Release Notes For GenBank Release 219

GBREL.TXT          Genetic Sequence Data Bank
                         April 15 2017

               NCBI-GenBank Flat File Release 219.0

                    Distribution Release Notes

 200877884 loci, 231824951552 bases, from 200877884 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 219.0
1.2 Cutoff Date
1.3 Important Changes in Release 219.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 219.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 219.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 219.0, incorporates data processed by the INSDC databases
as of Friday, April 14, 2017 at approximately 1:33am EDT.  For more recent
data, users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotides' database (see Section 6.4 of this document).

1.3 Important Changes in Release 219.0

1.3.1 GI sequence identifiers have been removed from GenBank/GenPept/FASTA
      formats and the FASTA header has been simplified

  As of March 15 2017, the integer sequence identifiers known as "GIs" were
no longer included in the GenBank, GenPept, and FASTA formats for GenBank
Update products. The FASTA header has been further simplified, to report only
the sequence Accession.Version for records that originate within the
International Sequence Database Collaboration (INSDC).

  And as of April 15 2017, this GenBank Release 219.0 is the first one to
follow that same policy. 

  Previously-assigned GI sequence identifiers will continue to exist
'behind the scenes', and NCBI services which accept GIs as inputs will
continue to be supported. NCBI will be adding support for Accession.Version
identifiers to any services that currently do not support them. As NCBI
makes this transition, we encourage any users who have workflows that
depend on GIs to make use of Accession.Version identifiers instead.

  The FASTA format has also been changed for sequence records originating
within the INSDC, to report only the Accession.Version and the record title.
This will improve compatibility with other file types provided by NCBI and
others, including GFF3, Gene, and dbSNP download files. This FASTA format
change has already been made for the redesigned genomes FTP site based on
user requests to have a single consistent sequence identifier for both GFF3
and FASTA formats.

  At this time, we plan to continue to provide database source information in
the FASTA header/definition line for non-INSDC sources of sequence data,
including UniProt, PDB structures, PIR, and Patent sequences.

Example 1 : An INSDC nucleotide record

  In the sample record below, nucleotide sequence AF123456 was assigned a
GI of 6633795, and the protein translated from its coding region feature
was assigned a GI of 6633796 :

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2  GI:6633795
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /db_xref="GI:6633796"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

  The Accession.Version is now the sole sequence version identifier. The GI
value on the VERSION line and the GI /db_xref qualifier for the coding region
feature are no longer displayed:

LOCUS       AF123456                1510 bp    mRNA    linear   VRT 12-APR-2012
DEFINITION  Gallus gallus doublesex and mab-3 related transcription factor 1
            (DMRT1) mRNA, partial cds.
ACCESSION   AF123456
VERSION     AF123456.2
....
     CDS             <1..936
                     /gene="DMRT1"
                     /note="cDMRT1"
                     /codon_start=1
                     /product="doublesex and mab-3 related transcription factor
                     1"
                     /protein_id="AAF19666.1"
                     /translation="PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSL
                     IAERQRVMAVQVALRRQQAQEEELGISHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPA
                     HSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSDLVVDSTYYSSFYQPSLYPYY
                     NNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQWQMKGMEN
                     RHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDS
                     GLGCLSSSESTKGDLECEPHQEPGAFAVSPVLEGE"

Example 2 : A GenPept record for an INSDC sequence

  The GenPept display format previously included GI identifiers in the VERSION
lines (note that the coding region feature for GenPept has never included any
mention of the protein GI identifiers) :

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1  GI:6633796
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

The VERSION line now no longer includes the GI identifier:

LOCUS       AAF19666                 311 aa            linear   VRT 12-APR-2012
DEFINITION  doublesex and mab-3 related transcription factor 1, partial [Gallus
            gallus].
ACCESSION   AAF19666
VERSION     AAF19666.1
DBSOURCE    accession AF123456.2
....
     CDS             1..311
                     /gene="DMRT1"
                     /coded_by="AF123456.2:<1..936"

Example 3: FASTA format for an INSDC nucleotide and protein sequence

  Previously, the FASTA display for most products included GI and database
source information (eg, 'gb' for GenBank, 'emb' for ENA, 'dbj' for
DDBJ), using the '|' character as a delimiter:

>gi|6633795|gb|AF123456.2| Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>gi|6633796|gb|AAF19666.1| doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

  Since March 15 2017, and with this April 2017 GenBank Release, just the
Accession.Version will be provided:

>AF123456.2 Gallus gallus doublesex and mab-3 related transcription factor 1 (DMRT1) mRNA, partial cds
CCGGCGGCGGGCAAGAAGCTGCCGCGTCTGCCCAAGTGTGCCCGCTGCCGCAACCACGGCTACTCCTCGC
CGCTGAAGGGGCACAAGCGGTTCTGCATGTGGCGGGACTGCCAGTGCAAGAAGTGCAGCCTGATCGCCGA
[....]

