gbcon154.seq
 249996807     gbcon155.seq
 249962992     gbcon156.seq
 248536662     gbcon157.seq
 249996706     gbcon158.seq
  77142541     gbcon159.seq
 249152299     gbcon16.seq
 249997889     gbcon160.seq
 249999200     gbcon161.seq
 249592774     gbcon162.seq
 249999036     gbcon163.seq
 146743115     gbcon164.seq
 249999163     gbcon165.seq
 249999088     gbcon166.seq
 249965282     gbcon167.seq
 249999882     gbcon168.seq
 249998336     gbcon169.seq
 249815376     gbcon17.seq
 249999448     gbcon170.seq
 249999572     gbcon171.seq
 182168706     gbcon172.seq
 249999124     gbcon173.seq
 249992786     gbcon174.seq
 249999222     gbcon175.seq
 249998010     gbcon176.seq
 201769902     gbcon177.seq
 249999463     gbcon178.seq
 249961848     gbcon179.seq
 249407361     gbcon18.seq
 249995060     gbcon180.seq
 249092209     gbcon181.seq
 249930072     gbcon182.seq
 249997515     gbcon183.seq
 249936271     gbcon184.seq
 249912674     gbcon185.seq
 249999407     gbcon186.seq
 227916706     gbcon187.seq
 250000045     gbcon188.seq
 249998074     gbcon189.seq
 249933972     gbcon19.seq
 249999760     gbcon190.seq
 249999489     gbcon191.seq
 249995774     gbcon192.seq
 249996950     gbcon193.seq
  29626236     gbcon194.seq
 249998551     gbcon195.seq
 249998712     gbcon196.seq
 249584381     gbcon197.seq
 249970992     gbcon198.seq
 236895180     gbcon199.seq
 249756523     gbcon2.seq
 245640191     gbcon20.seq
 249974979     gbcon200.seq
 249999995     gbcon201.seq
 249977876     gbcon202.seq
 249998577     gbcon203.seq
 249570761     gbcon204.seq
 250000208     gbcon205.seq
 249936250     gbcon206.seq
 249999644     gbcon207.seq
  74160440     gbcon208.seq
 249999259     gbcon209.seq
 227164874     gbcon21.seq
 249999298     gbcon210.seq
 249996283     gbcon211.seq
 249998745     gbcon212.seq
 205607173     gbcon213.seq
 249996001     gbcon214.seq
 249998524     gbcon215.seq
 249999955     gbcon216.seq
 249998250     gbcon217.seq
 163866121     gbcon218.seq
 250000103     gbcon219.seq
 249765763     gbcon22.seq
 249997454     gbcon220.seq
 249999723     gbcon221.seq
 249411124     gbcon222.seq
 249998596     gbcon223.seq
 246517634     gbcon224.seq
 249973217     gbcon225.seq
 249999719     gbcon226.seq
 249832214     gbcon227.seq
 250000000     gbcon228.seq
 249943384     gbcon229.seq
 131041737     gbcon23.seq
 249996886     gbcon230.seq
 183835837     gbcon231.seq
 249998617     gbcon232.seq
 249995784     gbcon233.seq
 249998545     gbcon234.seq
 249998150     gbcon235.seq
 221900223     gbcon236.seq
 249998954     gbcon237.seq
 249998064     gbcon238.seq
 249998228     gbcon239.seq
 249993008     gbcon24.seq
 249998382     gbcon240.seq
 108237204     gbcon241.seq
 249998697     gbcon242.seq
 249997911     gbcon243.seq
 249995832     gbcon244.seq
 249993350     gbcon245.seq
 249995272     gbcon246.seq
 192634625     gbcon247.seq
 249996817     gbcon248.seq
 249233163     gbcon249.seq
 249999110     gbcon25.seq
 249893608     gbcon250.seq
 249996028     gbcon251.seq
 249992079     gbcon252.seq
 249993023     gbcon253.seq
 249982338     gbcon254.seq
 249999812     gbcon255.seq
  21621150     gbcon256.seq
 249997790     gbcon257.seq
 249998872     gbcon258.seq
 249949308     gbcon259.seq
 249998996     gbcon26.seq
 249998934     gbcon260.seq
 249998040     gbcon261.seq
 126359748     gbcon262.seq
 249998331     gbcon263.seq
 249874563     gbcon264.seq
 249946469     gbcon265.seq
 250000032     gbcon266.seq
 249990184     gbcon267.seq
 249998893     gbcon268.seq
 183890652     gbcon269.seq
 249997358     gbcon27.seq
 249999962     gbcon270.seq
 249996982     gbcon271.seq
 249987851     gbcon272.seq
 249998390     gbcon273.seq
 249998892     gbcon274.seq
 249999650     gbcon275.seq
 249999897     gbcon276.seq
  25046915     gbcon277.seq
 249993984     gbcon278.seq
 249975639     gbcon279.seq
 250000240     gbcon28.seq
 250000185     gbcon280.seq
 249992295     gbcon281.seq
 249998813     gbcon282.seq
 118249102     gbcon283.seq
 249999438     gbcon284.seq
 249996270     gbcon285.seq
 249997984     gbcon286.seq
 249815715     gbcon287.seq
 249995029     gbcon288.seq
 130300787     gbcon289.seq
 249999627     gbcon29.seq
 249998557     gbcon290.seq
 249953364     gbcon291.seq
 249999371     gbcon292.seq
 250000228     gbcon293.seq
 249876840     gbcon294.seq
 117414877     gbcon295.seq
 249994666     gbcon296.seq
 249994930     gbcon297.seq
 249988364     gbcon298.seq
 249958199     gbcon299.seq
 249659590     gbcon3.seq
  91646555     gbcon30.seq
 249994461     gbcon300.seq
 249999608     gbcon301.seq
 138740466     gbcon302.seq
 249490506     gbcon303.seq
 249984475     gbcon304.seq
 249853249     gbcon305.seq
 249999926     gbcon306.seq
 249999458     gbcon307.seq
 249978925     gbcon308.seq
 249999122     gbcon309.seq
 249998086     gbcon31.seq
 250000081     gbcon310.seq
  92369106     gbcon311.seq
 249999210     gbcon312.seq
 250000207     gbcon313.seq
 249918460     gbcon314.seq
 249993126     gbcon315.seq
 250000174     gbcon316.seq
 249997645     gbcon317.seq
  72201805     gbcon318.seq
 249996332     gbcon319.seq
 249999757     gbcon32.seq
 249998103     gbcon320.seq
 249999600     gbcon321.seq
 249999582     gbcon322.seq
 249998680     gbcon323.seq
 249948534     gbcon324.seq
 249998730     gbcon325.seq
 249998178     gbcon326.seq
  77091952     gbcon327.seq
 249999793     gbcon328.seq
 249998403     gbcon329.seq
 249999116     gbcon33.seq
 249989845     gbcon330.seq
 249993695     gbcon331.seq
 249945178     gbcon332.seq
  62403785     gbcon333.seq
 249998896     gbcon334.seq
 249998688     gbcon335.seq
 249997681     gbcon336.seq
 249676377     gbcon337.seq
 249998864     gbcon338.seq
 249455726     gbcon339.seq
 249997359     gbcon34.seq
 249513873     gbcon340.seq
 224621836     gbcon341.seq
 250000009     gbcon342.seq
 249999657     gbcon343.seq
 249999310     gbcon344.seq
 249998557     gbcon345.seq
  42833441     gbcon346.seq
 249998287     gbcon347.seq
 249999132     gbcon348.seq
 249987566     gbcon349.seq
 247328230     gbcon35.seq
 249995835     gbcon350.seq
 249998240     gbcon351.seq
 249922665     gbcon352.seq
 249999867     gbcon353.seq
 249999485     gbcon354.seq
 240142329     gbcon355.seq
    127408     gbcon356.seq
 249640531     gbcon36.seq
 249941225     gbcon37.seq
  39584908     gbcon38.seq
 249997702     gbcon39.seq
 249665937     gbcon4.seq
 248806791     gbcon40.seq
 133521386     gbcon41.seq
 129847485     gbcon42.seq
 249996964     gbcon43.seq
 248492228     gbcon44.seq
 249996793     gbcon45.seq
 249998711     gbcon46.seq
 125645945     gbcon47.seq
 249998408     gbcon48.seq
 249999994     gbcon49.seq
 249998590     gbcon5.seq
 249998690     gbcon50.seq
 249999465     gbcon51.seq
 249970462     gbcon52.seq
 215825824     gbcon53.seq
 249995573     gbcon54.seq
 249996408     gbcon55.seq
 249994120     gbcon56.seq
 249994952     gbcon57.seq
 249998384     gbcon58.seq
 249996413     gbcon59.seq
 249881726     gbcon6.seq
  73437195     gbcon60.seq
 249998712     gbcon61.seq
 249998158     gbcon62.seq
 249996631     gbcon63.seq
 249998184     gbcon64.seq
 249997010     gbcon65.seq
  53203903     gbcon66.seq
 249995129     gbcon67.seq
 249997080     gbcon68.seq
 249999244     gbcon69.seq
 199375157     gbcon7.seq
 249997768     gbcon70.seq
 249999302     gbcon71.seq
  46505761     gbcon72.seq
 249997479     gbcon73.seq
 250000123     gbcon74.seq
 249999337     gbcon75.seq
 249997135     gbcon76.seq
 249996958     gbcon77.seq
 163671197     gbcon78.seq
 249996154     gbcon79.seq
 249993350     gbcon8.seq
 250000031     gbcon80.seq
 249995010     gbcon81.seq
 249997630     gbcon82.seq
 194598585     gbcon83.seq
 249997650     gbcon84.seq
 249997746     gbcon85.seq
 249995972     gbcon86.seq
 249996499     gbcon87.seq
 249998163     gbcon88.seq
   7197220     gbcon89.seq
 246642676     gbcon9.seq
 249996246     gbcon90.seq
 249997498     gbcon91.seq
 249996448     gbcon92.seq
 249998072     gbcon93.seq
 249997897     gbcon94.seq
 108419384     gbcon95.seq
 249999177     gbcon96.seq
 250000223     gbcon97.seq
 249994923     gbcon98.seq
 249998335     gbcon99.seq
   2419350     gbdel.txt
 249999243     gbenv1.seq
 249998704     gbenv10.seq
 249999834     gbenv11.seq
 249999315     gbenv12.seq
  60877425     gbenv13.seq
 249999586     gbenv14.seq
 249999453     gbenv15.seq
 249997729     gbenv16.seq
 249999729     gbenv17.seq
 249999621     gbenv18.seq
 249998911     gbenv19.seq
 250000171     gbenv2.seq
 249997582     gbenv20.seq
 249998366     gbenv21.seq
   8327963     gbenv22.seq
 249999497     gbenv23.seq
 249998337     gbenv24.seq
 249999532     gbenv25.seq
 249999494     gbenv26.seq
 182426301     gbenv27.seq
 249998528     gbenv28.seq
 249981054     gbenv29.seq
 249998610     gbenv3.seq
 250000173     gbenv30.seq
 249999866     gbenv31.seq
 249998316     gbenv32.seq
 249997641     gbenv33.seq
  78937292     gbenv34.seq
 249999624     gbenv35.seq
 249998437     gbenv36.seq
 249999769     gbenv37.seq
 249997082     gbenv38.seq
 187922866     gbenv39.seq
 249998547     gbenv4.seq
 249999162     gbenv40.seq
 249998654     gbenv41.seq
 249998128     gbenv42.seq
 249999051     gbenv43.seq
 249997851     gbenv44.seq
 249997627     gbenv45.seq
  54635531     gbenv46.seq
 250000169     gbenv47.seq
 250000214     gbenv48.seq
 249999795     gbenv49.seq
 244127841     gbenv5.seq
 249998391     gbenv50.seq
 199529735     gbenv51.seq
 249997378     gbenv52.seq
 249998091     gbenv53.seq
 249996878     gbenv54.seq
 250000231     gbenv55.seq
 249998743     gbenv56.seq
  89641403     gbenv57.seq
 249999181     gbenv58.seq
 249998661     gbenv59.seq
 249987804     gbenv6.seq
 249999654     gbenv60.seq
 249998679     gbenv61.seq
 249998179     gbenv62.seq
 221967618     gbenv63.seq
 249998230     gbenv64.seq
 249998005     gbenv65.seq
 249999773     gbenv66.seq
 249996796     gbenv67.seq
 250000071     gbenv68.seq
  93814951     gbenv69.seq
 249999971     gbenv7.seq
 249997783     gbenv70.seq
 249997755     gbenv71.seq
 249997253     gbenv72.seq
 249999924     gbenv73.seq
 249998606     gbenv74.seq
 154579990     gbenv75.seq
 250000047     gbenv76.seq
 249999793     gbenv77.seq
 249998003     gbenv78.seq
 249998200     gbenv79.seq
 183716645     gbenv8.seq
 249998905     gbenv80.seq
  99555701     gbenv81.seq
 249999195     gbenv82.seq
 249998350     gbenv83.seq
 249998899     gbenv84.seq
 249998006     gbenv85.seq
 197371920     gbenv86.seq
 250000101     gbenv87.seq
 249998839     gbenv88.seq
 249998111     gbenv89.seq
 249998171     gbenv9.seq
 249998570     gbenv90.seq
 249997583     gbenv91.seq
 249998300     gbenv92.seq
 249998434     gbenv93.seq
 249999520     gbenv94.seq
 119909156     gbenv95.seq
 524291248     gbest1.seq
 524291061     gbest10.seq
 524289081     gbest100.seq
 524291315     gbest101.seq
 524289364     gbest102.seq
 524291725     gbest103.seq
 351984199     gbest104.seq
 524291421     gbest105.seq
 524289783     gbest106.seq
 524292767     gbest107.seq
 382658661     gbest108.seq
 386097203     gbest109.seq
 524290496     gbest11.seq
 380000079     gbest110.seq
 380729939     gbest111.seq
 377641418     gbest112.seq
 381814764     gbest113.seq
 386023748     gbest114.seq
 385193102     gbest115.seq
 384027386     gbest116.seq
 380338395     gbest117.seq
 403514032     gbest118.seq
 482111035     gbest119.seq
 524289474     gbest12.seq
 524288832     gbest120.seq
 524290528     gbest121.seq
 524291602     gbest122.seq
 524289523     gbest123.seq
 473997069     gbest124.seq
 524290456     gbest125.seq
 524289964     gbest126.seq
 524291724     gbest127.seq
 524289732     gbest128.seq
 524290195     gbest129.seq
 146275575     gbest13.seq
 524291028     gbest130.seq
 524290723     gbest131.seq
 524289529     gbest132.seq
 524290759     gbest133.seq
 524290708     gbest134.seq
 524291962     gbest135.seq
 524291277     gbest136.seq
 290231468     gbest137.seq
 524290851     gbest138.seq
 524291208     gbest139.seq
 524289088     gbest14.seq
 524291489     gbest140.seq
 524291400     gbest141.seq
 524291925     gbest142.seq
 524290189     gbest143.seq
 524288791     gbest144.seq
 524288736     gbest145.seq
 524289722     gbest146.seq
 524289684     gbest147.seq
 524292126     gbest148.seq
 524291756     gbest149.seq
 524289566     gbest15.seq
 524288857     gbest150.seq
 469753103     gbest151.seq
 524288788     gbest152.seq
 524289615     gbest153.seq
 524292070     gbest154.seq
 524290439     gbest155.seq
 524289709     gbest156.seq
 524291100     gbest157.seq
 524288760     gbest158.seq
 524291552     gbest159.seq
 524289841     gbest16.seq
 524291525     gbest160.seq
 524289432     gbest161.seq
 524291279     gbest162.seq
 524290747     gbest163.seq
 239154714     gbest164.seq
 524289584     gbest165.seq
 524291164     gbest166.seq
 524289992     gbest167.seq
 524289659     gbest168.seq
 524290117     gbest169.seq
 524289601     gbest17.seq
 524290060     gbest170.seq
 524290221     gbest171.seq
 524288768     gbest172.seq
 524288738     gbest173.seq
 524289091     gbest174.seq
 524291207     gbest175.seq
 524291703     gbest176.seq
 524289435     gbest177.seq
  93258834     gbest178.seq
 524288887     gbest179.seq
 524289998     gbest18.seq
 524290228     gbest180.seq
 524290198     gbest181.seq
 524290734     gbest182.seq
 524289961     gbest183.seq
 524289071     gbest184.seq
 524291775     gbest185.seq
 524289148     gbest186.seq
 524291287     gbest187.seq
 524291968     gbest188.seq
 524289253     gbest189.seq
 524290188     gbest19.seq
 524289176     gbest190.seq
 458816806     gbest191.seq
 524292426     gbest192.seq
 524289282     gbest193.seq
 524292147     gbest194.seq
 524292135     gbest195.seq
 524289606     gbest196.seq
 524290978     gbest197.seq
 524288986     gbest198.seq
 524289098     gbest199.seq
 524291481     gbest2.seq
 524290537     gbest20.seq
 524290285     gbest200.seq
 524288825     gbest201.seq
 524290945     gbest202.seq
 524291612     gbest203.seq
 524288877     gbest204.seq
  40854590     gbest205.seq
 524289967     gbest206.seq
 524289971     gbest207.seq
 524288928     gbest208.seq
 524289793     gbest209.seq
 524289408     gbest21.seq
 524289369     gbest210.seq
 524289815     gbest211.seq
 524291134     gbest212.seq
 524292946     gbest213.seq
 524289888     gbest214.seq
 524289769     gbest215.seq
 473578876     gbest216.seq
 524289582     gbest217.seq
 524290596     gbest218.seq
 524292618     gbest219.seq
 492324279     gbest22.seq
 524288884     gbest220.seq
 524289706     gbest221.seq
 524296620     gbest222.seq
 524293088     gbest223.seq
 524292211     gbest224.seq
 524290788     gbest225.seq
 524293472     gbest226.seq
 524291644     gbest227.seq
 524290685     gbest228.seq
 462687496     gbest229.seq
 491393906     gbest23.seq
 524292406     gbest230.seq
 524289309     gbest231.seq
 524292558     gbest232.seq
 524292318     gbest233.seq
 524290106     gbest234.seq
 524291162     gbest235.seq
 524288802     gbest236.seq
 524291754     gbest237.seq
 524289068     gbest238.seq
 524291169     gbest239.seq
 502306003     gbest24.seq
 524290914     gbest240.seq
 524291258     gbest241.seq
 524289639     gbest242.seq
 524289602     gbest243.seq
 248242154     gbest244.seq
 524290929     gbest245.seq
 524292229     gbest246.seq
 524289568     gbest247.seq
 524289557     gbest248.seq
 524290795     gbest249.seq
 326344606     gbest25.seq
 524289270     gbest250.seq
 524290544     gbest251.seq
 520467073     gbest252.seq
 524289643     gbest253.seq
 524291146     gbest254.seq
 524291257     gbest255.seq
 333144418     gbest256.seq
 524289988     gbest257.seq
 524288942     gbest258.seq
 524288958     gbest259.seq
 524290540     gbest26.seq
 524290617     gbest260.seq
 524288846     gbest261.seq
 524290590     gbest262.seq
 524289793     gbest263.seq
 524289905     gbest264.seq
 524288752     gbest265.seq
 524291393     gbest266.seq
 218248701     gbest267.seq
 524290279     gbest268.seq
 524289977     gbest269.seq
 524289076     gbest27.seq
 524290732     gbest270.seq
 524291564     gbest271.seq
 524290835     gbest272.seq
 524288816     gbest273.seq
 524289522     gbest274.seq
 524290108     gbest275.seq
 524290705     gbest276.seq
 524289278     gbest277.seq
 524291234     gbest278.seq
 371051263     gbest279.seq
 524289730     gbest28.seq
 524288726     gbest280.seq
 524289263     gbest281.seq
 524291957     gbest282.seq
 524289504     gbest283.seq
 524288968     gbest284.seq
 524289433     gbest285.seq
 524289576     gbest286.seq
 524292435     gbest287.seq
 524292094     gbest288.seq
 524290357     gbest289.seq
 524291441     gbest29.seq
 524290126     gbest290.seq
 289207025     gbest291.seq
 524290045     gbest292.seq
 524290447     gbest293.seq
 524288832     gbest294.seq
 524289037     gbest295.seq
 524289226     gbest296.seq
 524292284     gbest297.seq
 524290924     gbest298.seq
 524291336     gbest299.seq
 488096828     gbest3.seq
 524293029     gbest30.seq
 524291167     gbest300.seq
 524289195     gbest301.seq
 469676381     gbest302.seq
 325638816     gbest303.seq
 475497685     gbest304.seq
 472632901     gbest305.seq
 524291423     gbest306.seq
 524291370     gbest307.seq
 524290292     gbest308.seq
 524289067     gbest309.seq
 524288731     gbest31.seq
 524292023     gbest310.seq
 524290206     gbest311.seq
 524289034     gbest312.seq
 524290980     gbest313.seq
 524291919     gbest314.seq
 524290719     gbest315.seq
 378923535     gbest316.seq
 524291670     gbest317.seq
 524289933     gbest318.seq
 524289070     gbest319.seq
 524290773     gbest32.seq
 524289585     gbest320.seq
 524289265     gbest321.seq
 524290884     gbest322.seq
 524290944     gbest323.seq
 524289594     gbest324.seq
 524291612     gbest325.seq
 524290339     gbest326.seq
 524289762     gbest327.seq
 514173399     gbest328.seq
 517234674     gbest329.seq
 524291057     gbest33.seq
 230958176     gbest330.seq
 524291203     gbest331.seq
 524292515     gbest332.seq
 524290012     gbest333.seq
 524288835     gbest334.seq
 524289360     gbest335.seq
 524293238     gbest336.seq
 494713844     gbest337.seq
 524289543     gbest338.seq
 524292633     gbest339.seq
 509456078     gbest34.seq
 524292227     gbest340.seq
 524288891     gbest341.seq
 524290195     gbest342.seq
 524288839     gbest343.seq
 335321169     gbest344.seq
 524290692     gbest345.seq
 524290188     gbest346.seq
 524289186     gbest347.seq
 524291804     gbest348.seq
 524290708     gbest349.seq
 486415960     gbest35.seq
 524290313     gbest350.seq
 510789078     gbest351.seq
 524290157     gbest352.seq
 524291449     gbest353.seq
 524290099     gbest354.seq
 524289838     gbest355.seq
 524289309     gbest356.seq
 524289837     gbest357.seq
 524290555     gbest358.seq
 142327139     gbest359.seq
 488144439     gbest36.seq
 524291699     gbest360.seq
 524289966     gbest361.seq
 524290594     gbest362.seq
 524289775     gbest363.seq
 524290395     gbest364.seq
 524290286     gbest365.seq
 524291088     gbest366.seq
 524289549     gbest367.seq
 524290850     gbest368.seq
 524290542     gbest369.seq
 486961754     gbest37.seq
 524290265     gbest370.seq
  66502079     gbest371.seq
 524290169     gbest372.seq
 524291019     gbest373.seq
 524291159     gbest374.seq
 524290823     gbest375.seq
 524291910     gbest376.seq
 524291053     gbest377.seq
 492684179     gbest378.seq
 524290139     gbest379.seq
 481688216     gbest38.seq
 524291543     gbest380.seq
 524290606     gbest381.seq
 524290945     gbest382.seq
 267040627     gbest383.seq
 524288839     gbest384.seq
 524290948     gbest385.seq
 524289303     gbest386.seq
 524290568     gbest387.seq
 524289831     gbest388.seq
 524289305     gbest389.seq
 485608330     gbest39.seq
 524290000     gbest390.seq
 524290224     gbest391.seq
 524290065     gbest392.seq
 524291530     gbest393.seq
 206114968     gbest394.seq
 524291193     gbest395.seq
 524291158     gbest396.seq
 524288996     gbest397.seq
 524291353     gbest398.seq
 524289694     gbest399.seq
 524289881     gbest4.seq
 134669460     gbest40.seq
 524292056     gbest400.seq
 524292216     gbest401.seq
 524291174     gbest402.seq
 524288830     gbest403.seq
 524289908     gbest404.seq
 524290428     gbest405.seq
 524289645     gbest406.seq
 418356052     gbest407.seq
 524289491     gbest408.seq
 524291795     gbest409.seq
 524288883     gbest41.seq
 524290094     gbest410.seq
 524289196     gbest411.seq