>AAF19666.1 doublesex and mab-3 related transcription factor 1, partial
[Gallus gallus]
PAAGKKLPRLPKCARCRNHGYSSPLKGHKRFCMWRDCQCKKCSLIAERQRVMAVQVALRRQQAQEEELGI
SHPVPLPSAPEPVVKKSSSSSSCLLQDSSSPAHSTSTVAAAAASAPPEGRMLIQDIPSIPSRGHLESTSD
LVVDSTYYSSFYQPSLYPYYNNLYNYSQYQMAVATESSSSETGGTFVGSAMKNSLRSLPATYMSSQSGKQ
WQMKGMENRHAMSSQYRMCSYYPPTSYLGQGVGSPTCVTQILASEDTPSYSESKARVFSPPSSQDSGLGC
LSSSESTKGDLECEPHQEPGAFAVSPVLEGE

Please direct any inquiries about these changes to the NCBI Service Desk:

  info@ncbi.nlm.nih.gov

1.3.2 Organizational changes

  The total number of sequence data files increased by 42 with this release:

  - the BCT division is now composed of 350 files (+20)
  - the CON division is now composed of 359 files (+3)
  - the ENV division is now composed of  97 files (+2)
  - the EST division is now composed of 483 files (+2)
  - the INV division is now composed of 153 files (+1)
  - the PAT division is now composed of 290 files (+7)
  - the PHG division is now composed of   4 files (+1)
  - the PLN division is now composed of 145 files (+2)
  - the PRI division is now composed of  56 files (+1)
  - the SYN division is now composed of  10 files (+1)
  - the TSA division is now composed of 230 files (+1)
  - the VRL division is now composed of  48 files (+1)

1.3.3 Invalid flatfile entry in GenBank 218.0 corrected : KX396599

  A user at Chemical Abstracts Services helpfully reported a formatting error
for GenBank sequence record KX396599 in GenBank Release 218.0 . The record
appeared with the KEYWORDS linetype in the wrong column:

LOCUS       KX396599                8308 bp    DNA     linear   PLN 18-JAN-2017
DEFINITION  Marshallia obovata retrotransposon del/tekay, complete sequence.
ACCESSION   KX396599
VERSION     KX396599.1  GI:1131742074

            KEYWORDS.
SOURCE      Marshallia obovata

  This was caused by the presence of an invalid keyword, consisting of just
a period. The data problem was fixed, but time constraints prevented us from
issuing a patch for the affected file ( gbpln130.seq ). Nonetheless, we
appreciate the scrutiny provided by GenBank users, and we do follow-up on all
problem reports. Thank you CAS!

1.3.4 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 219.0. Consider gbgss174.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                           April 15 2017

                NCBI-GenBank Flat File Release 219.0

                           GSS Sequences (Part 1)

   87034 loci,    63855245 bases, from    87034 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "174" based on the number of files dumped from the other
system.  We hope to resolve this discrepancy at some point, but the priority
is certainly much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 No changes impacting GenBank Release content are currently planned.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2855 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct36.seq - Bacterial sequence entries, part 36.
282. gbbct37.seq - Bacterial sequence entries, part 37.
283. gbbct38.seq - Bacterial sequence entries, part 38.
284. gbbct39.seq - Bacterial sequence entries, part 39.
285. gbbct4.seq - Bacterial sequence entries, part 4.
286. gbbct40.seq - Bacterial sequence entries, part 40.
287. gbbct41.seq - Bacterial sequence entries, part 41.
288. gbbct42.seq - Bacterial sequence entries, part 42.
289. gbbct43.seq - Bacterial sequence entries, part 43.
290. gbbct44.seq - Bacterial sequence entries, part 44.
291. gbbct45.seq - Bacterial sequence entries, part 45.
292. gbbct46.seq - Bacterial sequence entries, part 46.
293. gbbct47.seq - Bacterial sequence entries, part 47.
294. gbbct48.seq - Bacterial sequence entries, part 48.
295. gbbct49.seq - Bacterial sequence entries, part 49.
296. gbbct5.seq - Bacterial sequence entries, part 5.
297. gbbct50.seq - Bacterial sequence entries, part 50.
298. gbbct51.seq - Bacterial sequence entries, part 51.
299. gbbct52.seq - Bacterial sequence entries, part 52.
300. gbbct53.seq - Bacterial sequence entries, part 53.
301. gbbct54.seq - Bacterial sequence entries, part 54.
302. gbbct55.seq - Bacterial sequence entries, part 55.
303. gbbct56.seq - Bacterial sequence entries, part 56.
304. gbbct57.seq - Bacterial sequence entries, part 57.
305. gbbct58.seq - Bacterial sequence entries, part 58.
306. gbbct59.seq - Bacterial sequence entries, part 59.
307. gbbct6.seq - Bacterial sequence entries, part 6.
308. gbbct60.seq - Bacterial sequence entries, part 60.
309. gbbct61.seq - Bacterial sequence entries, part 61.
310. gbbct62.seq - Bacterial sequence entries, part 62.
311. gbbct63.seq - Bacterial sequence entries, part 63.
312. gbbct64.seq - Bacterial sequence entries, part 64.
313. gbbct65.seq - Bacterial sequence entries, part 65.
314. gbbct66.seq - Bacterial sequence entries, part 66.
315. gbbct67.seq - Bacterial sequence entries, part 67.
316. gbbct68.seq - Bacterial sequence entries, part 68.
317. gbbct69.seq - Bacterial sequence entries, part 69.
318. gbbct7.seq - Bacterial sequence entries, part 7.
319. gbbct70.seq - Bacterial sequence entries, part 70.
320. gbbct71.seq - Bacterial sequence entries, part 71.
321. gbbct72.seq - Bacterial sequence entries, part 72.
322. gbbct73.seq - Bacterial sequence entries, part 73.
323. gbbct74.seq - Bacterial sequence entries, part 74.
324. gbbct75.seq - Bacterial sequence entries, part 75.
325. gbbct76.seq - Bacterial sequence entries, part 76.
326. gbbct77.seq - Bacterial sequence entries, part 77.
327. gbbct78.seq - Bacterial sequence entries, part 78.
328. gbbct79.seq - Bacterial sequence entries, part 79.
329. gbbct8.seq - Bacterial sequence entries, part 8.
330. gbbct80.seq - Bacterial sequence entries, part 80.
331. gbbct81.seq - Bacterial sequence entries, part 81.
332. gbbct82.seq - Bacterial sequence entries, part 82.
333. gbbct83.seq - Bacterial sequence entries, part 83.
334. gbbct84.seq - Bacterial sequence entries, part 84.
335. gbbct85.seq - Bacterial sequence entries, part 85.
336. gbbct86.seq - Bacterial sequence entries, part 86.
337. gbbct87.seq - Bacterial sequence entries, part 87.
338. gbbct88.seq - Bacterial sequence entries, part 88.
339. gbbct89.seq - Bacterial sequence entries, part 89.
340. gbbct9.seq - Bacterial sequence entries, part 9.
341. gbbct90.seq - Bacterial sequence entries, part 90.
342. gbbct91.seq - Bacterial sequence entries, part 91.
343. gbbct92.seq - Bacterial sequence entries, part 92.
344. gbbct93.seq - Bacterial sequence entries, part 93.
345. gbbct94.seq - Bacterial sequence entries, part 94.
346. gbbct95.seq - Bacterial sequence entries, part 95.
347. gbbct96.seq - Bacterial sequence entries, part 96.