 524290153     gbest412.seq
 524291937     gbest413.seq
 524291859     gbest414.seq
 524289470     gbest415.seq
 524291234     gbest416.seq
 524289027     gbest417.seq
 524290114     gbest418.seq
 524290028     gbest419.seq
 524162079     gbest42.seq
 524291253     gbest420.seq
   2007785     gbest421.seq
 524291927     gbest422.seq
 524291812     gbest423.seq
 524290578     gbest424.seq
 524290594     gbest425.seq
 524290963     gbest426.seq
 524288979     gbest427.seq
 524292840     gbest428.seq
 524289132     gbest429.seq
 524289764     gbest43.seq
 524292087     gbest430.seq
 524290067     gbest431.seq
 524290276     gbest432.seq
 524289198     gbest433.seq
 524289944     gbest434.seq
 524289258     gbest435.seq
 130903236     gbest436.seq
 524289621     gbest437.seq
 524288994     gbest438.seq
 524290094     gbest439.seq
 524289150     gbest44.seq
 524291937     gbest440.seq
 524290429     gbest441.seq
 524288841     gbest442.seq
 524291712     gbest443.seq
 524289852     gbest444.seq
 524292928     gbest445.seq
 524291759     gbest446.seq
 524292939     gbest447.seq
 524291961     gbest448.seq
 163210506     gbest449.seq
 524289132     gbest45.seq
 524289591     gbest450.seq
 524288935     gbest451.seq
 524290005     gbest452.seq
 524289469     gbest453.seq
 524289897     gbest454.seq
 524289491     gbest455.seq
 524289960     gbest456.seq
 524291062     gbest457.seq
 524289857     gbest458.seq
 524290136     gbest459.seq
 524290241     gbest46.seq
 482929231     gbest460.seq
 524291094     gbest461.seq
 524289163     gbest462.seq
 524290048     gbest463.seq
 524289113     gbest464.seq
 524289845     gbest465.seq
 524291884     gbest466.seq
 524288914     gbest467.seq
 524290525     gbest468.seq
 524289637     gbest469.seq
 524288922     gbest47.seq
 524292297     gbest470.seq
 524289414     gbest471.seq
 388456960     gbest472.seq
 524290129     gbest473.seq
 524289892     gbest474.seq
 524289310     gbest475.seq
 524291208     gbest476.seq
 524289823     gbest477.seq
 524290378     gbest478.seq
 524288790     gbest479.seq
 524290753     gbest48.seq
 524289947     gbest480.seq
 374179063     gbest481.seq
 524289114     gbest49.seq
 524291458     gbest5.seq
 524290102     gbest50.seq
 524290521     gbest51.seq
 524291179     gbest52.seq
 524291275     gbest53.seq
 236876290     gbest54.seq
 524288762     gbest55.seq
 524290969     gbest56.seq
 524289164     gbest57.seq
 524289834     gbest58.seq
 524289066     gbest59.seq
 524290291     gbest6.seq
 524289616     gbest60.seq
 524291416     gbest61.seq
 524290963     gbest62.seq
 524289255     gbest63.seq
 524291605     gbest64.seq
 524291774     gbest65.seq
 524291998     gbest66.seq
 446632238     gbest67.seq
 524288924     gbest68.seq
 524290237     gbest69.seq
 524290105     gbest7.seq
 524290980     gbest70.seq
 524289127     gbest71.seq
 524290075     gbest72.seq
 524288757     gbest73.seq
 524291439     gbest74.seq
 524291270     gbest75.seq
 524293333     gbest76.seq
 524292421     gbest77.seq
 524289257     gbest78.seq
 524290274     gbest79.seq
 524289203     gbest8.seq
 166110754     gbest80.seq
 524290023     gbest81.seq
 524289401     gbest82.seq
 524290896     gbest83.seq
 524289637     gbest84.seq
 524289433     gbest85.seq
 524291839     gbest86.seq
 524289317     gbest87.seq
 524290350     gbest88.seq
 524291248     gbest89.seq
 524291083     gbest9.seq
 524288804     gbest90.seq
 524289282     gbest91.seq
 447804609     gbest92.seq
 524291742     gbest93.seq
 524290738     gbest94.seq
 524290251     gbest95.seq
 524289700     gbest96.seq
 524290553     gbest97.seq
 524289944     gbest98.seq
 524290982     gbest99.seq
 524290831     gbgss1.seq
 524290500     gbgss10.seq
 524289254     gbgss100.seq
 524291942     gbgss101.seq
 524292263     gbgss102.seq
 524289515     gbgss103.seq
 416309694     gbgss104.seq
 524291490     gbgss105.seq
 524291610     gbgss106.seq
 524289363     gbgss107.seq
 524291050     gbgss108.seq
 524290870     gbgss109.seq
 524291403     gbgss11.seq
 524288929     gbgss110.seq
 524290170     gbgss111.seq
 524291202     gbgss112.seq
 524289043     gbgss113.seq
 524288822     gbgss114.seq
 524290848     gbgss115.seq
  51468367     gbgss116.seq
 524288799     gbgss117.seq
 524290604     gbgss118.seq
 524291051     gbgss119.seq
 524291113     gbgss12.seq
 524291468     gbgss120.seq
 524291591     gbgss121.seq
 524290953     gbgss122.seq
 524290865     gbgss123.seq
 524290463     gbgss124.seq
 524289524     gbgss125.seq
 524288832     gbgss126.seq
 524289518     gbgss127.seq
 524289100     gbgss128.seq
 198119333     gbgss129.seq
 524292169     gbgss13.seq
 524289462     gbgss130.seq
 524289011     gbgss131.seq
 524290462     gbgss132.seq
 524290721     gbgss133.seq
 524289833     gbgss134.seq
 524289712     gbgss135.seq
 524289211     gbgss136.seq
 524289088     gbgss137.seq
 524288831     gbgss138.seq
 506004286     gbgss139.seq
 524290629     gbgss14.seq
 498420394     gbgss140.seq
 179574002     gbgss141.seq
 524289563     gbgss142.seq
 524289936     gbgss143.seq
 524289089     gbgss144.seq
 524289581     gbgss145.seq
 524291353     gbgss146.seq
 524289159     gbgss147.seq
 524290259     gbgss148.seq
 524290037     gbgss149.seq
 524290199     gbgss15.seq
 524290427     gbgss150.seq
 524290341     gbgss151.seq
 327422547     gbgss152.seq
 524291285     gbgss153.seq
 524290281     gbgss154.seq
 524291873     gbgss155.seq
 524291273     gbgss156.seq
 524291377     gbgss157.seq
 524291238     gbgss158.seq
 524291100     gbgss159.seq
 524289443     gbgss16.seq
 524289785     gbgss160.seq
 524290988     gbgss161.seq
 524289953     gbgss162.seq
 524291227     gbgss163.seq
 524291884     gbgss164.seq
 129450441     gbgss165.seq
 524290104     gbgss166.seq
 524289893     gbgss167.seq
 524289404     gbgss168.seq
 524290338     gbgss169.seq
 524290913     gbgss17.seq
 524288994     gbgss170.seq
 524289132     gbgss171.seq
 524288768     gbgss172.seq
 419520268     gbgss173.seq
 249998739     gbgss174.seq
 249997727     gbgss175.seq
 249998129     gbgss176.seq
 249997964     gbgss177.seq
  31810345     gbgss178.seq
 249997137     gbgss179.seq
 524289915     gbgss18.seq
 250000033     gbgss180.seq
 249998542     gbgss181.seq
 249998168     gbgss182.seq
 224919493     gbgss183.seq
 249998415     gbgss184.seq
 249999205     gbgss185.seq
 249999508     gbgss186.seq
 250000175     gbgss187.seq
 193957356     gbgss188.seq
 249997950     gbgss189.seq
 302682262     gbgss19.seq
 249998694     gbgss190.seq
 249998786     gbgss191.seq
 249999485     gbgss192.seq
 249997276     gbgss193.seq
  71085900     gbgss194.seq
 249999852     gbgss195.seq
   2112081     gbgss196.seq
  80349448     gbgss197.seq
 249999264     gbgss198.seq
 249998529     gbgss199.seq
 524290064     gbgss2.seq
 524289230     gbgss20.seq
  87602941     gbgss200.seq
 249999685     gbgss201.seq
 249998355     gbgss202.seq
 250000242     gbgss203.seq
 202974017     gbgss204.seq
 249999232     gbgss205.seq
 249999415     gbgss206.seq
 249999535     gbgss207.seq
 246297144     gbgss208.seq
 249997836     gbgss209.seq
 524290010     gbgss21.seq
 249999647     gbgss210.seq
 249998223     gbgss211.seq
 244710946     gbgss212.seq
 249999336     gbgss213.seq
 249996623     gbgss214.seq
 249999794     gbgss215.seq
 249996718     gbgss216.seq
 126591595     gbgss217.seq
 249997411     gbgss218.seq
 249997998     gbgss219.seq
 524289494     gbgss22.seq
 249999931     gbgss220.seq
 249998615     gbgss221.seq
  92409107     gbgss222.seq
 249999742     gbgss223.seq
 249999443     gbgss224.seq
 249998584     gbgss225.seq
 249999085     gbgss226.seq
 249998670     gbgss227.seq
 144091390     gbgss228.seq
 249997846     gbgss229.seq
 524291691     gbgss23.seq
 249999124     gbgss230.seq
 249997821     gbgss231.seq
 249997789     gbgss232.seq
  84917634     gbgss233.seq
 249999735     gbgss234.seq
 249999422     gbgss235.seq
 249998643     gbgss236.seq
 249999473     gbgss237.seq
 249997223     gbgss238.seq
 249998108     gbgss239.seq
 524290198     gbgss24.seq
 108672760     gbgss240.seq
 249999266     gbgss241.seq
 249999352     gbgss242.seq
 249999943     gbgss243.seq
  56997815     gbgss244.seq
  53334267     gbgss245.seq
 249999101     gbgss246.seq
 249999225     gbgss247.seq
 249999246     gbgss248.seq
 250000245     gbgss249.seq
 524289476     gbgss25.seq
 249999181     gbgss250.seq
 249997776     gbgss251.seq
 212341896     gbgss252.seq
 249999617     gbgss253.seq
 250000113     gbgss254.seq
 249997380     gbgss255.seq
 249999823     gbgss256.seq
  27507329     gbgss257.seq
 249997661     gbgss258.seq
 249999221     gbgss259.seq
 524290914     gbgss26.seq
 249996455     gbgss260.seq
 249997767     gbgss261.seq
 249999776     gbgss262.seq
 249999649     gbgss263.seq
 191301715     gbgss264.seq
 249998299     gbgss265.seq
 249999964     gbgss266.seq
 249999490     gbgss267.seq
 227730674     gbgss268.seq
 249998576     gbgss269.seq
 524290993     gbgss27.seq
 249999605     gbgss270.seq
 249997419     gbgss271.seq
 249997559     gbgss272.seq
 249997164     gbgss273.seq
 249999564     gbgss274.seq
 150742499     gbgss275.seq
 249999342     gbgss276.seq
 249998535     gbgss277.seq
 249997745     gbgss278.seq
 249998494     gbgss279.seq
 524289128     gbgss28.seq
 232359855     gbgss280.seq
 249997371     gbgss281.seq
 249997691     gbgss282.seq
 249997807     gbgss283.seq
 249996653     gbgss284.seq
 249998033     gbgss285.seq
 122000632     gbgss286.seq
 249999562     gbgss287.seq
 249998752     gbgss288.seq
 249999600     gbgss289.seq
 524290612     gbgss29.seq
 249999029     gbgss290.seq
 221982324     gbgss291.seq
 249999829     gbgss292.seq
 250000049     gbgss293.seq
 249999422     gbgss294.seq
 249998101     gbgss295.seq
  91611181     gbgss296.seq
 249998405     gbgss297.seq
 250000147     gbgss298.seq
 249999022     gbgss299.seq
 524289051     gbgss3.seq
 524289677     gbgss30.seq
 249998978     gbgss300.seq
 249999348     gbgss301.seq
 249998553     gbgss302.seq
 140417596     gbgss303.seq
  60005303     gbgss31.seq
 524289317     gbgss32.seq
 524288814     gbgss33.seq
 524289683     gbgss34.seq
 524288841     gbgss35.seq
 524290682     gbgss36.seq
 524289081     gbgss37.seq
 524290662     gbgss38.seq
 498937589     gbgss39.seq
 524288801     gbgss4.seq
 524292695     gbgss40.seq
 524290767     gbgss41.seq
 524290197     gbgss42.seq
  38893329     gbgss43.seq
 524289606     gbgss44.seq
 524291267     gbgss45.seq
 524288919     gbgss46.seq
 524290160     gbgss47.seq
 226134995     gbgss48.seq
 524289088     gbgss49.seq
 160043826     gbgss5.seq
 524291855     gbgss50.seq
 524289535     gbgss51.seq
 524290608     gbgss52.seq
 524290847     gbgss53.seq
 524290853     gbgss54.seq
 524291543     gbgss55.seq
 524291406     gbgss56.seq
 524289687     gbgss57.seq
 524288874     gbgss58.seq
 524289776     gbgss59.seq
 524290099     gbgss6.seq
  46449920     gbgss60.seq
 524290292     gbgss61.seq
 524289281     gbgss62.seq
 524291599     gbgss63.seq
 460094592     gbgss64.seq
 524289058     gbgss65.seq
 524291915     gbgss66.seq
 524290169     gbgss67.seq
 524289070     gbgss68.seq
 524290849     gbgss69.seq
 524290281     gbgss7.seq
 524289831     gbgss70.seq
 524291565     gbgss71.seq
 524290413     gbgss72.seq
 524291061     gbgss73.seq
 524290599     gbgss74.seq
 524290750     gbgss75.seq
 524290533     gbgss76.seq
  49842947     gbgss77.seq
 524290812     gbgss78.seq
 524289925     gbgss79.seq
 524289869     gbgss8.seq
 524290691     gbgss80.seq
 524290728     gbgss81.seq
 524289126     gbgss82.seq
 524290941     gbgss83.seq
 524291274     gbgss84.seq
 524290623     gbgss85.seq
 524289899     gbgss86.seq
 524290720     gbgss87.seq
 524291087     gbgss88.seq
 386608837     gbgss89.seq
 524290571     gbgss9.seq
 524292344     gbgss90.seq
 524292444     gbgss91.seq
 524289266     gbgss92.seq
 524292472     gbgss93.seq
 524290689     gbgss94.seq
 524292079     gbgss95.seq
 524289433     gbgss96.seq
 524290383     gbgss97.seq
 524292130     gbgss98.seq
 524291272     gbgss99.seq
 249993884     gbhtc1.seq
 249999255     gbhtc10.seq
 249999889     gbhtc11.seq
 114167521     gbhtc12.seq
 250000092     gbhtc13.seq
 249999267     gbhtc14.seq
 148037460     gbhtc15.seq
 249995319     gbhtc2.seq
 249993906     gbhtc3.seq
 249998396     gbhtc4.seq
 249989366     gbhtc5.seq
 249989186     gbhtc6.seq
 249996567     gbhtc7.seq
  85908087     gbhtc8.seq
 249998301     gbhtc9.seq
 249935589     gbhtg1.seq
 249953451     gbhtg10.seq
 249912439     gbhtg100.seq
 249866482     gbhtg101.seq
 249548804     gbhtg102.seq
 249905568     gbhtg103.seq
   3688468     gbhtg104.seq
 249815335     gbhtg105.seq
 249888148     gbhtg106.seq
 249851229     gbhtg107.seq
 249907584     gbhtg108.seq
 249989197     gbhtg109.seq
    799345     gbhtg11.seq
 249789219     gbhtg110.seq
 167859406     gbhtg111.seq
 249871646     gbhtg112.seq
 249961061     gbhtg113.seq
 249891820     gbhtg114.seq
 249930745     gbhtg115.seq
 249789870     gbhtg116.seq
 249989661     gbhtg117.seq
 249966181     gbhtg118.seq
 219076623     gbhtg119.seq
 249887872     gbhtg12.seq
 249852224     gbhtg120.seq
 249901917     gbhtg121.seq
 249988304     gbhtg122.seq
 249907211     gbhtg123.seq
 249918797     gbhtg124.seq
 249974119     gbhtg125.seq
 249870359     gbhtg126.seq
 249931510     gbhtg127.seq
 249827706     gbhtg128.seq
 249926259     gbhtg129.seq
 249967619     gbhtg13.seq
 249980450     gbhtg130.seq
    526931     gbhtg131.seq
 249979004     gbhtg132.seq
 249792568     gbhtg133.seq
 246328967     gbhtg134.seq
 249729843     gbhtg135.seq
 249950564     gbhtg136.seq
 141393711     gbhtg137.seq
 249860825     gbhtg138.seq
 249838305     gbhtg139.seq
 249584228     gbhtg14.seq
 249821150     gbhtg140.seq
 249911276     gbhtg141.seq
 249828373     gbhtg142.seq
 134515756     gbhtg143.seq
 249956990     gbhtg144.seq
 249814020     gbhtg145.seq
 249834009     gbhtg146.seq
 249921180     gbhtg147.seq
 249997474     gbhtg148.seq
 249813182     gbhtg149.seq
 249771919     gbhtg15.seq
 249939321     gbhtg150.seq
 249885440     gbhtg151.seq
 249995805     gbhtg152.seq
 249574178     gbhtg153.seq
 237420050     gbhtg154.seq
 249738514     gbhtg16.seq
 249165958     gbhtg17.seq
 249980023     gbhtg18.seq
 249676824     gbhtg19.seq
 249996522     gbhtg2.seq
 249986149     gbhtg20.seq
 237141818     gbhtg21.seq
 249756771     gbhtg22.seq
 249864682     gbhtg23.seq
 249983387     gbhtg24.seq
 249917977     gbhtg25.seq
 249757014     gbhtg26.seq
 249887744     gbhtg27.seq
 249957955     gbhtg28.seq
 249838343     gbhtg29.seq
 249996216     gbhtg3.seq
 249989516     gbhtg30.seq
 225321862     gbhtg31.seq
 249823624     gbhtg32.seq
 249917494     gbhtg33.seq
 249925313     gbhtg34.seq
 249914652     gbhtg35.seq
 249854042     gbhtg36.seq
 249811834     gbhtg37.seq
 249764454     gbhtg38.seq
 249623490     gbhtg39.seq
 249972436     gbhtg4.seq
 249836303     gbhtg40.seq
 224358179     gbhtg41.seq
 249873953     gbhtg42.seq
 249782842     gbhtg43.seq
 249972744     gbhtg44.seq
 249775813     gbhtg45.seq
 249969730     gbhtg46.seq
 249708936     gbhtg47.seq
 249863648     gbhtg48.seq
 249890163     gbhtg49.seq
 249908832     gbhtg5.seq
 249900107     gbhtg50.seq
 234820301     gbhtg51.seq
 249734905     gbhtg52.seq
 249972831     gbhtg53.seq
 249785177     gbhtg54.seq
 249720551     gbhtg55.seq
 249959801     gbhtg56.seq
  18795879     gbhtg57.seq
 249860951     gbhtg58.seq
 249828685     gbhtg59.seq
 249992589     gbhtg6.seq
 249998409     gbhtg60.seq
 249924871     gbhtg61.seq
 225131281     gbhtg62.seq
 249885321     gbhtg63.seq
 249908283     gbhtg64.seq
 249801379     gbhtg65.seq
 249764001     gbhtg66.seq
 249829947     gbhtg67.seq
  16219827     gbhtg68.seq
 249985806     gbhtg69.seq
 249808286     gbhtg7.seq
 249884242     gbhtg70.seq
 249965546     gbhtg71.seq
 249769227     gbhtg72.seq
 223428576     gbhtg73.seq
 249948298     gbhtg74.seq
 249890417     gbhtg75.seq
 249853113     gbhtg76.seq
 249954582     gbhtg77.seq
 235178045     gbhtg78.seq
 249882552     gbhtg79.seq
 249827100     gbhtg8.seq
 249980343     gbhtg80.seq
 249869955     gbhtg81.seq
 249894930     gbhtg82.seq
 202300570     gbhtg83.seq
 249873886     gbhtg84.seq
 249951229     gbhtg85.seq
 249869760     gbhtg86.seq
 249889142     gbhtg87.seq
 206020594     gbhtg88.seq
 249893096     gbhtg89.seq
 249952756     gbhtg9.seq
 249878126     gbhtg90.seq
 249782466     gbhtg91.seq
 249893923     gbhtg92.seq
 194413602     gbhtg93.seq
 249975890     gbhtg94.seq
 249987330     gbhtg95.seq
 249876035     gbhtg96.seq
 249800612     gbhtg97.seq
 161659006     gbhtg98.seq
 249873981     gbhtg99.seq
 249997229     gbinv1.seq
 249130724     gbinv10.seq
 249996456     gbinv100.seq
 249997555     gbinv101.seq
 249997832     gbinv102.seq
  80271449     gbinv103.seq
 249955085     gbinv104.seq
 249996849     gbinv105.seq
 249991952     gbinv106.seq
 249976130     gbinv107.seq
 249999980     gbinv108.seq
 249983498     gbinv109.seq
 248749950     gbinv11.seq
 249996598     gbinv110.seq
  89129686     gbinv111.seq
 249973375     gbinv112.seq
 249899693     gbinv113.seq
 249979396     gbinv114.seq
 249998795     gbinv115.seq
 249994232     gbinv116.seq
 249966582     gbinv117.seq
 249983747     gbinv118.seq
 249995961     gbinv119.seq
 249994371     gbinv12.seq
 249994417     gbinv120.seq
 151414969     gbinv121.seq
 249999545     gbinv122.seq
 249995664     gbinv123.seq
 249998338     gbinv124.seq
 249793471     gbinv125.seq
 249981535     gbinv126.seq
 249997903     gbinv127.seq
 243824572     gbinv128.seq
  52925611     gbinv129.seq
 249997495     gbinv13.seq
 249973860     gbinv130.seq
 249946261     gbinv131.seq
 249988320     gbinv132.seq
 249993992     gbinv133.seq
  28355116     gbinv134.seq
 250000131     gbinv135.seq
 249997724     gbinv136.seq
  59918656     gbinv137.seq
 249998579     gbinv138.seq
 249973278     gbinv139.seq
 184899960     gbinv14.seq
 249995075     gbinv140.seq
 249994925     gbinv141.seq
 148119999     gbinv142.seq
 249995603     gbinv143.seq
 249999045     gbinv144.seq
 249999297     gbinv145.seq
 249999642     gbinv146.seq
 249998443     gbinv147.seq
 249999508     gbinv148.seq
 249998781     gbinv149.seq
 249998966     gbinv15.seq
 249188091     gbinv150.seq
 248712401     gbinv151.seq
 234479150     gbinv152.seq
 249999752     gbinv16.seq
 249998909     gbinv17.seq
 166380037     gbinv18.seq
 249285666     gbinv19.seq
 249908118     gbinv2.seq
 248668359     gbinv20.seq
 249999968     gbinv21.seq
 249993414     gbinv22.seq
 249998639     gbinv23.seq
   2021972     gbinv24.seq
 230403036     gbinv25.seq
 175506967     gbinv26.seq
 249999330     gbinv27.seq
 249998933     gbinv28.seq
 228001583     gbinv29.seq
 249841697     gbinv3.seq
 249999284     gbinv30.seq
 249998633     gbinv31.seq
 249999280     gbinv32.seq
 249999424     gbinv33.seq
 183950992     gbinv34.seq
 249999977     gbinv35.seq
 249982110     gbinv36.seq
 249999312     gbinv37.seq
 249998015     gbinv38.seq
 189364583     gbinv39.seq
 205455085     gbinv4.seq
 249997349     gbinv40.seq
 249996728     gbinv41.seq
 249994617     gbinv42.seq
 249997916     gbinv43.seq
 125065436     gbinv44.seq
 250000210     gbinv45.seq
 250000020     gbinv46.seq
 249997252     gbinv47.seq
 249994399     gbinv48.seq
 103676686     gbinv49.seq
 249996555     gbinv5.seq
 249998546     gbinv50.seq
 249998736     gbinv51.seq
 250000180     gbinv52.seq
 249997713     gbinv53.seq
 104210163     gbinv54.seq
 249996743     gbinv55.seq
 249999942     gbinv56.seq
 249996683     gbinv57.seq
 249999116     gbinv58.seq
 250000035     gbinv59.seq
 249997791     gbinv6.seq
 249998465     gbinv60.seq
 202487713     gbinv61.seq
 249997671     gbinv62.seq
 249999512     gbinv63.seq
 249998853     gbinv64.seq
 249999156     gbinv65.seq
 248494585     gbinv66.seq
 249999301     gbinv67.seq
  34146797     gbinv68.seq
 249999790     gbinv69.seq
 249999899     gbinv7.seq
 250000189     gbinv70.seq
 250000091     gbinv71.seq
 201580572     gbinv72.seq
 249926462     gbinv73.seq
 249971937     gbinv74.seq
 247889588     gbinv75.seq
 249920717     gbinv76.seq
 249921421     gbinv77.seq
 249871878     gbinv78.seq
 249897317     gbinv79.seq
 234435205     gbinv8.seq
 221036085     gbinv80.seq
 249997947     gbinv81.seq
 249993437     gbinv82.seq
 249995495     gbinv83.seq
 249997709     gbinv84.seq
  51747128     gbinv85.seq
 249996142     gbinv86.seq
 249961763     gbinv87.seq