348. gbbct97.seq - Bacterial sequence entries, part 97.
349. gbbct98.seq - Bacterial sequence entries, part 98.
350. gbbct99.seq - Bacterial sequence entries, part 99.
351. gbchg.txt - Accession numbers of entries updated since the previous release.
352. gbcon1.seq - Constructed sequence entries, part 1.
353. gbcon10.seq - Constructed sequence entries, part 10.
354. gbcon100.seq - Constructed sequence entries, part 100.
355. gbcon101.seq - Constructed sequence entries, part 101.
356. gbcon102.seq - Constructed sequence entries, part 102.
357. gbcon103.seq - Constructed sequence entries, part 103.
358. gbcon104.seq - Constructed sequence entries, part 104.
359. gbcon105.seq - Constructed sequence entries, part 105.
360. gbcon106.seq - Constructed sequence entries, part 106.
361. gbcon107.seq - Constructed sequence entries, part 107.
362. gbcon108.seq - Constructed sequence entries, part 108.
363. gbcon109.seq - Constructed sequence entries, part 109.
364. gbcon11.seq - Constructed sequence entries, part 11.
365. gbcon110.seq - Constructed sequence entries, part 110.
366. gbcon111.seq - Constructed sequence entries, part 111.
367. gbcon112.seq - Constructed sequence entries, part 112.
368. gbcon113.seq - Constructed sequence entries, part 113.
369. gbcon114.seq - Constructed sequence entries, part 114.
370. gbcon115.seq - Constructed sequence entries, part 115.
371. gbcon116.seq - Constructed sequence entries, part 116.
372. gbcon117.seq - Constructed sequence entries, part 117.
373. gbcon118.seq - Constructed sequence entries, part 118.
374. gbcon119.seq - Constructed sequence entries, part 119.
375. gbcon12.seq - Constructed sequence entries, part 12.
376. gbcon120.seq - Constructed sequence entries, part 120.
377. gbcon121.seq - Constructed sequence entries, part 121.
378. gbcon122.seq - Constructed sequence entries, part 122.
379. gbcon123.seq - Constructed sequence entries, part 123.
380. gbcon124.seq - Constructed sequence entries, part 124.
381. gbcon125.seq - Constructed sequence entries, part 125.
382. gbcon126.seq - Constructed sequence entries, part 126.
383. gbcon127.seq - Constructed sequence entries, part 127.
384. gbcon128.seq - Constructed sequence entries, part 128.
385. gbcon129.seq - Constructed sequence entries, part 129.
386. gbcon13.seq - Constructed sequence entries, part 13.
387. gbcon130.seq - Constructed sequence entries, part 130.
388. gbcon131.seq - Constructed sequence entries, part 131.
389. gbcon132.seq - Constructed sequence entries, part 132.
390. gbcon133.seq - Constructed sequence entries, part 133.
391. gbcon134.seq - Constructed sequence entries, part 134.
392. gbcon135.seq - Constructed sequence entries, part 135.
393. gbcon136.seq - Constructed sequence entries, part 136.
394. gbcon137.seq - Constructed sequence entries, part 137.
395. gbcon138.seq - Constructed sequence entries, part 138.
396. gbcon139.seq - Constructed sequence entries, part 139.
397. gbcon14.seq - Constructed sequence entries, part 14.
398. gbcon140.seq - Constructed sequence entries, part 140.
399. gbcon141.seq - Constructed sequence entries, part 141.
400. gbcon142.seq - Constructed sequence entries, part 142.
401. gbcon143.seq - Constructed sequence entries, part 143.
402. gbcon144.seq - Constructed sequence entries, part 144.
403. gbcon145.seq - Constructed sequence entries, part 145.
404. gbcon146.seq - Constructed sequence entries, part 146.
405. gbcon147.seq - Constructed sequence entries, part 147.
406. gbcon148.seq - Constructed sequence entries, part 148.
407. gbcon149.seq - Constructed sequence entries, part 149.
408. gbcon15.seq - Constructed sequence entries, part 15.
409. gbcon150.seq - Constructed sequence entries, part 150.
410. gbcon151.seq - Constructed sequence entries, part 151.
411. gbcon152.seq - Constructed sequence entries, part 152.
412. gbcon153.seq - Constructed sequence entries, part 153.
413. gbcon154.seq - Constructed sequence entries, part 154.
414. gbcon155.seq - Constructed sequence entries, part 155.
415. gbcon156.seq - Constructed sequence entries, part 156.
416. gbcon157.seq - Constructed sequence entries, part 157.
417. gbcon158.seq - Constructed sequence entries, part 158.
418. gbcon159.seq - Constructed sequence entries, part 159.
419. gbcon16.seq - Constructed sequence entries, part 16.
420. gbcon160.seq - Constructed sequence entries, part 160.
421. gbcon161.seq - Constructed sequence entries, part 161.
422. gbcon162.seq - Constructed sequence entries, part 162.
423. gbcon163.seq - Constructed sequence entries, part 163.
424. gbcon164.seq - Constructed sequence entries, part 164.
425. gbcon165.seq - Constructed sequence entries, part 165.
426. gbcon166.seq - Constructed sequence entries, part 166.
427. gbcon167.seq - Constructed sequence entries, part 167.
428. gbcon168.seq - Constructed sequence entries, part 168.
429. gbcon169.seq - Constructed sequence entries, part 169.
430. gbcon17.seq - Constructed sequence entries, part 17.
431. gbcon170.seq - Constructed sequence entries, part 170.
432. gbcon171.seq - Constructed sequence entries, part 171.
433. gbcon172.seq - Constructed sequence entries, part 172.
434. gbcon173.seq - Constructed sequence entries, part 173.
435. gbcon174.seq - Constructed sequence entries, part 174.
436. gbcon175.seq - Constructed sequence entries, part 175.
437. gbcon176.seq - Constructed sequence entries, part 176.
438. gbcon177.seq - Constructed sequence entries, part 177.
439. gbcon178.seq - Constructed sequence entries, part 178.
440. gbcon179.seq - Constructed sequence entries, part 179.
441. gbcon18.seq - Constructed sequence entries, part 18.
442. gbcon180.seq - Constructed sequence entries, part 180.
443. gbcon181.seq - Constructed sequence entries, part 181.
444. gbcon182.seq - Constructed sequence entries, part 182.
445. gbcon183.seq - Constructed sequence entries, part 183.
446. gbcon184.seq - Constructed sequence entries, part 184.
447. gbcon185.seq - Constructed sequence entries, part 185.
448. gbcon186.seq - Constructed sequence entries, part 186.
449. gbcon187.seq - Constructed sequence entries, part 187.
450. gbcon188.seq - Constructed sequence entries, part 188.
451. gbcon189.seq - Constructed sequence entries, part 189.
452. gbcon19.seq - Constructed sequence entries, part 19.
453. gbcon190.seq - Constructed sequence entries, part 190.
454. gbcon191.seq - Constructed sequence entries, part 191.
455. gbcon192.seq - Constructed sequence entries, part 192.
456. gbcon193.seq - Constructed sequence entries, part 193.
457. gbcon194.seq - Constructed sequence entries, part 194.
458. gbcon195.seq - Constructed sequence entries, part 195.
459. gbcon196.seq - Constructed sequence entries, part 196.
460. gbcon197.seq - Constructed sequence entries, part 197.
461. gbcon198.seq - Constructed sequence entries, part 198.
462. gbcon199.seq - Constructed sequence entries, part 199.
463. gbcon2.seq - Constructed sequence entries, part 2.
464. gbcon20.seq - Constructed sequence entries, part 20.
465. gbcon200.seq - Constructed sequence entries, part 200.
466. gbcon201.seq - Constructed sequence entries, part 201.
467. gbcon202.seq - Constructed sequence entries, part 202.
468. gbcon203.seq - Constructed sequence entries, part 203.
469. gbcon204.seq - Constructed sequence entries, part 204.
470. gbcon205.seq - Constructed sequence entries, part 205.
471. gbcon206.seq - Constructed sequence entries, part 206.
472. gbcon207.seq - Constructed sequence entries, part 207.
473. gbcon208.seq - Constructed sequence entries, part 208.
474. gbcon209.seq - Constructed sequence entries, part 209.
475. gbcon21.seq - Constructed sequence entries, part 21.
476. gbcon210.seq - Constructed sequence entries, part 210.
477. gbcon211.seq - Constructed sequence entries, part 211.
478. gbcon212.seq - Constructed sequence entries, part 212.
479. gbcon213.seq - Constructed sequence entries, part 213.
480. gbcon214.seq - Constructed sequence entries, part 214.
481. gbcon215.seq - Constructed sequence entries, part 215.
482. gbcon216.seq - Constructed sequence entries, part 216.
483. gbcon217.seq - Constructed sequence entries, part 217.
484. gbcon218.seq - Constructed sequence entries, part 218.
485. gbcon219.seq - Constructed sequence entries, part 219.
486. gbcon22.seq - Constructed sequence entries, part 22.
487. gbcon220.seq - Constructed sequence entries, part 220.
488. gbcon221.seq - Constructed sequence entries, part 221.