 249996526     gbinv88.seq
 249990785     gbinv89.seq
 249997098     gbinv9.seq
 249983105     gbinv90.seq
 249977710     gbinv91.seq
 249994985     gbinv92.seq
 249998590     gbinv93.seq
 249999068     gbinv94.seq
 224842193     gbinv95.seq
 249976996     gbinv96.seq
 249991734     gbinv97.seq
 249996378     gbinv98.seq
 249999578     gbinv99.seq
 249757871     gbmam1.seq
 338653945     gbmam10.seq
 315434421     gbmam11.seq
 162425861     gbmam12.seq
 150157348     gbmam13.seq
 159032552     gbmam14.seq
 136269244     gbmam15.seq
 122412969     gbmam16.seq
 248159424     gbmam17.seq
 202955099     gbmam18.seq
 208310894     gbmam19.seq
 249998899     gbmam2.seq
 209752374     gbmam20.seq
 197940571     gbmam21.seq
 230561883     gbmam22.seq
 220222486     gbmam23.seq
 123191148     gbmam24.seq
 191446547     gbmam25.seq
   9946563     gbmam26.seq
  43996573     gbmam27.seq
  91328397     gbmam28.seq
  88836150     gbmam29.seq
  85292787     gbmam3.seq
   6429575     gbmam30.seq
  21179271     gbmam31.seq
 249998387     gbmam32.seq
 203003044     gbmam33.seq
 249998413     gbmam34.seq
 249999465     gbmam35.seq
 249999527     gbmam36.seq
 220888005     gbmam37.seq
 249998572     gbmam38.seq
   2315048     gbmam39.seq
  83818517     gbmam4.seq
  71963309     gbmam5.seq
  22758642     gbmam6.seq
   1275077     gbmam7.seq
   2480909     gbmam8.seq
 375834671     gbmam9.seq
  12633566     gbnew.txt
 249998793     gbpat1.seq
 249999153     gbpat10.seq
 249999052     gbpat100.seq
 249998996     gbpat101.seq
 249999065     gbpat102.seq
 249999793     gbpat103.seq
 149112469     gbpat104.seq
 249999880     gbpat105.seq
 249998929     gbpat106.seq
 249928220     gbpat107.seq
 249824879     gbpat108.seq
 249998856     gbpat109.seq
 179864487     gbpat11.seq
 192956440     gbpat110.seq
 249999860     gbpat111.seq
 249999699     gbpat112.seq
 249995886     gbpat113.seq
  80387229     gbpat114.seq
 250000030     gbpat115.seq
 249999279     gbpat116.seq
 249779774     gbpat117.seq
 250000129     gbpat118.seq
 249999583     gbpat119.seq
 249996002     gbpat12.seq
  67188949     gbpat120.seq
 249998923     gbpat121.seq
 250000184     gbpat122.seq
 249999601     gbpat123.seq
 249999810     gbpat124.seq
 160252740     gbpat125.seq
 249999692     gbpat126.seq
 250000171     gbpat127.seq
 234780519     gbpat128.seq
 249991536     gbpat129.seq
 249999992     gbpat13.seq
 249970935     gbpat130.seq
 249999745     gbpat131.seq
 249999400     gbpat132.seq
 249994345     gbpat133.seq
  66832984     gbpat134.seq
 249992315     gbpat135.seq
 249999844     gbpat136.seq
 250000121     gbpat137.seq
 250000131     gbpat138.seq
 249999522     gbpat139.seq
 249999791     gbpat14.seq
  18435141     gbpat140.seq
 249999655     gbpat141.seq
 249998828     gbpat142.seq
 249999803     gbpat143.seq
 249999630     gbpat144.seq
  46945926     gbpat145.seq
 250000154     gbpat146.seq
 249998813     gbpat147.seq
 249998963     gbpat148.seq
 234578566     gbpat149.seq
 249996354     gbpat15.seq
 249999721     gbpat150.seq
 249999524     gbpat151.seq
 250000054     gbpat152.seq
  86839732     gbpat153.seq
 249999922     gbpat154.seq
 249999316     gbpat155.seq
 250000037     gbpat156.seq
  63844747     gbpat157.seq
 250000051     gbpat158.seq
 249997830     gbpat159.seq
 250000152     gbpat16.seq
 249999716     gbpat160.seq
 249999171     gbpat161.seq
 249999446     gbpat162.seq
 249998740     gbpat163.seq
 224222052     gbpat164.seq
 250000249     gbpat165.seq
 249999893     gbpat166.seq
 249999893     gbpat167.seq
 220539897     gbpat168.seq
 249999753     gbpat169.seq
  75613376     gbpat17.seq
 249999903     gbpat170.seq
 249999862     gbpat171.seq
  12453813     gbpat172.seq
 249950771     gbpat173.seq
 250000246     gbpat174.seq
 250000125     gbpat175.seq
 249998896     gbpat176.seq
  91698903     gbpat177.seq
 249999432     gbpat178.seq
 249999105     gbpat179.seq
 250000027     gbpat18.seq
 249998633     gbpat180.seq
 250000180     gbpat181.seq
   9115252     gbpat182.seq
 249999856     gbpat183.seq
 249999183     gbpat184.seq
 249999616     gbpat185.seq
 174952464     gbpat186.seq
 250000222     gbpat187.seq
 249995822     gbpat188.seq
 250000136     gbpat189.seq
 250000005     gbpat19.seq
 250000015     gbpat190.seq
  76767668     gbpat191.seq
 250000158     gbpat192.seq
 249987422     gbpat193.seq
 249999879     gbpat194.seq
 249996128     gbpat195.seq
 250000230     gbpat196.seq
 249999916     gbpat197.seq
  87541805     gbpat198.seq
 249998561     gbpat199.seq
 249998199     gbpat2.seq
 250000048     gbpat20.seq
 249997943     gbpat200.seq
 250000041     gbpat201.seq
 249997763     gbpat202.seq
 214704514     gbpat203.seq
 250000131     gbpat204.seq
 249208826     gbpat205.seq
 249997742     gbpat206.seq
 249999400     gbpat207.seq
 181207629     gbpat208.seq
 249548891     gbpat209.seq
 249996002     gbpat21.seq
 248510893     gbpat210.seq
 249999288     gbpat211.seq
 249999564     gbpat212.seq
 249922836     gbpat213.seq
 249999818     gbpat214.seq
  18031394     gbpat215.seq
 249999209     gbpat216.seq
 249997908     gbpat217.seq
 249999127     gbpat218.seq
 120256598     gbpat219.seq
 186231274     gbpat22.seq
 249998973     gbpat220.seq
 249997519     gbpat221.seq
 249995791     gbpat222.seq
 249996771     gbpat223.seq
 249994328     gbpat224.seq
 249994052     gbpat225.seq
 249998641     gbpat226.seq
 249999677     gbpat227.seq
  71853592     gbpat228.seq
 249999586     gbpat229.seq
 250000256     gbpat23.seq
 249999857     gbpat230.seq
 250000010     gbpat231.seq
 249999833     gbpat232.seq
 226268143     gbpat233.seq
 249999524     gbpat234.seq
 250000119     gbpat235.seq
 250000084     gbpat236.seq
 249999003     gbpat237.seq
  66984112     gbpat238.seq
 249997007     gbpat239.seq
 249824197     gbpat24.seq
 250000179     gbpat240.seq
 249992908     gbpat241.seq
 249997832     gbpat242.seq
 249993405     gbpat243.seq
 244588890     gbpat244.seq
 250000137     gbpat245.seq
 249998505     gbpat246.seq
 249999477     gbpat247.seq
 249998705     gbpat248.seq
  35684095     gbpat249.seq
 249999932     gbpat25.seq
 249999356     gbpat250.seq
 249994110     gbpat251.seq
 249999700     gbpat252.seq
 144872604     gbpat253.seq
 249707336     gbpat254.seq
 249999719     gbpat255.seq
 250000099     gbpat256.seq
  74014219     gbpat257.seq
 250000099     gbpat258.seq
 249999927     gbpat259.seq
 250000183     gbpat26.seq
 249997659     gbpat260.seq
 159284155     gbpat261.seq
 249999413     gbpat262.seq
 249953991     gbpat263.seq
 249999044     gbpat264.seq
 249999694     gbpat265.seq
 249995608     gbpat266.seq
 249995229     gbpat267.seq
  36010217     gbpat268.seq
 249999184     gbpat269.seq
  71839519     gbpat27.seq
 249996815     gbpat270.seq
 249997460     gbpat271.seq
 249999421     gbpat272.seq
 249999139     gbpat273.seq
 249999825     gbpat274.seq
 249997983     gbpat275.seq
 116153162     gbpat276.seq
 249997632     gbpat277.seq
 249999337     gbpat278.seq
 249999611     gbpat279.seq
 249997849     gbpat28.seq
 249996583     gbpat280.seq
 249998750     gbpat281.seq
 249999104     gbpat282.seq
 109859465     gbpat283.seq
 249998865     gbpat29.seq
 249999364     gbpat3.seq
 249998293     gbpat30.seq
 249999090     gbpat31.seq
 249999689     gbpat32.seq
 180420989     gbpat33.seq
 249999040     gbpat34.seq
 249998820     gbpat35.seq
 249999458     gbpat36.seq
 249998893     gbpat37.seq
 249999264     gbpat38.seq
 249998992     gbpat39.seq
 249998815     gbpat4.seq
 249843525     gbpat40.seq
 103949722     gbpat41.seq
 249999647     gbpat42.seq
 249970304     gbpat43.seq
 249999848     gbpat44.seq
 250000114     gbpat45.seq
 249996856     gbpat46.seq
 249936194     gbpat47.seq
 249999788     gbpat48.seq
 250000051     gbpat49.seq
  71663145     gbpat5.seq
 172111194     gbpat50.seq
 249998120     gbpat51.seq
 249999740     gbpat52.seq
 250000064     gbpat53.seq
 250000038     gbpat54.seq
 222935237     gbpat55.seq
 249999057     gbpat56.seq
 249999847     gbpat57.seq
 249999517     gbpat58.seq
 164755303     gbpat59.seq
 249998966     gbpat6.seq
 249911938     gbpat60.seq
 249999632     gbpat61.seq
 249998692     gbpat62.seq
 249999588     gbpat63.seq
 136008468     gbpat64.seq
 250000038     gbpat65.seq
 249998123     gbpat66.seq
 249996994     gbpat67.seq
 249998077     gbpat68.seq
 250000144     gbpat69.seq
 249999628     gbpat7.seq
 250000131     gbpat70.seq
 144901242     gbpat71.seq
 250000118     gbpat72.seq
 249999899     gbpat73.seq
 249998837     gbpat74.seq
 244400787     gbpat75.seq
 248968857     gbpat76.seq
 244458666     gbpat77.seq
 247877948     gbpat78.seq
 249999900     gbpat79.seq
 249993968     gbpat8.seq
 160632775     gbpat80.seq
 250000121     gbpat81.seq
 249999657     gbpat82.seq
 249999470     gbpat83.seq
 249999644     gbpat84.seq
 249996706     gbpat85.seq
 249998694     gbpat86.seq
  99352539     gbpat87.seq
 249158092     gbpat88.seq
 249999477     gbpat89.seq
 249999637     gbpat9.seq
 249998924     gbpat90.seq
 249999386     gbpat91.seq
 249999088     gbpat92.seq
 249999429     gbpat93.seq
 145309507     gbpat94.seq
 249999839     gbpat95.seq
 249998956     gbpat96.seq
 249999939     gbpat97.seq
 250000257     gbpat98.seq
 196973298     gbpat99.seq
 249913552     gbphg1.seq
 249988223     gbphg2.seq
 238494166     gbphg3.seq
 249998370     gbpln1.seq
 157157066     gbpln10.seq
 249998681     gbpln100.seq
 249998427     gbpln101.seq
 250000077     gbpln102.seq
 249998454     gbpln103.seq
 249999328     gbpln104.seq
  26979942     gbpln105.seq
 249999548     gbpln106.seq
 249994736     gbpln107.seq
 249999347     gbpln108.seq
 249998091     gbpln109.seq
 249999348     gbpln11.seq
  92110208     gbpln110.seq
 249999024     gbpln111.seq
 249661995     gbpln112.seq
 249998462     gbpln113.seq
 213257902     gbpln114.seq
 249999477     gbpln115.seq
 249998886     gbpln116.seq
 250000228     gbpln117.seq
 162132185     gbpln118.seq
 249996384     gbpln119.seq
 249996737     gbpln12.seq
 249995467     gbpln120.seq
 249999449     gbpln121.seq
 124411749     gbpln122.seq
 249999942     gbpln123.seq
 249998086     gbpln124.seq
 249999673     gbpln125.seq
 129098466     gbpln126.seq
 250000198     gbpln127.seq
 249999662     gbpln128.seq
 249998767     gbpln129.seq
 249998296     gbpln13.seq
  62261687     gbpln130.seq
 249999621     gbpln131.seq
 248962411     gbpln132.seq
 247373913     gbpln133.seq
 246119716     gbpln134.seq
 236031691     gbpln135.seq
 230146972     gbpln136.seq
 238389782     gbpln137.seq
 242341149     gbpln138.seq
 239901809     gbpln139.seq
 249990209     gbpln14.seq
 204234827     gbpln140.seq
 209308211     gbpln141.seq
 249998456     gbpln142.seq
  65121491     gbpln143.seq
 230978729     gbpln15.seq
 249986655     gbpln16.seq
 249971191     gbpln17.seq
 249953271     gbpln18.seq
  20516461     gbpln19.seq
 249998518     gbpln2.seq
 242162680     gbpln20.seq
 249961568     gbpln21.seq
 248513124     gbpln22.seq
 248932558     gbpln23.seq
 239020735     gbpln24.seq
 232335792     gbpln25.seq
 233137901     gbpln26.seq
 235733976     gbpln27.seq
 199441006     gbpln28.seq
 196263817     gbpln29.seq
 249830550     gbpln3.seq
 249999357     gbpln30.seq
  98663584     gbpln31.seq
 249996466     gbpln32.seq
 136625162     gbpln33.seq
 206776474     gbpln34.seq
  85572114     gbpln35.seq
 193637563     gbpln36.seq
 225480575     gbpln37.seq
 242182266     gbpln38.seq
 249082194     gbpln39.seq
 248651236     gbpln4.seq
 249870443     gbpln40.seq
 249589674     gbpln41.seq
 248843165     gbpln42.seq
 151530927     gbpln43.seq
 248921694     gbpln44.seq
 249563302     gbpln45.seq
 249388979     gbpln46.seq
 248323494     gbpln47.seq
 249707687     gbpln48.seq
 248905881     gbpln49.seq
 249986719     gbpln5.seq
  59100007     gbpln50.seq
 248364192     gbpln51.seq
 248121194     gbpln52.seq
 225116714     gbpln53.seq
 237545098     gbpln54.seq
 246931602     gbpln55.seq
 246972551     gbpln56.seq
 240466039     gbpln57.seq
 193851086     gbpln58.seq
 165751132     gbpln59.seq
 249894061     gbpln6.seq
  40096085     gbpln60.seq
  75057058     gbpln61.seq
 249997674     gbpln62.seq
 249999640     gbpln63.seq
 249998884     gbpln64.seq
 113847957     gbpln65.seq
 249999835     gbpln66.seq
 249997041     gbpln67.seq
 249998549     gbpln68.seq
 249997808     gbpln69.seq
 249920659     gbpln7.seq
 150207668     gbpln70.seq
 249998953     gbpln71.seq
 249995886     gbpln72.seq
 249998317     gbpln73.seq
 249591675     gbpln74.seq
 246507204     gbpln75.seq
 249979608     gbpln76.seq
 249998985     gbpln77.seq
  49793920     gbpln78.seq
 249997944     gbpln79.seq
 249941394     gbpln8.seq
  50221781     gbpln80.seq
 212768934     gbpln81.seq
 249158071     gbpln82.seq
 187081267     gbpln83.seq
 997560866     gbpln84.seq
  56731231     gbpln85.seq
 215691551     gbpln86.seq
 171793674     gbpln87.seq
 197391160     gbpln88.seq
 177950644     gbpln89.seq
 249998337     gbpln9.seq
 196456279     gbpln90.seq
 189037066     gbpln91.seq
 220764647     gbpln92.seq
 227204520     gbpln93.seq
 224027197     gbpln94.seq
 248372246     gbpln95.seq
 189074155     gbpln96.seq
 249996231     gbpln97.seq
 249999015     gbpln98.seq
  63016205     gbpln99.seq
 149042483     gbpri1.seq
 249857188     gbpri10.seq
 144959826     gbpri11.seq
 249963263     gbpri12.seq
 249890704     gbpri13.seq
 249896089     gbpri14.seq
 249946723     gbpri15.seq
 249866001     gbpri16.seq
 249867628     gbpri17.seq
 249757996     gbpri18.seq
 249922745     gbpri19.seq
 249876636     gbpri2.seq
 249959015     gbpri20.seq
 249969459     gbpri21.seq
 249971385     gbpri22.seq
 249996074     gbpri23.seq
  67530266     gbpri24.seq
 163846749     gbpri25.seq
 249995269     gbpri26.seq
 247717409     gbpri27.seq
 249970709     gbpri28.seq
 249937746     gbpri29.seq
 249757213     gbpri3.seq
 249764453     gbpri30.seq
 249993115     gbpri31.seq
 249885937     gbpri32.seq
 249972226     gbpri33.seq
 249965632     gbpri34.seq
 249931322     gbpri35.seq
  23041738     gbpri36.seq
 249995315     gbpri37.seq
 250000024     gbpri38.seq
 249504555     gbpri39.seq
 249867318     gbpri4.seq
 249999522     gbpri40.seq
 249998875     gbpri41.seq
 201976475     gbpri42.seq
 249999204     gbpri43.seq
 249972609     gbpri44.seq
 249985161     gbpri45.seq
 249999337     gbpri46.seq
 133104448     gbpri47.seq
 249939523     gbpri48.seq
 249997673     gbpri49.seq
 249991969     gbpri5.seq
 245549739     gbpri50.seq
 314294187     gbpri51.seq
 258775309     gbpri52.seq
 268666448     gbpri53.seq
 249998258     gbpri54.seq
 183254294     gbpri55.seq
 249940062     gbpri6.seq
 249942075     gbpri7.seq
 249914573     gbpri8.seq
 249778445     gbpri9.seq
    456997     gbrel.txt
 249736541     gbrod1.seq
 249986924     gbrod10.seq
  82229266     gbrod11.seq
 249871281     gbrod12.seq
 249783723     gbrod13.seq
 249992850     gbrod14.seq
 249651610     gbrod15.seq
 249953745     gbrod16.seq
 249885180     gbrod17.seq
 249943440     gbrod18.seq
 249924080     gbrod19.seq
 249725876     gbrod2.seq
 249986824     gbrod20.seq
 249843909     gbrod21.seq
 204885340     gbrod22.seq
 249998231     gbrod23.seq
 249996660     gbrod24.seq
 249915214     gbrod25.seq
 249983854     gbrod26.seq
 249999684     gbrod27.seq
 249996037     gbrod28.seq
 249995986     gbrod29.seq
 249898431     gbrod3.seq
 214451448     gbrod30.seq
 249927365     gbrod4.seq
 249959287     gbrod5.seq
 249786740     gbrod6.seq
 249903605     gbrod7.seq
 249796022     gbrod8.seq
 249978578     gbrod9.seq
 249999144     gbsts1.seq
 249997905     gbsts10.seq
 210966786     gbsts11.seq
 249996524     gbsts12.seq
 249997907     gbsts13.seq
 249997823     gbsts14.seq
 249999432     gbsts15.seq
  26055512     gbsts16.seq
 250000234     gbsts17.seq
 249999396     gbsts18.seq
 250000050     gbsts19.seq
 249999407     gbsts2.seq
 187847098     gbsts20.seq
 249999577     gbsts3.seq
 249998356     gbsts4.seq
  42334415     gbsts5.seq
 249997411     gbsts6.seq
 249997774     gbsts7.seq
 249997192     gbsts8.seq
 249997315     gbsts9.seq
 249999623     gbsyn1.seq
 249998514     gbsyn2.seq
 249980754     gbsyn3.seq
 249951244     gbsyn4.seq
 249965375     gbsyn5.seq
 249972256     gbsyn6.seq
 249999524     gbsyn7.seq
 249998095     gbsyn8.seq
 132757205     gbsyn9.seq
 249998789     gbtsa1.seq
  56875503     gbtsa10.seq
 249999189     gbtsa100.seq
 249999433     gbtsa101.seq
 249996526     gbtsa102.seq
 249998542     gbtsa103.seq
 107894053     gbtsa104.seq
 249999743     gbtsa105.seq
 249999340     gbtsa106.seq
 250000193     gbtsa107.seq
 249997708     gbtsa108.seq
 249999597     gbtsa109.seq
 249996711     gbtsa11.seq
 249998574     gbtsa110.seq
 228581442     gbtsa111.seq
 249998448     gbtsa112.seq
 249998116     gbtsa113.seq
 249999828     gbtsa114.seq
 249999325     gbtsa115.seq
 249994026     gbtsa116.seq
  16579382     gbtsa117.seq
 249998403     gbtsa118.seq
 249999879     gbtsa119.seq
 249996983     gbtsa12.seq
 249998407     gbtsa120.seq
 220818721     gbtsa121.seq
 249995763     gbtsa122.seq
 249996555     gbtsa123.seq
 249995761     gbtsa124.seq
 249998511     gbtsa125.seq
 249998563     gbtsa126.seq
 250000068     gbtsa127.seq
 173022495     gbtsa128.seq
 249999326     gbtsa129.seq
 249993453     gbtsa13.seq
 249997095     gbtsa130.seq
 249998452     gbtsa131.seq
 249997998     gbtsa132.seq
 249999141     gbtsa133.seq
 249999792     gbtsa134.seq
   8254827     gbtsa135.seq
 249999027     gbtsa136.seq
 249999626     gbtsa137.seq
 249999337     gbtsa138.seq
 249997377     gbtsa139.seq
 249998857     gbtsa14.seq
 136260650     gbtsa140.seq
 249998131     gbtsa141.seq
 249999514     gbtsa142.seq
 249997541     gbtsa143.seq
 249997718     gbtsa144.seq
  35878567     gbtsa145.seq
 249999033     gbtsa146.seq
 249996430     gbtsa147.seq
 249999407     gbtsa148.seq
 249999070     gbtsa149.seq
 212107370     gbtsa15.seq
 249998280     gbtsa150.seq
 249998961     gbtsa151.seq
 249997929     gbtsa152.seq
 249999837     gbtsa153.seq
  56029904     gbtsa154.seq
 249997859     gbtsa155.seq
 249998020     gbtsa156.seq
 249999234     gbtsa157.seq
 249997993     gbtsa158.seq
 249998073     gbtsa159.seq
 249998665     gbtsa16.seq
 249999025     gbtsa160.seq
  88482532     gbtsa161.seq
 249999569     gbtsa162.seq
 249998179     gbtsa163.seq
 249997593     gbtsa164.seq
 133634227     gbtsa165.seq
 250000051     gbtsa166.seq
 249997064     gbtsa167.seq
 249996807     gbtsa168.seq
 249995565     gbtsa169.seq
 249997851     gbtsa17.seq
 249999016     gbtsa170.seq
 249999347     gbtsa171.seq
 212464283     gbtsa172.seq
 249999604     gbtsa173.seq
 250000062     gbtsa174.seq
 249998057     gbtsa175.seq
 249999289     gbtsa176.seq
 249999094     gbtsa177.seq
 249995474     gbtsa178.seq
 235671082     gbtsa179.seq
 249996669     gbtsa18.seq
 249996624     gbtsa180.seq
 249997321     gbtsa181.seq
 249995617     gbtsa182.seq
 249994262     gbtsa183.seq
 249997299     gbtsa184.seq
 249994810     gbtsa185.seq
 249996107     gbtsa186.seq
 158803373     gbtsa187.seq
 249998144     gbtsa188.seq
 249999142     gbtsa189.seq
 249996821     gbtsa19.seq
 249995468     gbtsa190.seq
 249995022     gbtsa191.seq
 249996263     gbtsa192.seq
 249997899     gbtsa193.seq
 249998569     gbtsa194.seq
 249996478     gbtsa195.seq
 137489684     gbtsa196.seq
 249996764     gbtsa197.seq
 249998199     gbtsa198.seq
 249998750     gbtsa199.seq
 249998838     gbtsa2.seq
 184645681     gbtsa20.seq
 249997310     gbtsa200.seq
  17504918     gbtsa201.seq
 249994885     gbtsa202.seq
 249999243     gbtsa203.seq
 249989561     gbtsa204.seq
 249997860     gbtsa205.seq
 249998286     gbtsa206.seq
 174688788     gbtsa207.seq
 249999300     gbtsa208.seq
 249997856     gbtsa209.seq
 249998729     gbtsa21.seq
 249996155     gbtsa210.seq
 249996918     gbtsa211.seq
 249994050     gbtsa212.seq
 249997510     gbtsa213.seq
 249998407     gbtsa214.seq
 186774487     gbtsa215.seq
 249996159     gbtsa216.seq
 249996376     gbtsa217.seq
 249998017     gbtsa218.seq
 250000184     gbtsa219.seq
 249995960     gbtsa22.seq
 250000235     gbtsa220.seq
 249998424     gbtsa221.seq
 209204781     gbtsa222.seq
 249999871     gbtsa223.seq
 249998426     gbtsa224.seq
 249995429     gbtsa225.seq
 249999230     gbtsa226.seq
 249998719     gbtsa227.seq
 249999680     gbtsa228.seq
 147516971     gbtsa229.seq
 249996875     gbtsa23.seq
 249998125     gbtsa24.seq
 141504931     gbtsa25.seq
 249998989     gbtsa26.seq
 249996697     gbtsa27.seq
 249999341     gbtsa28.seq
 249995316     gbtsa29.seq
 249998033     gbtsa3.seq
 249995742     gbtsa30.seq
  14687257     gbtsa31.seq
 249999462     gbtsa32.seq
 249997921     gbtsa33.seq
 250000061     gbtsa34.seq
 249999369     gbtsa35.seq
 249998248     gbtsa36.seq
 250000200     gbtsa37.seq
  77824344     gbtsa38.seq
 249998838     gbtsa39.seq
 249998666     gbtsa4.seq
 249998049     gbtsa40.seq
 249998745     gbtsa41.seq
 249998655     gbtsa42.seq
 249999730     gbtsa43.seq
 249998189     gbtsa44.seq
 249999047     gbtsa45.seq
  35519576     gbtsa46.seq
 249996819     gbtsa47.seq
 249998958     gbtsa48.seq
 249998918     gbtsa49.seq
 154448941     gbtsa5.seq
 249999945     gbtsa50.seq
  77219842     gbtsa51.seq
 249997780     gbtsa52.seq
 249998411     gbtsa53.seq
 249998803     gbtsa54.seq
 249998916     gbtsa55.seq
 159863234     gbtsa56.seq
 250000009     gbtsa57.seq
 249998760     gbtsa58.seq
 249999183     gbtsa59.seq
 249997875     gbtsa6.seq
 249998062     gbtsa60.seq
 249997264     gbtsa61.seq
 249999006     gbtsa62.seq
 249999666     gbtsa63.seq
 246318645     gbtsa64.seq
 249999875     gbtsa65.seq
 249998311     gbtsa66.seq
 249997772     gbtsa67.seq
 249998444     gbtsa68.seq
 249999791     gbtsa69.seq
 249998005     gbtsa7.seq
 249998667     gbtsa70.seq
 232817222     gbtsa71.seq
 249998934     gbtsa72.seq
 249999138     gbtsa73.seq
 249999425     gbtsa74.seq
 249999985     gbtsa75.seq
 249994548     gbtsa76.seq
 249998653     gbtsa77.seq
 184594960     gbtsa78.seq
 249999580     gbtsa79.seq
 249999806     gbtsa8.seq
 249999459     gbtsa80.seq
 250000060     gbtsa81.seq
 249998829     gbtsa82.seq
 249995363     gbtsa83.seq
 111806279     gbtsa84.seq
 249997659     gbtsa85.seq
 249998620     gbtsa86.seq
 249998734     gbtsa87.seq
 249992900     gbtsa88.seq
 249999666     gbtsa89.seq
 249999617     gbtsa9.seq
  45985876     gbtsa90.seq
 250000084     gbtsa91.seq
 249998916     gbtsa92.seq
 249999940     gbtsa93.seq
 249999226     gbtsa94.seq
 249998671     gbtsa95.seq
 150715089     gbtsa96.seq
 250000251     gbtsa97.seq
 250000245     gbtsa98.seq
 249999623     gbtsa99.seq
    792470     gbuna1.seq
 249995890     gbvrl1.seq
 249996009     gbvrl10.seq
 249995761     gbvrl11.seq
 249790726     gbvrl12.seq
 249996290     gbvrl13.seq
 249998108     gbvrl14.seq
  11422712     gbvrl15.seq
 249997107     gbvrl16.seq
 249997216     gbvrl17.seq
 249999575     gbvrl18.seq
 250000244     gbvrl19.seq
 249999758     gbvrl2.seq
 229526887     gbvrl20.seq
 249997726     gbvrl21.seq
 249999328     gbvrl22.seq
 249996110     gbvrl23.seq
 249998728     gbvrl24.seq
 144682084     gbvrl25.seq
 250000034     gbvrl26.seq
 249995120     gbvrl27.seq
 249998011     gbvrl28.seq
 249996535     gbvrl29.seq
 249998726     gbvrl3.seq
 249998115     gbvrl30.seq
  75776591     gbvrl31.seq
 249994260     gbvrl32.seq
 249999433     gbvrl33.seq
 249999057     gbvrl34.seq
 249999426     gbvrl35.seq
 249975427     gbvrl36.seq
  36707758     gbvrl37.seq
 249997462     gbvrl38.seq
 249999959     gbvrl39.seq
 249997404     gbvrl4.seq
 250000235     gbvrl40.seq
 249997746     gbvrl41.seq
 249998955     gbvrl42.seq
 249999943     gbvrl43.seq
 250000125     gbvrl44.seq
 249998313     gbvrl45.seq
 249998397     gbvrl46.seq
      6950     gbvrl47.seq
 249997481     gbvrl5.seq
  87528992     gbvrl6.seq
 249999573     gbvrl7.seq
 249997153     gbvrl8.seq
 249999928     gbvrl9.seq
 249996505     gbvrt1.seq
 249876904     gbvrt10.seq
 249997940     gbvrt11.seq
 137145900     gbvrt12.seq
 249949016     gbvrt13.seq
 249984377     gbvrt14.seq
 249994295     gbvrt15.seq
 250000117     gbvrt16.seq
 249998698     gbvrt17.seq
 249999961     gbvrt18.seq
  62750552     gbvrt19.seq
 249791139     gbvrt2.seq
 249896427     gbvrt20.seq
 249996978     gbvrt21.seq
 249998806     gbvrt22.seq
 249997538     gbvrt23.seq
 250000226     gbvrt24.seq
 109631482     gbvrt25.seq
 249998337     gbvrt26.seq
 249999748     gbvrt27.seq
 249996857     gbvrt28.seq
 199449107     gbvrt29.seq
 250000103     gbvrt3.seq
 249997976     gbvrt30.seq
 249997013     gbvrt31.seq
  30188857     gbvrt32.seq
 249996907     gbvrt33.seq
 192952550     gbvrt34.seq
 249987742     gbvrt35.seq
 249997337     gbvrt36.seq
 249999459     gbvrt37.seq
 117341866     gbvrt38.seq
 249998278     gbvrt39.seq
 249755154     gbvrt4.seq
 249997784     gbvrt40.seq
 109289257     gbvrt41.seq
 249999741     gbvrt42.seq
 249997219     gbvrt43.seq
 248875460     gbvrt44.seq
 238513975     gbvrt45.seq
 227073655     gbvrt46.seq
 232655289     gbvrt47.seq
 249849991     gbvrt48.seq
 249370876     gbvrt49.seq
 231151330     gbvrt5.seq
 249965747     gbvrt50.seq
 249999118     gbvrt51.seq
  45407125     gbvrt52.seq
 249999335     gbvrt53.seq
 180507423     gbvrt54.seq
 246330940     gbvrt55.seq
 227143105     gbvrt56.seq
 249608691     gbvrt57.seq
 234447524     gbvrt58.seq
 249647333     gbvrt59.seq
 249996733     gbvrt6.seq
 249740040     gbvrt60.seq
 249797253     gbvrt61.seq
 249954226     gbvrt62.seq
 248825435     gbvrt63.seq
 138282846     gbvrt64.seq
 249991757     gbvrt7.seq
 249838208     gbvrt8.seq
 249883461     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63520      86558776
BCT10        14157      87882687
BCT100       59         111542017
BCT101       44         107663978
BCT102       42         105130602
BCT103       62         106991504
BCT104       46         108660243
BCT105       32         92188895
BCT106       29         106059433
BCT107       23         100309671
BCT108       22         102815068
BCT109       22         103205495
BCT11        2360       103149777
BCT110       22         103088812
BCT111       22         103089220
BCT112       22         101716543
BCT113       21         101640086
BCT114       23         106816508
BCT115       46         109374721
BCT116       38         105562991
BCT117       6          15890032
BCT118       50         111764861
BCT119       60         109369965
BCT12        70         115123597
BCT120       59         112726237
BCT121       67         111056909
BCT122       44         111343032
BCT123       50         114715155
BCT124       57         110894677
BCT125       21         103150112
BCT126       30         107463152
BCT127       27         60879521
BCT128       44         114207420
BCT129       46         113853781
BCT13        111        116076156
BCT130       61         113013046
BCT131       39         107930220
BCT132       54         114611674
BCT133       41         113615676
BCT134       27         110911703
BCT135       66         112753283
BCT136       41         109240313
BCT137       34         109643277
BCT138       35         120475641
BCT139       50         113231526
BCT14        70         113372788
BCT140       55         109421677
BCT141       78         113214393
BCT142       41         111552967
BCT143       52         114895149
BCT144       69         109578631
BCT145       69         114363423
BCT146       56         114971435
BCT147       54         104965439
BCT148       17         35013598
BCT149       62         99560423
BCT15        53         115328609
BCT150       43         103972342
BCT151       31         107564841
BCT152       43         111146788
BCT153       69         105178122
BCT154       40         106930486
BCT155       63         103214676
BCT156       59         109908714
BCT157       3          5977905
BCT158       48         109450542
BCT159       52         109603502
BCT16        74         122556134
BCT160       49         106107943
BCT161       42         106127600
BCT162       50         109569448
BCT163       41         111935679
BCT164       33         108982329
BCT165       5          20537449
BCT166       35         106938488
BCT167       33         108751417
BCT168       39         109930943
BCT169       36         107844857
BCT17        41         116033349
BCT170       46         108994757
BCT171       46         109657611
BCT172       45         108164567
BCT173       36         110937597
BCT174       21         55380015
BCT175       93         99698834
BCT176       28         105910339
BCT177       26         106807776
BCT178       26         106791919
BCT179       30         105001148
BCT18        68         116609452
BCT180       53         113159243
BCT181       41         109650928
BCT182       58         106583459
BCT183       29         106651086
BCT184       38         106119442
BCT185       34         109870688
BCT186       49         107842851
BCT187       58         108513804
BCT188       49         100859762
BCT189       99         108381810
BCT19        67         113662798
BCT190       49         107667989
BCT191       47         108689534
BCT192       59         110356184
BCT193       32         104780146
BCT194       46         107907078
BCT195       71         108370903
BCT196       55         106988264
BCT197       59         110706690
BCT198       29         107497066
BCT199       35         107590450
BCT2         31059      98726308
BCT20        67         115443289
BCT200       79         110133721
BCT201       48         110157763
BCT202       68         108609785
BCT203       43         109695697
BCT204       42         108803289
BCT205       50         106367913
BCT206       63         105722279
BCT207       87         102463356
BCT208       47         106320436
BCT209       4          21185740
BCT21        75         137862852
BCT210       45         105385654
BCT211       97         106730684
BCT212       30         105981388
BCT213       26         104792233
BCT214       49         104781156
BCT215       46         105813856
BCT216       37         106025707
BCT217       64         105696283
BCT218       47         111773029
BCT219       23         68169196
BCT22        16005      32106501
BCT220       63         110629108
BCT221       65         109299387
BCT222       59         107079051
BCT223       58         104487341
BCT224       84         108329657
BCT225       94         105182973
BCT226       27         103173258
BCT227       36         107897738
BCT228       44         109598297
BCT229       2          3079875
BCT23        53816      84836330
BCT230       64         108255307
BCT231       63         108517292
BCT232       71         108843337
BCT233       57         108367292
BCT234       51         108267883
BCT235       60         106001723
BCT236       70         112862854
BCT237       73         113438827
BCT238       43         108083127
BCT239       47         106996662
BCT24        86         109498452
BCT240       43         88727474
BCT241       62         106300128
BCT242       37         109309588
BCT243       70         108529282
BCT244       45         105877238
BCT245       65         108060473
BCT246       63         106611694
BCT247       59         107374544
BCT248       47         105933059
BCT249       35         110329773
BCT25        137        95492678
BCT250       61         110147469
BCT251       53         111278331
BCT252       49         106275815
BCT253       8          15903911
BCT254       57         107641125
BCT255       41         104696290
BCT256       50         112747858
BCT257       41         105639330
BCT258       42         113769294
BCT259       39         115388381
BCT26        57         111091737
BCT260       72         108094847
BCT261       48         110118539
BCT262       66         108699303
BCT263       42         109115487
BCT264       86         111549431
BCT265       82         108169961
BCT266       86         105257997
BCT267       73         105205687
BCT268       67         124854661
BCT269       53         108768065
BCT27        52         109549606
BCT270       61         105241213
BCT271       29         103286797
BCT272       84         110686780
BCT273       18         5937216
BCT274       203        89845400
BCT275       325        25743984
BCT276       1589       2511957
BCT277       3172       5268484
BCT278       6338       7796395
BCT279       12613      14997742
BCT28        46         112848420
BCT280       25523      27672627
BCT281       50568      54082661
BCT282       75853      77878358
BCT283       71330      76777807
BCT284       10364      92224381
BCT285       5305       94797455
BCT286       3323       102716745
BCT287       125        92772533
BCT288       39         103801273
BCT289       214        102743901
BCT29        57         112994744
BCT290       6101       97980407
BCT291       22126      93813041
BCT292       21150      21746960
BCT293       71365      73593068
BCT294       3689       102660265
BCT295       3947       100740033
BCT296       6493       97476157
BCT297       3878       96543194
BCT298       10721      103934323
BCT299       74845      78899410
BCT3         45         110044504
BCT30        66         108817610
BCT300       73412      78161937
BCT301       4850       6035558
BCT302       75556      78482246
BCT303       72015      77189463
BCT304       72713      73987467
BCT305       12828      14826537
BCT306       70822      75410718
BCT307       72194      73731871
BCT308       20393      19443183
BCT309       66585      81298652
BCT31        36         96325907
BCT310       48956      60154347
BCT311       62449      82724871
BCT312       27895      40140225
BCT313       21914      105523954
BCT314       3605       155996851
BCT315       1275       171896261
BCT316       5629       104079818
BCT317       1853       106646156
BCT318       2649       100746266
BCT319       1770       108102265
BCT32        40         106881287
BCT320       2594       117450942
BCT321       984        117722298
BCT322       995        121038638
BCT323       626        134909518
BCT324       21         115595834
BCT325       25         118987507
BCT326       21         110764266
BCT327       21         114706495
BCT328       1470       121890189
BCT329       513        128591115
BCT33        59         107430269
BCT330       29901      86386453
BCT34        74         111675186
BCT35        55         110045255
BCT36        63         106845594
BCT37        55         109391464
BCT38        53         108650404
BCT39        46         110495229
BCT4         59         112453622
BCT40        95         109522868
BCT41        58         106383657
BCT42        67         109486091
BCT43        125        110095720
BCT44        37         71643089
BCT45        200        111474100
BCT46        54         111189650
BCT47        35         108859141
BCT48        59         107860764
BCT49        56         105257914
BCT5         24104      103626869
BCT50        45         109560296
BCT51        74         109517239
BCT52        63         108817997
BCT53        45         105399191
BCT54        59         110379618
BCT55        70         108888422
BCT56        77         109259381
BCT57        22         22714378
BCT58        67         109336234
BCT59        60         104664634
BCT6         13433      19705106
BCT60        53         102829098
BCT61        56         108908758
BCT62        58         105643854
BCT63        54         109754097
BCT64        72         109941269
BCT65        61         106056484
BCT66        70         111010690
BCT67        36         115917629
BCT68        79         110703954
BCT69        50         110061589
BCT7         39658      80452210
BCT70        61         113995855
BCT71        25         28242590
BCT72        43         109853786
BCT73        50         116699480
BCT74        66         111693041
BCT75        50         111467075
BCT76        53         109197672
BCT77        97         112945696
BCT78        73         112059377
BCT79        80         105609227
BCT8         1992       59265649
BCT80        61         114956262
BCT81        64         115718442
BCT82        53         114897025
BCT83        62         113769294
BCT84        49         112978106
BCT85        21         43870898
BCT86        48         118002347
BCT87        63         115290616
BCT88        248        115434499
BCT89        70         109982609
BCT9         7656       93380719
BCT90        297        115164977
BCT91        63         110836541
BCT92        68         108767418
BCT93        45         109031298
BCT94        61         108655373
BCT95        61         109296173
BCT96        4          12180716
BCT97        57         116195274
BCT98        61         106396448
BCT99        39         113384349
ENV1         92455      71794008
ENV10        86261      70392148
ENV11        93078      72832779
ENV12        82352      86610547
ENV13        21805      18674470
ENV14        84711      80822818
ENV15        118343     43037482
ENV16        89146      77071612
ENV17        96417      67757746
ENV18        96024      63237758
ENV19        109630     66853238
ENV2         95829      68805343
ENV20        121971     64265151
ENV21        59519      80371257
ENV22        1987       2668520
ENV23        64036      80463296
ENV24        90211      75812600
ENV25        125172     39265203
ENV26        122785     28945679
ENV27        90679      20907713
ENV28        123097     49753756
ENV29        97826      67184945
ENV3         93818      67853380
ENV30        115025     56511972
ENV31        135879     52802977
ENV32        109145     60809369
ENV33        94513      64673398
ENV34        25360      24123977
ENV35        62536      84995133
ENV36        88722      73276073
ENV37        102896     44274222
ENV38        96867      56282212
ENV39        70673      54653611
ENV4         76100      80456991
ENV40        111228     47246471
ENV41        100828     61076007
ENV42        107048     61675140
ENV43        63689      90609210
ENV44        72539      78869615
ENV45        62024      84275175
ENV46        13553      18434242
ENV47        70511      78327058
ENV48        107795     49575769
ENV49        112481     56191673
ENV5         38872      97287288
ENV50        104684     61473177
ENV51        80596      42559465
ENV52        100601     44023259
ENV53        42885      53351901
ENV54        41970      54596651
ENV55        57474      57083783
ENV56        96501      61610151
ENV57        35153      19529681
ENV58        92149      66866589
ENV59        80785      71288245
ENV6         69921      92340693
ENV60        78506      67769679
ENV61        85908      69828559
ENV62        95718      60414115
ENV63        83352      53462275
ENV64        109664     46034771
ENV65        90166      60778487
ENV66        101124     51563263
ENV67        93854      57092838
ENV68        80596      73549636
ENV69        31956      24893849
ENV7         91604      82014663
ENV70        74047      82695949
ENV71        82785      51571083
ENV72        86262      59358235
ENV73        56642      76510466
ENV74        105208     32162948
ENV75        66957      16913321
ENV76        78566      74345254
ENV77        91981      57751811
ENV78        101478     59816935
ENV79        108107     39991056
ENV8         77445      44865593
ENV80        108258     37631273
ENV81        34804      24674095
ENV82        98677      54409106
ENV83        116351     29438819
ENV84        107405     41857443
ENV85        104001     49461843
ENV86        90211      35097331
ENV87        101611     50066701
ENV88        114301     49908568
ENV89        110826     53768992
ENV9         131421     31025284
ENV90        94073      54488032
ENV91        87110      61732141
ENV92        106589     51160592
ENV93        83027      43395882
ENV94        95465      62459317
ENV95        48366      32844793
EST1         159499     61801436
EST10        168032     72459725
EST100       233458     141786807
EST101       238402     125275700
EST102       190883     104629538
EST103       184967     102305952
EST104       101130     70450537
EST105       160793     120298207
EST106       174180     106404420
EST107       134712     84646183
EST108       63886      23757596
EST109       63358      22276965
EST11        169630     73878088
EST110       63849      23103116
EST111       63872      26895204
EST112       64362      22974555
EST113       64589      24558070
EST114       63579      27052475
EST115       63773      26188976
EST116       64047      27301532
EST117       63896      25162553
EST118       61257      33658863
EST119       122869     62549295
EST12        167848     70448022
EST120       160383     85613242
EST121       187597     92586894
EST122       148679     95608532
EST123       158546     93394200
EST124       131747     85717931