489. gbcon222.seq - Constructed sequence entries, part 222.
490. gbcon223.seq - Constructed sequence entries, part 223.
491. gbcon224.seq - Constructed sequence entries, part 224.
492. gbcon225.seq - Constructed sequence entries, part 225.
493. gbcon226.seq - Constructed sequence entries, part 226.
494. gbcon227.seq - Constructed sequence entries, part 227.
495. gbcon228.seq - Constructed sequence entries, part 228.
496. gbcon229.seq - Constructed sequence entries, part 229.
497. gbcon23.seq - Constructed sequence entries, part 23.
498. gbcon230.seq - Constructed sequence entries, part 230.
499. gbcon231.seq - Constructed sequence entries, part 231.
500. gbcon232.seq - Constructed sequence entries, part 232.
501. gbcon233.seq - Constructed sequence entries, part 233.
502. gbcon234.seq - Constructed sequence entries, part 234.
503. gbcon235.seq - Constructed sequence entries, part 235.
504. gbcon236.seq - Constructed sequence entries, part 236.
505. gbcon237.seq - Constructed sequence entries, part 237.
506. gbcon238.seq - Constructed sequence entries, part 238.
507. gbcon239.seq - Constructed sequence entries, part 239.
508. gbcon24.seq - Constructed sequence entries, part 24.
509. gbcon240.seq - Constructed sequence entries, part 240.
510. gbcon241.seq - Constructed sequence entries, part 241.
511. gbcon242.seq - Constructed sequence entries, part 242.
512. gbcon243.seq - Constructed sequence entries, part 243.
513. gbcon244.seq - Constructed sequence entries, part 244.
514. gbcon245.seq - Constructed sequence entries, part 245.
515. gbcon246.seq - Constructed sequence entries, part 246.
516. gbcon247.seq - Constructed sequence entries, part 247.
517. gbcon248.seq - Constructed sequence entries, part 248.
518. gbcon249.seq - Constructed sequence entries, part 249.
519. gbcon25.seq - Constructed sequence entries, part 25.
520. gbcon250.seq - Constructed sequence entries, part 250.
521. gbcon251.seq - Constructed sequence entries, part 251.
522. gbcon252.seq - Constructed sequence entries, part 252.
523. gbcon253.seq - Constructed sequence entries, part 253.
524. gbcon254.seq - Constructed sequence entries, part 254.
525. gbcon255.seq - Constructed sequence entries, part 255.
526. gbcon256.seq - Constructed sequence entries, part 256.
527. gbcon257.seq - Constructed sequence entries, part 257.
528. gbcon258.seq - Constructed sequence entries, part 258.
529. gbcon259.seq - Constructed sequence entries, part 259.
530. gbcon26.seq - Constructed sequence entries, part 26.
531. gbcon260.seq - Constructed sequence entries, part 260.
532. gbcon261.seq - Constructed sequence entries, part 261.
533. gbcon262.seq - Constructed sequence entries, part 262.
534. gbcon263.seq - Constructed sequence entries, part 263.
535. gbcon264.seq - Constructed sequence entries, part 264.
536. gbcon265.seq - Constructed sequence entries, part 265.
537. gbcon266.seq - Constructed sequence entries, part 266.
538. gbcon267.seq - Constructed sequence entries, part 267.
539. gbcon268.seq - Constructed sequence entries, part 268.
540. gbcon269.seq - Constructed sequence entries, part 269.
541. gbcon27.seq - Constructed sequence entries, part 27.
542. gbcon270.seq - Constructed sequence entries, part 270.
543. gbcon271.seq - Constructed sequence entries, part 271.
544. gbcon272.seq - Constructed sequence entries, part 272.
545. gbcon273.seq - Constructed sequence entries, part 273.
546. gbcon274.seq - Constructed sequence entries, part 274.
547. gbcon275.seq - Constructed sequence entries, part 275.
548. gbcon276.seq - Constructed sequence entries, part 276.
549. gbcon277.seq - Constructed sequence entries, part 277.
550. gbcon278.seq - Constructed sequence entries, part 278.
551. gbcon279.seq - Constructed sequence entries, part 279.
552. gbcon28.seq - Constructed sequence entries, part 28.
553. gbcon280.seq - Constructed sequence entries, part 280.
554. gbcon281.seq - Constructed sequence entries, part 281.
555. gbcon282.seq - Constructed sequence entries, part 282.
556. gbcon283.seq - Constructed sequence entries, part 283.
557. gbcon284.seq - Constructed sequence entries, part 284.
558. gbcon285.seq - Constructed sequence entries, part 285.
559. gbcon286.seq - Constructed sequence entries, part 286.
560. gbcon287.seq - Constructed sequence entries, part 287.
561. gbcon288.seq - Constructed sequence entries, part 288.
562. gbcon289.seq - Constructed sequence entries, part 289.
563. gbcon29.seq - Constructed sequence entries, part 29.
564. gbcon290.seq - Constructed sequence entries, part 290.
565. gbcon291.seq - Constructed sequence entries, part 291.
566. gbcon292.seq - Constructed sequence entries, part 292.
567. gbcon293.seq - Constructed sequence entries, part 293.
568. gbcon294.seq - Constructed sequence entries, part 294.
569. gbcon295.seq - Constructed sequence entries, part 295.
570. gbcon296.seq - Constructed sequence entries, part 296.
571. gbcon297.seq - Constructed sequence entries, part 297.
572. gbcon298.seq - Constructed sequence entries, part 298.
573. gbcon299.seq - Constructed sequence entries, part 299.
574. gbcon3.seq - Constructed sequence entries, part 3.
575. gbcon30.seq - Constructed sequence entries, part 30.
576. gbcon300.seq - Constructed sequence entries, part 300.
577. gbcon301.seq - Constructed sequence entries, part 301.
578. gbcon302.seq - Constructed sequence entries, part 302.
579. gbcon303.seq - Constructed sequence entries, part 303.
580. gbcon304.seq - Constructed sequence entries, part 304.
581. gbcon305.seq - Constructed sequence entries, part 305.
582. gbcon306.seq - Constructed sequence entries, part 306.
583. gbcon307.seq - Constructed sequence entries, part 307.
584. gbcon308.seq - Constructed sequence entries, part 308.
585. gbcon309.seq - Constructed sequence entries, part 309.
586. gbcon31.seq - Constructed sequence entries, part 31.
587. gbcon310.seq - Constructed sequence entries, part 310.
588. gbcon311.seq - Constructed sequence entries, part 311.
589. gbcon312.seq - Constructed sequence entries, part 312.
590. gbcon313.seq - Constructed sequence entries, part 313.
591. gbcon314.seq - Constructed sequence entries, part 314.
592. gbcon315.seq - Constructed sequence entries, part 315.
593. gbcon316.seq - Constructed sequence entries, part 316.
594. gbcon317.seq - Constructed sequence entries, part 317.
595. gbcon318.seq - Constructed sequence entries, part 318.
596. gbcon319.seq - Constructed sequence entries, part 319.
597. gbcon32.seq - Constructed sequence entries, part 32.
598. gbcon320.seq - Constructed sequence entries, part 320.
599. gbcon321.seq - Constructed sequence entries, part 321.
600. gbcon322.seq - Constructed sequence entries, part 322.
601. gbcon323.seq - Constructed sequence entries, part 323.
602. gbcon324.seq - Constructed sequence entries, part 324.
603. gbcon325.seq - Constructed sequence entries, part 325.
604. gbcon326.seq - Constructed sequence entries, part 326.
605. gbcon327.seq - Constructed sequence entries, part 327.
606. gbcon328.seq - Constructed sequence entries, part 328.
607. gbcon329.seq - Constructed sequence entries, part 329.
608. gbcon33.seq - Constructed sequence entries, part 33.
609. gbcon330.seq - Constructed sequence entries, part 330.
610. gbcon331.seq - Constructed sequence entries, part 331.
611. gbcon332.seq - Constructed sequence entries, part 332.
612. gbcon333.seq - Constructed sequence entries, part 333.
613. gbcon334.seq - Constructed sequence entries, part 334.
614. gbcon335.seq - Constructed sequence entries, part 335.
615. gbcon336.seq - Constructed sequence entries, part 336.
616. gbcon337.seq - Constructed sequence entries, part 337.
617. gbcon338.seq - Constructed sequence entries, part 338.
618. gbcon339.seq - Constructed sequence entries, part 339.
619. gbcon34.seq - Constructed sequence entries, part 34.
620. gbcon340.seq - Constructed sequence entries, part 340.
621. gbcon341.seq - Constructed sequence entries, part 341.
622. gbcon342.seq - Constructed sequence entries, part 342.
623. gbcon343.seq - Constructed sequence entries, part 343.
624. gbcon344.seq - Constructed sequence entries, part 344.
625. gbcon345.seq - Constructed sequence entries, part 345.
626. gbcon346.seq - Constructed sequence entries, part 346.
627. gbcon347.seq - Constructed sequence entries, part 347.
628. gbcon348.seq - Constructed sequence entries, part 348.
629. gbcon349.seq - Constructed sequence entries, part 349.