EST125       188279     90228463
EST126       157035     83531159
EST127       157235     84342111
EST128       156706     84842767
EST129       152205     85257789
EST13        68741      33334986
EST130       173770     93241397
EST131       183485     117031489
EST132       202877     102651329
EST133       159676     87284840
EST134       163010     83011615
EST135       142484     83649091
EST136       144805     89822283
EST137       98307      52093260
EST138       172655     97586125
EST139       244035     112746145
EST14        217463     108979670
EST140       155860     84003639
EST141       167358     92277414
EST142       151128     88613211
EST143       133457     81255588
EST144       154969     97374978
EST145       156616     85955365
EST146       124212     63279009
EST147       121182     65033365
EST148       127633     57947138
EST149       127054     51236282
EST15        169669     106000373
EST150       128438     51177819
EST151       115397     43033799
EST152       164021     82736970
EST153       176887     74089486
EST154       162720     110595936
EST155       199582     122326131
EST156       213395     121238984
EST157       175158     97094111
EST158       154462     108164625
EST159       142639     95242130
EST16        181577     113586611
EST160       155124     96486345
EST161       157944     82774533
EST162       139662     78578799
EST163       168589     93711918
EST164       69750      43367110
EST165       150728     92270715
EST166       192369     110548255
EST167       146103     84103679
EST168       142828     72419993
EST169       150311     87670169
EST17        196123     115757741
EST170       191237     104885649
EST171       156739     96081314
EST172       168091     82969251
EST173       126944     86620544
EST174       171141     100366318
EST175       173377     100354314
EST176       121225     67838556
EST177       158095     91074260
EST178       30755      17836104
EST179       170877     103282132
EST18        194435     120873103
EST180       181396     119581108
EST181       143703     116741571
EST182       194433     99359772
EST183       153314     103348882
EST184       154995     101639355
EST185       141193     81730529
EST186       176777     71789435
EST187       150847     84458259
EST188       157411     99904634
EST189       156891     96488025
EST19        157763     113163104
EST190       140875     84011623
EST191       159186     96150273
EST192       146889     94035515
EST193       131478     91560094
EST194       142716     87526263
EST195       137339     89555673
EST196       132648     93993975
EST197       163933     87296175
EST198       174728     96024126
EST199       174085     96902254
EST2         162337     61673044
EST20        189886     100194818
EST200       171959     96534100
EST201       169419     94934551
EST202       172386     95810979
EST203       174112     95379672
EST204       174590     96203209
EST205       13711      7285446
EST206       189437     105533524
EST207       206000     105138458
EST208       172509     102444312
EST209       180685     102064162
EST21        218525     107505513
EST210       202176     123340046
EST211       195647     112833871
EST212       195600     124007282
EST213       138751     93563363
EST214       215441     137235832
EST215       234897     121742005
EST216       161694     105718159
EST217       182463     100789792
EST218       202165     98900693
EST219       132734     95262150
EST22        190242     62060883
EST220       147701     87571985
EST221       210706     116134052
EST222       161784     105322482
EST223       103247     107501565
EST224       153184     103916502
EST225       159108     95528005
EST226       142949     103197116
EST227       224842     104407286
EST228       137180     100991147
EST229       121937     86634543
EST23        138909     39563114
EST230       137906     97917969
EST231       122790     87936705
EST232       143778     89691767
EST233       129920     88652396
EST234       140428     105164502
EST235       132026     93230557
EST236       124179     84034758
EST237       142789     88115650
EST238       156797     120909058
EST239       127119     119251984
EST24        102635     27788547
EST240       139415     103464120
EST241       174785     105989245
EST242       167023     103550229
EST243       154485     99304388
EST244       86550      49599694
EST245       166837     125572252
EST246       143646     106127797
EST247       155630     100211749
EST248       212064     97644175
EST249       187824     112164753
EST25        122482     51006068
EST250       153347     86203707
EST251       217805     27184348
EST252       220437     89810873
EST253       163495     120483957
EST254       175235     102688735
EST255       162366     107941550
EST256       113928     70987904
EST257       155435     113579630
EST258       184992     112288857
EST259       188989     97734050
EST26        214445     97482243
EST260       176343     110279970
EST261       162391     111858987
EST262       230865     108319507
EST263       276081     121280070
EST264       193033     115012633
EST265       187886     36317633
EST266       258553     125920618
EST267       65403      39699758
EST268       153173     97666231
EST269       166015     102209256
EST27        219438     110315416
EST270       166184     114257835
EST271       198060     102942636
EST272       156600     106636833
EST273       196060     115037623
EST274       196830     48813903
EST275       206566     42247305
EST276       181581     103279634
EST277       171163     115321662
EST278       186323     116514174
EST279       126056     72453020
EST28        190578     88624703
EST280       175358     114199130
EST281       170878     74586452
EST282       133318     83110798
EST283       130655     85401832
EST284       155191     102525319
EST285       260789     27544652
EST286       264780     24330651
EST287       148899     104684761
EST288       169577     109695034
EST289       160108     102630779
EST29        158257     69008587
EST290       155908     92342299
EST291       152982     14108430
EST292       209893     74150341
EST293       164986     107690610
EST294       177020     106881453
EST295       154021     98606015
EST296       200098     108098653
EST297       154950     111200195
EST298       166350     101039358
EST299       187993     115216791
EST3         151290     53610446
EST30        171781     69703622
EST300       178941     102999632
EST301       185795     99200842
EST302       184133     64504497
EST303       127133     45091009
EST304       183962     71376275
EST305       184618     69634960
EST306       185635     96246051
EST307       182543     131140001
EST308       145731     84812234
EST309       152932     92418032
EST31        149988     63650930
EST310       131463     100591525
EST311       161054     97319093
EST312       171221     97955005
EST313       150871     96999028
EST314       168221     95561183
EST315       160481     107360907
EST316       100839     70844433
EST317       164574     107967038
EST318       157371     108929746
EST319       178602     151136465
EST32        168732     76284085
EST320       170888     112059985
EST321       141704     75845451
EST322       144016     98183743
EST323       147115     101049725
EST324       134855     90901952
EST325       149245     99477997
EST326       149866     101255842
EST327       177681     110786187
EST328       149026     82701748
EST329       149122     85532568
EST33        175393     67753085
EST330       65935      40590515
EST331       150547     108398890
EST332       161697     97050541
EST333       143763     91475313
EST334       141807     89347418
EST335       203929     111103334
EST336       138686     75663611
EST337       91344      54432507
EST338       130362     85755237
EST339       137145     87066981
EST34        119103     41182974
EST340       125778     80477565
EST341       158998     85265987
EST342       217319     85075267
EST343       171331     87524505
EST344       106547     63643163
EST345       165373     103535447
EST346       146959     89845833
EST347       133010     88559731
EST348       136155     88631617
EST349       185952     121850779
EST35        96368      29586937
EST350       161388     97655031
EST351       153768     78052931
EST352       188001     127497787
EST353       118340     82179294
EST354       73372      44179330
EST355       136790     75270537
EST356       130579     78257312
EST357       147609     58509730
EST358       158745     32267715
EST359       43066      8820514
EST36        96775      30245787
EST360       155610     42678294
EST361       190791     120873382
EST362       238304     113679829
EST363       247499     113104120
EST364       187909     102808821
EST365       141237     91606015
EST366       136580     86831327
EST367       152933     90110510
EST368       190302     117644869
EST369       227718     63731991
EST37        95688      29021587
EST370       177687     111524076
EST371       32522      14295559
EST372       214207     117614240
EST373       204819     121606862
EST374       203755     116464098
EST375       143638     69180492
EST376       198360     122118273
EST377       159042     100693785
EST378       166382     127614903
EST379       183506     145467183
EST38        97555      29505261
EST380       156932     92777380
EST381       164162     105206292
EST382       185597     106410614
EST383       95801      56584167
EST384       205017     111663433
EST385       195517     108717459
EST386       192545     118848383
EST387       191040     124061750
EST388       200937     132592354
EST389       219032     133302451
EST39        97679      30983223
EST390       212658     135038338
EST391       200426     162483845
EST392       214534     143894397
EST393       181037     110617913
EST394       65829      39346754
EST395       192042     104241911
EST396       169652     14895903
EST397       159580     13504419
EST398       157425     26497549
EST399       158848     32002084
EST4         171413     67335703
EST40        28220      7231870
EST400       158765     32196478
EST401       150312     77329595
EST402       174851     102139728
EST403       170194     116367695
EST404       167735     96953733
EST405       155412     108371783
EST406       140689     98165327
EST407       116266     81800860
EST408       154651     97586691
EST409       166766     121254674
EST41        101354     52983819
EST410       163344     98906925
EST411       169183     62456326
EST412       168478     29398171
EST413       160430     107213389
EST414       151595     101285805
EST415       180346     117828966
EST416       139771     76263802
EST417       194659     109970607
EST418       156980     116794723
EST419       133819     91428811
EST42        119679     50944607
EST420       139350     92079240
EST421       540        354487
EST422       147675     92116887
EST423       176528     96828779
EST424       179713     98251508
EST425       146889     90950521
EST426       180441     109802003
EST427       163547     96571025
EST428       109608     75555805
EST429       85713      65410891
EST43        166340     91994672
EST430       100073     67533239
EST431       134683     79170712
EST432       136986     80775337
EST433       133941     82114256
EST434       135813     90089574
EST435       142425     86084824
EST436       51753      27121015
EST437       160087     86803201
EST438       195590     116791571
EST439       126181     81352495
EST44        170626     72307937
EST440       192621     106661598
EST441       178751     84064225
EST442       162430     92674670
EST443       155215     85051345
EST444       208507     121700809
EST445       192031     114698846
EST446       167727     101823458
EST447       147134     109592830
EST448       136322     84955035
EST449       42209      29195338
EST45        167818     85153092
EST450       162939     71839681
EST451       188851     92430904
EST452       209756     83087871
EST453       205279     87398047
EST454       188456     93207524
EST455       181211     107180122
EST456       187734     112602875
EST457       188450     113859369
EST458       204921     138348916
EST459       190135     89873487
EST46        168457     86859201
EST460       171972     78430086
EST461       189907     133001274
EST462       215040     123157704
EST463       172683     109664677
EST464       183167     109459021
EST465       198724     116693978
EST466       137182     97035345
EST467       166064     105411630
EST468       168385     86428978
EST469       161296     89114652
EST47        163575     87986123
EST470       156668     84249925
EST471       157272     82709744
EST472       145297     80442972
EST473       167659     107534876
EST474       184315     109347805
EST475       176707     116448527
EST476       185145     121336454
EST477       181024     113753476
EST478       179490     108300085
EST479       179537     72863397
EST48        162694     83205394
EST480       170092     59729468
EST481       115693     46025929
EST49        160314     91339555
EST5         169497     66371617
EST50        162292     88449659
EST51        157695     99247326
EST52        159761     69998443
EST53        147278     82485710
EST54        72117      47664559
EST55        167521     70086597
EST56        165247     74991905
EST57        164952     91076377
EST58        159201     97090933
EST59        156790     102099694
EST6         172138     67169120
EST60        165075     99239018
EST61        160292     108342628
EST62        171997     80645167
EST63        173910     93375008
EST64        155459     84254220
EST65        148883     81669661
EST66        159107     98579128
EST67        131565     75042645
EST68        150067     91962686
EST69        195872     108737839
EST7         170561     73071074
EST70        181354     95121407
EST71        222270     121811794
EST72        187090     111908612
EST73        203923     120921264
EST74        164642     90825428
EST75        132422     60412056
EST76        137984     67964272
EST77        157783     97834828
EST78        157473     97743291
EST79        142838     78804766
EST8         180024     73160756
EST80        46267      21517091
EST81        164059     100489477
EST82        212720     115147602
EST83        224803     124305792
EST84        200951     94564363
EST85        212095     93363873
EST86        161368     93012104
EST87        144165     87406413
EST88        164648     81019513
EST89        158778     79938427
EST9         168973     69428034
EST90        153573     102338068
EST91        151706     88939489
EST92        131079     84841910
EST93        156093     112957041
EST94        141253     103425213
EST95        142079     101604771
EST96        141253     97651112
EST97        147722     81887569
EST98        178942     111005620
EST99        223818     135594745
GSS1         200938     87993526
GSS10        132676     60724263
GSS100       145434     114442767
GSS101       141763     116184076
GSS102       143261     116672134
GSS103       166570     128263370
GSS104       149025     82048493
GSS105       191436     120801377
GSS106       168729     112791945
GSS107       198746     116490362
GSS108       205238     134899360
GSS109       209604     138169286
GSS11        137127     73876681
GSS110       207354     140810063
GSS111       206097     142300603
GSS112       205163     143530240
GSS113       204924     143949340
GSS114       202025     146602236
GSS115       182171     139434019
GSS116       16997      10161585
GSS117       133164     84216220
GSS118       170214     80242630
GSS119       183879     79367758
GSS12        148408     75889201
GSS120       170042     148161187
GSS121       177734     120660279
GSS122       179418     145659022
GSS123       187619     120675200
GSS124       186871     139162689
GSS125       192429     127211256
GSS126       192027     93289441
GSS127       167547     156540154
GSS128       163635     113996346
GSS129       60852      36801445
GSS13        145642     69077999
GSS130       170924     155391265
GSS131       172236     154355390
GSS132       172285     155047185
GSS133       173669     154061261
GSS134       171880     154918497
GSS135       180286     138244448
GSS136       177778     146362755
GSS137       166232     119407177
GSS138       192388     95146131
GSS139       258614     44192301
GSS14        171161     85467912
GSS140       258272     39801873
GSS141       93069      14316936
GSS142       254550     58910013
GSS143       266302     53698538
GSS144       190432     88898179
GSS145       196772     64266126
GSS146       185070     146364670
GSS147       181726     149596630
GSS148       167299     154580142
GSS149       170987     157779426
GSS15        161589     98196837
GSS150       232936     77219110
GSS151       231029     76724319
GSS152       131130     60287057
GSS153       213638     54260488
GSS154       157555     97574477
GSS155       182950     113538142
GSS156       135786     87096217
GSS157       165174     130023777
GSS158       183703     161464359
GSS159       193931     159491634
GSS16        173175     87176842
GSS160       190375     125588647
GSS161       217120     138275110
GSS162       221520     132814686
GSS163       160693     98930579
GSS164       150123     86028356
GSS165       37397      28653694
GSS166       211763     157998111
GSS167       192754     102631747
GSS168       171989     67671219
GSS169       206242     159862317
GSS17        184018     114262091
GSS170       207812     162102007
GSS171       207212     163842020
GSS172       205397     135465889
GSS173       157773     112225896
GSS174       87032      63853715
GSS175       83577      62785783
GSS176       103113     48365477
GSS177       68934      58595891
GSS178       8571       7692351
GSS179       68591      57924394
GSS18        191866     113865053
GSS180       69224      56650935
GSS181       69460      56187403
GSS182       71202      55998401
GSS183       68561      51865315
GSS184       75915      58209304
GSS185       86540      74277212
GSS186       81317      44384966
GSS187       92266      45108910
GSS188       65131      48539953
GSS189       77811      61666620
GSS19        109259     49019582
GSS190       70214      59194054
GSS191       68204      63291319
GSS192       62731      52925680
GSS193       94994      42346893
GSS194       19509      4537258
GSS195       112930     70870954
GSS196       830        565879
GSS197       23226      28867035
GSS198       109084     70678875
GSS199       84403      34582519
GSS2         182739     92537427
GSS20        181328     101431612
GSS200       35904      22282147
GSS201       103304     62490220
GSS202       102329     63761256
GSS203       104240     67638632
GSS204       82127      41294650
GSS205       83102      54651503
GSS206       95565      61249467
GSS207       107362     78589335
GSS208       106444     76728833
GSS209       106101     79982459
GSS21        166554     114432569
GSS210       104001     80014803
GSS211       75801      50678132
GSS212       105097     63619915
GSS213       109868     66415305
GSS214       105969     59182678
GSS215       68062      37223883
GSS216       69097      38525198
GSS217       38174      18339130
GSS218       85817      46213833
GSS219       97756      56282806
GSS22        169386     97553408
GSS220       94838      49467300
GSS221       96276      55952494
GSS222       41313      23149851
GSS223       114055     43442995
GSS224       116422     39251295
GSS225       108546     52732132
GSS226       108646     67068758
GSS227       101582     78242838
GSS228       57082      34119143
GSS229       96897      36918766
GSS23        186604     125906880
GSS230       96399      37676586
GSS231       97739      35452830
GSS232       95145      39751140
GSS233       33820      15967145
GSS234       103714     66128197
GSS235       94551      61191001
GSS236       95126      60360147
GSS237       94775      60866327
GSS238       75722      69995993
GSS239       80576      68523879
GSS24        192677     129465133
GSS240       37155      35107935
GSS241       82369      27761898
GSS242       82844      26872946
GSS243       83400      25690460
GSS244       19119      5586005
GSS245       16547      7508221
GSS246       94100      60580478
GSS247       97403      65501702
GSS248       96166      65715907
GSS249       106376     69841317
GSS25        177883     105804709
GSS250       91708      45507881
GSS251       91214      49568095
GSS252       75915      41427331
GSS253       90839      57016024
GSS254       89674      61866093
GSS255       88534      63668650
GSS256       89290      62493340
GSS257       9699       6996370
GSS258       87995      63795538
GSS259       90590      62742076
GSS26        184544     106682913
GSS260       94937      59925372
GSS261       74696      63777273
GSS262       84391      78676825
GSS263       82881      80793634
GSS264       69452      51663438
GSS265       114900     62956729
GSS266       108980     55519998
GSS267       107208     51972208
GSS268       99627      44671760
GSS269       109459     48915853
GSS27        170222     149612515
GSS270       99009      46102645
GSS271       81073      62985537
GSS272       72764      72724310
GSS273       64504      55742518
GSS274       60740      46995025
GSS275       36837      27810275
GSS276       60845      46734002
GSS277       61946      49327951
GSS278       84047      86740412
GSS279       82536      88549611
GSS28        188949     147823412
GSS280       77949      74213298
GSS281       84442      64951795
GSS282       60134      48386085
GSS283       60082      48548768
GSS284       79755      51505702
GSS285       81394      61015678
GSS286       46325      27866603
GSS287       94787      57200301
GSS288       93517      59081345
GSS289       93900      58510429
GSS29        150153     104245068
GSS290       94714      57307691
GSS291       83843      51265303
GSS292       103666     69242174
GSS293       104299     74321241
GSS294       109373     68331863
GSS295       106994     71135784
GSS296       38781      26571815
GSS297       111314     66044649
GSS298       97520      60954006
GSS299       106950     56669730
GSS3         175733     88087665
GSS30        191200     131476397
GSS300       93049      72593306
GSS301       82894      88249746
GSS302       78885      94156617
GSS303       52511      30616464
GSS31        21025      14035894
GSS32        195389     126949740
GSS33        217735     116814786
GSS34        219655     114197394
GSS35        220809     112620179
GSS36        214074     122634098
GSS37        196390     154722789
GSS38        192935     145197749
GSS39        193486     73141364
GSS4         167432     85323813
GSS40        186632     96354423
GSS41        187084     123984045
GSS42        173605     161517271
GSS43        12187      7839229
GSS44        183230     99934228
GSS45        172376     121119534
GSS46        183257     123433464
GSS47        188863     120897764
GSS48        75978      66231967
GSS49        170045     100948017
GSS5         51060      30411628
GSS50        166240     102102664
GSS51        166431     101323646
GSS52        181635     120322749
GSS53        183662     115768060
GSS54        181050     122902198
GSS55        187664     112722735
GSS56        187348     135090537
GSS57        177431     103601581
GSS58        194389     118882782
GSS59        180325     129959162
GSS6         161937     84623154
GSS60        15086      13673357
GSS61        171906     138347929
GSS62        162249     111940574
GSS63        162290     111957380
GSS64        158271     107224004
GSS65        156086     128713494
GSS66        170391     142685291
GSS67        176079     114825244
GSS68        202855     127207738
GSS69        193353     110430909
GSS7         165841     79603400
GSS70        244858     126155477
GSS71        161723     107779544
GSS72        157963     117708898
GSS73        162710     124585979
GSS74        162678     124640861
GSS75        173943     108791847
GSS76        191275     140086024
GSS77        18428      11801712
GSS78        196630     124922865
GSS79        169313     110439814
GSS8         165838     89012145
GSS80        199153     130496475
GSS81        210322     89537954
GSS82        190712     96066102
GSS83        133039     93055247
GSS84        145944     117206848
GSS85        139790     117027123
GSS86        142875     113979528
GSS87        144231     119970332
GSS88        141762     115675632
GSS89        109629     91427911
GSS9         138237     67304162
GSS90        149553     122345328
GSS91        147790     117796701
GSS92        144115     113153024
GSS93        142979     115532063
GSS94        144337     119766805
GSS95        148217     121722672
GSS96        147793     117900972
GSS97        146200     121152590
GSS98        146262     121035840
GSS99        146701     120156218
HTC1         25047      27029224
HTC10        70836      69653618
HTC11        72400      69670853
HTC12        28242      33347869
HTC13        67517      60542416
HTC14        69003      69660470
HTC15        51368      38814100
HTC2         16071      36202003
HTC3         16014      36607191
HTC4         16234      35514380
HTC5         15960      40329026
HTC6         16042      37386456
HTC7         53542      31186695
HTC8         31530      19965253
HTC9         60703      77599470
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1590       179393068
HTG121       1587       179603616
HTG122       1580       179595063
HTG123       1598       179568613
HTG124       1603       179517182
HTG125       1582       180855862
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1476       185679630
HTG129       1134       190249540
HTG13        875        191786413
HTG130       1103       184582645
HTG131       4          407375
HTG132       1557       186483382
HTG133       1855       177768696
HTG134       986        186174720
HTG135       1072       192049994
HTG136       1089       193222951
HTG137       602        109520336
HTG138       1031       189469892
HTG139       1055       192678789
HTG14        753        191921309
HTG140       1163       191852916
HTG141       1080       192395765
HTG142       1083       192975115
HTG143       589        103841272
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2138       191586731
HTG149       1095       192364847
HTG15        745        191963148
HTG150       1077       192119040
HTG151       1090       192426687
HTG152       1041       190364643
HTG153       1974       181988294
HTG154       1784       181034783
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93628      48164281
INV10        48916      92508871
INV100       38635      162651925
INV101       37923      155535140
INV102       47450      148279075
INV103       31582      35878775
INV104       41258      162193552
INV105       8649       189035299
INV106       14549      181577331
INV107       5295       188760704
INV108       18509      176900436
INV109       34351      158679406
INV11        35         174810098
INV110       14344      172158272
INV111       23577      45955779
INV112       16795      180349455
INV113       21027      172501512
INV114       4891       191046501
INV115       26084      174037919
INV116       14547      181030545
INV117       44397      155376448
INV118       27112      171621394
INV119       19370      174154051
INV12        15632      161925418
INV120       49371      138775955
INV121       29055      84543185
INV122       96245      108547326
INV123       35892      166944993
INV124       23159      177277868
INV125       22654      170374262
INV126       4699       190767649
INV127       29376      152389625
INV128       55624      119361124
INV129       566        40635863
INV13        83272      64868423
INV130       7358       190633905
INV131       51895      153104512
INV132       5607       188059543
INV133       35090      162253206
INV134       3365       19020735
INV135       39813      159668855
INV136       62444      141571579
INV137       19462      30223725
INV138       104664     106635585
INV139       74577      120116541
INV14        54320      46101324
INV140       12112      167732182
INV141       18278      163726949
INV142       13818      94808827
INV143       29262      155753563
INV144       38610      149060814
INV145       51684      139700572
INV146       70877      126444377
INV147       97323      108082698
INV148       125942     86452766
INV149       27987      144315350
INV15        84538      65975420
INV150       12946      139875993
INV151       132        149902574
INV152       26397      124619450
INV16        80708      66715312
INV17        78537      66746722
INV18        50079      47120359
INV19        36852      121660608
INV2         59888      89722649
INV20        284        149846609
INV21        49881      102948166
INV22        77052      55594643
INV23        72033      61777374
INV24        503        326538
INV25        23152      127349623
INV26        6          133712559
INV27        56682      101641341
INV28        74038      50296507
INV29        70510      51206869
INV3         1369       188232507
INV30        76787      54969417
INV31        75551      57242745
INV32        76764      57110261
INV33        73303      54064968
INV34        55363      36915009
INV35        78682      56871964
INV36        74464      55066581
INV37        74387      60742758
INV38        77029      58615650
INV39        56732      37829364
INV4         880        127630174
INV40        77757      56004101
INV41        73562      52337759
INV42        74633      56045813
INV43        76864      57443933
INV44        38946      33663220
INV45        75621      48345729
INV46        73066      44533748
INV47        75217      45544787
INV48        76461      52866992
INV49        29667      22262412
INV5         26265      110061516
INV50        76238      53982420
INV51        74224      43989727
INV52        73428      43290058
INV53        73791      42592612
INV54        29028      17529807
INV55        69245      41128505
INV56        68883      41226471
INV57        68601      41232894
INV58        68676      40816532
INV59        69801      45083426
INV6         77729      71336868
INV60        69322      41884536
INV61        56793      33888976
INV62        65395      48445893
INV63        69007      49644705
INV64        73883      58883878
INV65        68482      48983627
INV66        66214      76107378
INV67        39295      148283347
INV68        9245       18883393
INV69        81479      126211856
INV7         53226      95764043
INV70        100429     109691945
INV71        116036     96137263
INV72        101319     70777781
INV73        35239      166647152
INV74        30755      171594048
INV75        27724      170864744
INV76        2640       190498229
INV77        6183       191107737
INV78        17837      180141483
INV79        15378      184713635
INV8         43847      90546758
INV80        6839       167378491
INV81        8875       189509571
INV82        15662      184182101
INV83        30722      171526293
INV84        65600      142208408
INV85        21638      22670137
INV86        50224      153584896
INV87        4095       191102716
INV88        11177      184659675
INV89        29153      168751324
INV9         80226      71402698
INV90        3317       189349389
INV91        6330       186171285
INV92        12367      180474553
INV93        39596      157268982
INV94        60755      142074593
INV95        67983      110944176
INV96        93063      112788673
INV97        14244      174036919
INV98        29357      160122987
INV99        66634      130026281
MAM1         21062      154718152
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         13955      164818204
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         20419      31491832
MAM30        1706       2411269
MAM31        6836       6159435
MAM32        79404      74426036
MAM33        31122      118974548
MAM34        75932      62137984
MAM35        68733      72275494
MAM36        64114      77806672
MAM37        50457      76781738
MAM38        8811       182843205
MAM39        698        679015
MAM4         26809      24996320
MAM5         13731      20581346
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         222546     70101214
PAT10        124320     102482604
PAT100       178683     3394977
PAT101       178342     3388498
PAT102       178198     3385762
PAT103       178185     3385515
PAT104       132610     2848492
PAT105       342935     8573375
PAT106       188806     88519660
PAT107       111348     132068608
PAT108       3850       194703659
PAT109       131292     110979300
PAT11        98863      64213900
PAT110       158599     54826034
PAT111       224681     34110381
PAT112       250080     15844313
PAT113       180682     63512552
PAT114       51695      26213879
PAT115       114135     110460977
PAT116       137530     83206438
PAT117       164380     99024764
PAT118       158392     103578951
PAT119       137596     115028387
PAT12        141823     62679900
PAT120       42621      28098514
PAT121       193712     81686401
PAT122       150218     108404223
PAT123       356051     11379519
PAT124       257211     57607676
PAT125       138160     48226316
PAT126       322021     22795469
PAT127       155642     102753966
PAT128       132724     110696205
PAT129       128341     121313309
PAT13        103922     59409436
PAT130       21664      184390005
PAT131       144889     112900617
PAT132       171997     96405634
PAT133       44617      171215968
PAT134       9167       47581637
PAT135       33645      178334734
PAT136       153558     109675196
PAT137       178705     90913377
PAT138       136050     115324192
PAT139       120392     123343236
PAT14        102673     49405820
PAT140       8526       8991488
PAT141       155429     101473147
PAT142       184764     88815933
PAT143       182409     85292093
PAT144       174403     93928365
PAT145       28829      20461016
PAT146       147930     108545990
PAT147       160944     101973644
PAT148       185311     90980420
PAT149       231649     49265020
PAT15        120390     52406644
PAT150       203020     47532890
PAT151       277498     9808008
PAT152       220370     46464160
PAT153       107730     2906417
PAT154       270386     21672571
PAT155       186660     61147649
PAT156       109662     106102758
PAT157       47746      9596649
PAT158       87159      87872668
PAT159       78135      95529851
PAT16        108541     62745531
PAT160       144037     78090897
PAT161       168238     70786048
PAT162       121010     93307227
PAT163       103752     84891082
PAT164       166141     46780225
PAT165       270022     5130418
PAT166       269978     5129582
PAT167       269978     5129582
PAT168       237888     4519872
PAT169       269396     5118524
PAT17        47669      17039281
PAT170       235450     25552370
PAT171       203694     47174781
PAT172       12103      424941
PAT173       165310     74498391
PAT174       91504      126583865
PAT175       171359     72072028
PAT176       214402     66356095
PAT177       42873      49259391
PAT178       235138     59544089
PAT179       123750     125093767
PAT18        146771     52594264
PAT180       217504     66591902
PAT181       198097     84199370
PAT182       2346       5855451
PAT183       190271     85554469
PAT184       158609     102172052
PAT185       157481     102983510
PAT186       99253      76900838
PAT187       156209     98316380
PAT188       91682      138752301
PAT189       160779     88041379
PAT19        153712     78039557
PAT190       136985     111168356
PAT191       42350      35878823
PAT192       168931     98953101
PAT193       142774     114661479
PAT194       131583     119360876
PAT195       97976      135115181
PAT196       155419     106223733
PAT197       185166     62148242
PAT198       32116      30256502
PAT199       93110      87244389
PAT2         194518     84672670
PAT20        104717     118087494
PAT200       91788      79966796
PAT201       83782      91661717
PAT202       108692     54197295
PAT203       101026     56660358
PAT204       150189     24631215
PAT205       93817      82459162
PAT206       26010      162900357
PAT207       113938     65759860
PAT208       81619      28134712
PAT209       3631       191518875
PAT21        133761     95340284
PAT210       84408      78157905
PAT211       145069     26290546
PAT212       76929      99953941
PAT213       95332      71448829
PAT214       129838     31394819
PAT215       4941       7291501
PAT216       106322     62280040
PAT217       140008     12598692
PAT218       150515     23979175
PAT219       74138      6340578
PAT22        84658      79569499
PAT220       58028      68766855
PAT221       41081      54488985
PAT222       60874      54846667
PAT223       37721      64049389
PAT224       41403      61064163
PAT225       40777      53268819
PAT226       79930      57627962
PAT227       111536     54517184
PAT228       37077      8158973
PAT229       103405     55692396
PAT23        123520     103391176
PAT230       99422      44580758
PAT231       84104      73950890
PAT232       98253      10042153
PAT233       123244     19683537
PAT234       86784      129976419
PAT235       158937     78754509
PAT236       213346     47013401
PAT237       169347     66528995
PAT238       59815      8716469
PAT239       161862     78374968
PAT24        119457     105503971
PAT240       119782     100490688
PAT241       86768      128896454
PAT242       37958      167205209
PAT243       35970      168656493
PAT244       75399      138099809
PAT245       252325     29172061
PAT246       137106     91853065
PAT247       148263     82349935
PAT248       141921     74968807
PAT249       16886      11382760
PAT25        145018     86742912
PAT250       141695     86763404
PAT251       144995     93151551
PAT252       257285     12186129
PAT253       152526     4584721
PAT254       240738     21500238
PAT255       248574     11702646
PAT256       258799     3881985
PAT257       76619      1149285
PAT258       258799     3881985
PAT259       253598     6415258
PAT26        174985     64376643
PAT260       183005     43408017
PAT261       57091      1826912
PAT262       96023      21414304
PAT263       36374      149540976
PAT264       17414      176266090
PAT265       155889     8152794
PAT266       33561      148872633
PAT267       31808      82257068
PAT268       5177       9379909
PAT269       37903      57481578
PAT27        72020      1800500
PAT270       37752      57968298
PAT271       37840      57577626
PAT272       37917      57289516
PAT273       60381      56854446
PAT274       129179     17677143
PAT275       131713     31074471
PAT276       47779      27461060
PAT277       138411     26719181
PAT278       151717     82173676
PAT279       257564     3863460
PAT28        102082     77369523
PAT280       202779     44603483
PAT281       187755     61695319
PAT282       170832     71463470
PAT283       65599      37908053
PAT29        93953      87559053
PAT3         171992     95904578
PAT30        119905     61672909
PAT31        96692      78977785
PAT32        128053     54918300
PAT33        92450      51198040
PAT34        117827     69179372
PAT35        119659     35930835
PAT36        121818     44323299
PAT37        94325      86760308
PAT38        147250     22244895
PAT39        149444     31041662
PAT4         153752     106058463
PAT40        114664     49976809
PAT41        33897      46161678
PAT42        95722      83166454
PAT43        100230     70746430
PAT44        135982     39560964
PAT45        143800     35449233
PAT46        123840     64322888
PAT47        104449     81149035
PAT48        93089      74613582
PAT49        113259     66580350
PAT5         57129      23913162
PAT50        65583      54917178
PAT51        135191     107998311
PAT52        167082     97033437
PAT53        116397     127556980
PAT54        196343     76723060
PAT55        80303      127991082
PAT56        27631      180872621
PAT57        185409     93066654
PAT58        274258     6856450
PAT59        129447     31627433
PAT6         170645     91912459
PAT60        161320     77719729
PAT61        92639      89107951
PAT62        106058     74951034
PAT63        122370     64033005
PAT64        68048      30422705
PAT65        70748      109764944
PAT66        87946      82759037
PAT67        92971      78935157
PAT68        93164      72444136
PAT69        93383      75087244
PAT7         154875     88271620
PAT70        115770     60532287
PAT71        102747     9942058
PAT72        175928     10547489
PAT73        171510     10872561
PAT74        171496     10866737
PAT75        99864      86225363
PAT76        99         196466297
PAT77        67         192869889
PAT78        103        195600591
PAT79        1132       196318332
PAT8         131122     96964681
PAT80        97604      5772661
PAT81        151009     9636510
PAT82        151022     9621259
PAT83        151024     9622125
PAT84        151021     9620837
PAT85        94628      88047763
PAT86        92255      94526562
PAT87        37563      34676580
PAT88        83459      93185861
PAT89        15567      180450135
PAT9         129260     101026612
PAT90        164890     19209721
PAT91        178944     3399936
PAT92        177434     3371246
PAT93        175305     3330795
PAT94        101402     1926638
PAT95        169165     12412132
PAT96        178699     3395281
PAT97        178691     3395129
PAT98        178677     3394863
PAT99        140786     2674934
PHG1         5824       104138625
PHG2         3019       106295919
PHG3         3020       101620715
PLN1         59767      93436571
PLN10        47564      48051623
PLN100       77257      71114370
PLN101       69910      84148629
PLN102       76125      67763010
PLN103       71988      76758376
PLN104       79868      65166618
PLN105       8104       7745854
PLN106       77956      63284506
PLN107       75146      68277163
PLN108       81468      59147137
PLN109       81347      58392323
PLN11        71546      76898503
PLN110       24298      27083462
PLN111       73349      62799606
PLN112       72156      70370125
PLN113       64147      83457149
PLN114       57261      64962735
PLN115       91252      52598997
PLN116       74821      67443457
PLN117       71216      68457234
PLN118       41742      48915308
PLN119       70482      70813142
PLN12        39816      50753798
PLN120       61634      78684514
PLN121       61893      81917493
PLN122       35783      34216904
PLN123       69450      73165250
PLN124       65248      74185833
PLN125       62867      80937102
PLN126       31993      41485218
PLN127       59696      84967291
PLN128       56958      84657816
PLN129       63613      79562358
PLN13        38807      63028116
PLN130       13832      19922591
PLN131       55301      91102294
PLN132       26705      105113915
PLN133       11121      169616904
PLN134       80         193253349
PLN135       31332      137993980
PLN136       6          180795696
PLN137       15265      153279412
PLN138       2279       179491976
PLN139       201        188494320
PLN14        25601      117919519
PLN140       1890       143567273
PLN141       4          165102368
PLN142       29753      136691467
PLN143       11511      24826180
PLN15        21197      110640707
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        1473       11877350
PLN2         74486      77615902
PLN20        23259      121287391
PLN21        6071       150261554
PLN22        1195       166515226
PLN23        1458       165567924
PLN24        30         163964553
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21961      107423846
PLN3         36200      105164563
PLN30        66913      69637026
PLN31        29615      31681063
PLN32        76757      76019036
PLN33        36358      41239988
PLN34        57312      72147499
PLN35        28689      28923618
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        280        132296769
PLN4         1368       177961614
PLN40        99         128278470
PLN41        276        130066439
PLN42        162        128507084
PLN43        96         78235858
PLN44        155        127161655
PLN45        140        128498419
PLN46        171        128468478
PLN47        168        134239052
PLN48        201        152936626
PLN49        273        194235260
PLN5         1845       186016576
PLN50        65         46109956
PLN51        272        193886506
PLN52        227        194049434
PLN53        137        175158920
PLN54        5          182400284
PLN55        14         189437622
PLN56        111        163524389
PLN57        53         160960328
PLN58        386        151381693
PLN59        2328       93715621
PLN6         1848       194272696
PLN60        7181       18795412
PLN61        14346      29953091
PLN62        18732      133872701
PLN63        77717      74501731
PLN64        96392      58592321
PLN65        34297      32440265
PLN66        80153      71428501
PLN67        77555      75757668
PLN68        79989      70155643
PLN69        81459      74668361
PLN7         1688       194277347
PLN70        60080      34111903
PLN71        98780      55111632
PLN72        82283      68249801
PLN73        44620      98674371
PLN74        5511       152839994
PLN75        11882      165587691
PLN76        29507      120346017
PLN77        53395      102417699
PLN78        17725      12655047
PLN79        80799      72352767
PLN8         1831       193322220
PLN80        17668      12943338
PLN81        49499      72634904
PLN82        25059      110563611
PLN83        13564      89761993
PLN84        1          774434471
PLN85        8305       28494018
PLN86        1858       148969943
PLN87        2          135217911
PLN88        2          155188403
PLN89        2          140023111
PLN9         49131      106369975
PLN90        2          154604167
PLN91        2          148753627
PLN92        3          173772618
PLN93        3          178836778
PLN94        3          176344173
PLN95        3          195539469
PLN96        12431      129466187
PLN97        81781      65443213
PLN98        92302      57802341
PLN99        23066      15620380
PRI1         23034      59762327
PRI10        1254       178692891
PRI11        865        105120773
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22384      144319360
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2081       192754914
PRI23        4907       186840598
PRI24        12078      30586908
PRI25        27934      79135867
PRI26        59714      83874064
PRI27        36311      82322681
PRI28        8758       172032991
PRI29        2265       191511011
PRI3         1439       174314309
PRI30        1665       190764297
PRI31        2075       192251373
PRI32        2195       191150383
PRI33        13091      162158571
PRI34        2067       170809233
PRI35        56436      88262262
PRI36        4477       9299641
PRI37        32154      63605650
PRI38        20538      119329276
PRI39        18691      150583407
PRI4         1276       185669146
PRI40        67704      85012457
PRI41        50233      89169276
PRI42        41719      84230754
PRI43        47255      95769974
PRI44        26885      100977166
PRI45        28651      109110050
PRI46        22892      105447380
PRI47        21149      48001117
PRI48        23090      123852730
PRI49        37771      110164174
PRI5         1337       184500937
PRI50        43593      86416093
PRI51        1          229594237
PRI52        1          190673448
PRI53        1          197221778
PRI54        18860      164111366
PRI55        40835      77871299
PRI6         1180       180111971
PRI7         1229       180255349
PRI8         1219       179122541
PRI9         1372       174797659
ROD1         37494      132461565
ROD10        990        182141245
ROD11        313        59221860
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15161      159100447
ROD2         907        176074185
ROD20        20982      153402221
ROD21        1216       193805576
ROD22        1007       158474097
ROD23        15255      168406561
ROD24        37600      68951616
ROD25        20074      114216098
ROD26        1529       193330721
ROD27        150580     18422422
ROD28        75238      78243299
ROD29        83726      53138247
ROD3         910        173137629
ROD30        56962      66066829
ROD4         900        173814565
ROD5         921        174674771
ROD6         964        177140666
ROD7         974        179619503
ROD8         968        181286279
ROD9         1001       181574078
STS1         85256      36747730
STS10        57907      44420409
STS11        48921      37511590
STS12        57924      43637361
STS13        64058      42737902
STS14        93169      34131972
STS15        104293     26506104
STS16        10772      2917144
STS17        103700     27504029
STS18        97621      33595220
STS19        96610      34549559
STS2         84142      49927708
STS20        71196      25121130
STS3         65861      25926514
STS4         77854      37074403
STS5         9142       5360707
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55705      37758824
SYN1         52645      71008900
SYN2         43737      80657281
SYN3         23838      124595057
SYN4         4593       176416683
SYN5         4587       176331540
SYN6         4592       176402547
SYN7         10320      162883613
SYN8         56776      73118443
SYN9         21121      48666292
TSA1         119079     37787968
TSA10        18501      20932212
TSA100       76680      52659255
TSA101       66774      66687697
TSA102       63892      75957536
TSA103       86991      55453747
TSA104       51740      27880810
TSA105       74245      86358066
TSA106       80229      75622518
TSA107       84801      72305810
TSA108       77881      83686531
TSA109       94375      51986778
TSA11        134170     34616677
TSA110       99157      69089270
TSA111       59230      97228833
TSA112       109175     49378845
TSA113       63354      68310026
TSA114       80812      88891396
TSA115       70536      71912167
TSA116       57870      119426084
TSA117       5003       6824267
TSA118       106689     67779914
TSA119       93410      83369889
TSA12        59768      19488440
TSA120       98615      76609458
TSA121       88033      68056906
TSA122       84941      58891355
TSA123       77605      62173752
TSA124       82434      76718672
TSA125       98409      60357622
TSA126       94492      42586949
TSA127       76551      54457847
TSA128       42473      39763260
TSA129       59626      61176103
TSA13        64542      58862448
TSA130       59047      61657426
TSA131       59168      62167042
TSA132       71956      78379950
TSA133       87818      51643326
TSA134       63336      64766777
TSA135       2563       1147163
TSA136       77745      34626570
TSA137       74689      66831444
TSA138       81079      78598444
TSA139       74692      64675647
TSA14        91996      62507406
TSA140       41882      34789042
TSA141       87600      70235611
TSA142       89003      68194525
TSA143       84656      77065314
TSA144       76791      81310397
TSA145       12038      10028761
TSA146       104187     53670971
TSA147       80878      61177338
TSA148       69693      78323809
TSA149       73196      67845845
TSA15        87656      43266725
TSA150       86992      75471245
TSA151       89428      70000229
TSA152       62311      102880653
TSA153       95611      74148270
TSA154       20799      14551082
TSA155       82974      63616708
TSA156       83472      63790182
TSA157       78941      73480275
TSA158       76936      75992422
TSA159       93256      58483267
TSA16        76021      85945541
TSA160       100927     67777228
TSA161       35508      24274059
TSA162       103445     64539230
TSA163       94920      75734700
TSA164       80355      64233867
TSA165       30552      47121787
TSA166       51839      98295419
TSA167       46917      107683976
TSA168       44952      111436512
TSA169       42000      117073120
TSA17        79282      72813794
TSA170       39479      121890914
TSA171       37678      125330444
TSA172       30670      109097872
TSA173       78905      65671407
TSA174       61760      78088578
TSA175       65825      57454871
TSA176       40183      19203236
TSA177       38342      27295147
TSA178       35785      38621286
TSA179       34467      33162251
TSA18        86990      44505259
TSA180       31670      56857624
TSA181       31446      57845848
TSA182       39266      23134620
TSA183       40382      18182813
TSA184       41061      15174943
TSA185       41459      13408377
TSA186       41699      12346210
TSA187       26552      7560175
TSA188       41889      11506042
TSA189       41935      11303163
TSA19        73713      88531920
TSA190       41981      11096976
TSA191       42054      10770114
TSA192       42099      10570948
TSA193       42146      10365212
TSA194       43309      10362207
TSA195       69616      80129578
TSA196       26923      63171712
TSA197       89415      47258677
TSA198       47220      118089707
TSA199       86115      55982924
TSA2         112857     41270825
TSA20        66317      50611440
TSA200       79788      68179642
TSA201       4209       7000727
TSA202       51803      113422564
TSA203       44468      125297442
TSA204       37716      136219910
TSA205       63686      93740297
TSA206       62741      93126523
TSA207       46334      60938611
TSA208       62968      91356653
TSA209       75264      70251649
TSA21        81010      82050811
TSA210       48708      114790470
TSA211       81060      60457833
TSA212       48578      115504480
TSA213       79665      62922125
TSA214       71228      77140870
TSA215       52435      59143202
TSA216       80932      60001620
TSA217       40964      127412427
TSA218       88534      47058145
TSA219       61937      92459996
TSA22        62981      84302128
TSA220       79675      61576520
TSA221       88145      48373235
TSA222       55802      72353627
TSA223       71004      77849450
TSA224       68819      81280831
TSA225       85636      49751087
TSA226       66528      82429296
TSA227       91281      39406050
TSA228       62631      88834556
TSA229       52061      26280651
TSA23        85921      72677240
TSA24        99504      51812612
TSA25        58972      18379993
TSA26        85797      70106183
TSA27        120080     38852195
TSA28        135074     34047115
TSA29        52642      68387687
TSA3         109733     40830795
TSA30        47693      62712379
TSA31        2568       4358627
TSA32        60987      81840924
TSA33        92736      66826706
TSA34        109036     50277160
TSA35        106046     49573929
TSA36        101812     53917489
TSA37        104284     47753675
TSA38        25389      16338232
TSA39        66195      59263498
TSA4         110492     47447995
TSA40        92195      67722162
TSA41        92653      62162134
TSA42        80016      85985823
TSA43        99476      49896159
TSA44        113588     34208526
TSA45        95224      67534051
TSA46        13727      8550688
TSA47        94376      35380174
TSA48        77496      35938873
TSA49        106331     43405855
TSA5         78313      23627515
TSA50        113836     45499687
TSA51        29689      20438208
TSA52        103698     51338286
TSA53        101105     54210094
TSA54        97800      59154259
TSA55        81457      86094158
TSA56        69662      30955177
TSA57        90365      71288560
TSA58        97520      54422413
TSA59        60100      105474646
TSA6         111583     58975350
TSA60        86932      65069884
TSA61        78619      70637275
TSA62        83058      72217122
TSA63        82797      72052194
TSA64        68995      90904935
TSA65        90775      66751306
TSA66        75897      84474882
TSA67        71863      73185394
TSA68        68804      60806344
TSA69        84870      78036163
TSA7         87421      57901423
TSA70        85128      78006974
TSA71        70319      97838883
TSA72        85540      69665112
TSA73        84998      51586540
TSA74        102424     68703465
TSA75        87429      59046111
TSA76        103691     57030248
TSA77        73563      72856703
TSA78        78601      44515996
TSA79        87334      79220475
TSA8         104450     72517643
TSA80        91719      69206004
TSA81        78362      53147378
TSA82        78400      56954579
TSA83        97317      60069251
TSA84        38937      36173906
TSA85        88948      76782378
TSA86        95034      55397472
TSA87        110915     44811175
TSA88        97305      57964555
TSA89        65129      97030273
TSA9         109298     60842426
TSA90        15369      14817152
TSA91        101299     55496095
TSA92        91074      53959118
TSA93        93807      43529343
TSA94        85784      74015406
TSA95        73184      72093605
TSA96        39929      46730597
TSA97        77159      80203977
TSA98        77312      55431136
TSA99        84109      38689281
UNA1         331        203865
VRL1         64903      70769481
VRL10        43229      72883414
VRL11        56533      70627952
VRL12        61167      72738007
VRL13        67518      67431626
VRL14        54867      73302746
VRL15        2840       3441331
VRL16        62745      70819240
VRL17        57092      72668936
VRL18        63478      63564678
VRL19        57002      73292382
VRL2         66379      66512170
VRL20        52491      66744316
VRL21        54656      72255110
VRL22        58269      71167230
VRL23        56011      73207648
VRL24        55138      73778491
VRL25        28856      46584661
VRL26        52073      74757429
VRL27        38021      81453332
VRL28        47479      74993854
VRL29        48073      73976258
VRL3         70109      63547048
VRL30        48973      76494134
VRL31        13681      25387738
VRL32        49437      77635745
VRL33        42564      86779067
VRL34        41594      82957447
VRL35        48366      79615136
VRL36        37758      86462894
VRL37        4690       14077699
VRL38        37870      90381904
VRL39        43998      82378614
VRL4         68196      65099820
VRL40        46502      77007284
VRL41        42650      84989593
VRL42        47013      80236684
VRL43        44361      80166781
VRL44        38156      86080760
VRL45        45624      76686146
VRL46        55261      83550306
VRL47        2          1554
VRL5         68629      68728351
VRL6         19606      24728907
VRL7         47936      77148735
VRL8         46495      71634496
VRL9         43814      71160830
VRT1         67764      78110274
VRT10        1319       193297450
VRT11        8963       180814244
VRT12        3138       102269796
VRT13        13369      172251922
VRT14        5825       185117490
VRT15        3795       188803260
VRT16        49451      115678387
VRT17        79236      69221134
VRT18        77245      66382073
VRT19        20257      15012446
VRT2         2018       192886076
VRT20        71597      76198520
VRT21        44683      123262662
VRT22        77126      63349360
VRT23        79212      62103731
VRT24        81633      58051242
VRT25        35713      24625481
VRT26        102766     66105738
VRT27        81128      56357433
VRT28        85590      58023398
VRT29        62931      47238673
VRT3         47972      121079759
VRT30        90668      54053437
VRT31        76011      57751943
VRT32        8730       7412560
VRT33        74791      58256603
VRT34        56253      45386451
VRT35        80826      56881398
VRT36        75190      59220924
VRT37        78486      59224983
VRT38        55213      21395606
VRT39        109804     52929051
VRT4         24852      148335156
VRT40        77282      65761828
VRT41        42443      21916145
VRT42        89695      53316911
VRT43        85760      58498046
VRT44        19967      162386082
VRT45        50         186377607
VRT46        88         177179294
VRT47        163        181176777
VRT48        300        194496566
VRT49        730        193323130
VRT5         39256      102901023
VRT50        2970       190777490
VRT51        57568      140009526
VRT52        33866      3612693
VRT53        177067     28429798
VRT54        53955      90444098
VRT55        3242       189215331
VRT56        9          178794778
VRT57        10         196480447
VRT58        11         184541365
VRT59        28         196498040
VRT6         72852      66444245
VRT60        389        196385145
VRT61        1315       195608731
VRT62        2566       194640733
VRT63        3378       193090756
VRT64        20017      77247058
VRT7         31812      63612788
VRT8         30162      115610066
VRT9         1265       193453095

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 218.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

24139331 18779444525   Homo sapiens
9882392  10228549605   Mus musculus
2197627   6529009564   Rattus norvegicus
2228475   5428540966   Bos taurus
4187182   5210268617   Zea mays
3298713   5070634803   Sus scrofa
1346792   3235810597   Hordeum vulgare subsp. vulgare
1729016   3190980414   Danio rerio
72        2590574434   Ovis canadensis canadensis
1812721   1942645790   Triticum aestivum
205313    1836402173   Cyprinus carpio
745839    1746317793   Solanum lycopersicum
1378251   1642168788   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
258052    1436154077   Strongylocentrotus purpuratus
118291    1377465262   Escherichia coli
463118    1336903816   Macaca mulatta
490329    1264433052   Spirometra erinaceieuropaei
1588051   1250005232   Xenopus tropicalis
2583179   1212109587   Arabidopsis thaliana

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349


3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2017

                NCBI-GenBank Flat File Release 218.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1  GI:173593
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1  GI:173603
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains two types of identifiers for a GenBank database entry:
a compound accession number and an NCBI GI identifier. 

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1  GI:6017929
            ^^^^^^^^^^  ^^^^^^^^^^
            Compound    NCBI GI
            Accession   Identifier
            Number

  A compound accession number consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one. Compound accessions are
often referred to as "Accession.Version" .

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  The NCBI GI identifier of the VERSION line also serves as a method for
identifying the sequence data that has existed for a database entry over
time. GI identifiers are numeric values of one or more digits. Since they
are integer keys, they are less human-friendly than the Accession.Version
system described above. Returning to our example for AF181452, it was
initially assigned GI 6017929. If the sequence changes, a new integer GI will
be assigned, perhaps 7345003 . And after the second sequence change, perhaps
the GI would become 10456892 .

  Why are both these methods for identifying the version of the sequence
associated with a database entry in use? For two reasons:

- Some data sources processed by NCBI for incorporation into its Entrez
  sequence retrieval system do not version their own sequences.

- GIs provide a uniform, integer identifier system for every sequence
  NCBI has processed. Some products and systems derived from (or reliant
  upon) NCBI products and services prefer to use these integer identifiers
  because they can all be processed in the same manner.

GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via GI-based or
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/M10101.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

NOTE: As of December 2013, GI identifiers are no longer assigned for
selected classes of sequence records, such as WGS projects that include
millions of contigs and millions of scaffolds (example: ALWZ04).

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1  GI:424935948
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Clark K, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW.
   GenBank. Nucleic Acids Res. 44(D1):D67-72 (2016)

   DOI:   10.1093/nar/gkv1276
   PMID:  26590407
   PMCID: PMC4702903.

  The following statement is an example of how you may cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number J01016, which showed
significant similarity...'

  (1) Clark, K. et al, Nucleic Acids Res. 44(D1), D67-72 (2016)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: if you have a World Wide Web browser, such as
Netscape or Internet-Explorer, simply point your browser to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov or by
phone at 301-496-2475.

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Michael Kornbluh, Jim Ostell, Vasuki Palanigobu,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Kamen Todorov, Eugene Yaschenko,
	Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center