630. gbcon35.seq - Constructed sequence entries, part 35.
631. gbcon350.seq - Constructed sequence entries, part 350.
632. gbcon351.seq - Constructed sequence entries, part 351.
633. gbcon352.seq - Constructed sequence entries, part 352.
634. gbcon353.seq - Constructed sequence entries, part 353.
635. gbcon354.seq - Constructed sequence entries, part 354.
636. gbcon355.seq - Constructed sequence entries, part 355.
637. gbcon356.seq - Constructed sequence entries, part 356.
638. gbcon357.seq - Constructed sequence entries, part 357.
639. gbcon358.seq - Constructed sequence entries, part 358.
640. gbcon359.seq - Constructed sequence entries, part 359.
641. gbcon36.seq - Constructed sequence entries, part 36.
642. gbcon37.seq - Constructed sequence entries, part 37.
643. gbcon38.seq - Constructed sequence entries, part 38.
644. gbcon39.seq - Constructed sequence entries, part 39.
645. gbcon4.seq - Constructed sequence entries, part 4.
646. gbcon40.seq - Constructed sequence entries, part 40.
647. gbcon41.seq - Constructed sequence entries, part 41.
648. gbcon42.seq - Constructed sequence entries, part 42.
649. gbcon43.seq - Constructed sequence entries, part 43.
650. gbcon44.seq - Constructed sequence entries, part 44.
651. gbcon45.seq - Constructed sequence entries, part 45.
652. gbcon46.seq - Constructed sequence entries, part 46.
653. gbcon47.seq - Constructed sequence entries, part 47.
654. gbcon48.seq - Constructed sequence entries, part 48.
655. gbcon49.seq - Constructed sequence entries, part 49.
656. gbcon5.seq - Constructed sequence entries, part 5.
657. gbcon50.seq - Constructed sequence entries, part 50.
658. gbcon51.seq - Constructed sequence entries, part 51.
659. gbcon52.seq - Constructed sequence entries, part 52.
660. gbcon53.seq - Constructed sequence entries, part 53.
661. gbcon54.seq - Constructed sequence entries, part 54.
662. gbcon55.seq - Constructed sequence entries, part 55.
663. gbcon56.seq - Constructed sequence entries, part 56.
664. gbcon57.seq - Constructed sequence entries, part 57.
665. gbcon58.seq - Constructed sequence entries, part 58.
666. gbcon59.seq - Constructed sequence entries, part 59.
667. gbcon6.seq - Constructed sequence entries, part 6.
668. gbcon60.seq - Constructed sequence entries, part 60.
669. gbcon61.seq - Constructed sequence entries, part 61.
670. gbcon62.seq - Constructed sequence entries, part 62.
671. gbcon63.seq - Constructed sequence entries, part 63.
672. gbcon64.seq - Constructed sequence entries, part 64.
673. gbcon65.seq - Constructed sequence entries, part 65.
674. gbcon66.seq - Constructed sequence entries, part 66.
675. gbcon67.seq - Constructed sequence entries, part 67.
676. gbcon68.seq - Constructed sequence entries, part 68.
677. gbcon69.seq - Constructed sequence entries, part 69.
678. gbcon7.seq - Constructed sequence entries, part 7.
679. gbcon70.seq - Constructed sequence entries, part 70.
680. gbcon71.seq - Constructed sequence entries, part 71.
681. gbcon72.seq - Constructed sequence entries, part 72.
682. gbcon73.seq - Constructed sequence entries, part 73.
683. gbcon74.seq - Constructed sequence entries, part 74.
684. gbcon75.seq - Constructed sequence entries, part 75.
685. gbcon76.seq - Constructed sequence entries, part 76.
686. gbcon77.seq - Constructed sequence entries, part 77.
687. gbcon78.seq - Constructed sequence entries, part 78.
688. gbcon79.seq - Constructed sequence entries, part 79.
689. gbcon8.seq - Constructed sequence entries, part 8.
690. gbcon80.seq - Constructed sequence entries, part 80.
691. gbcon81.seq - Constructed sequence entries, part 81.
692. gbcon82.seq - Constructed sequence entries, part 82.
693. gbcon83.seq - Constructed sequence entries, part 83.
694. gbcon84.seq - Constructed sequence entries, part 84.
695. gbcon85.seq - Constructed sequence entries, part 85.
696. gbcon86.seq - Constructed sequence entries, part 86.
697. gbcon87.seq - Constructed sequence entries, part 87.
698. gbcon88.seq - Constructed sequence entries, part 88.
699. gbcon89.seq - Constructed sequence entries, part 89.
700. gbcon9.seq - Constructed sequence entries, part 9.
701. gbcon90.seq - Constructed sequence entries, part 90.
702. gbcon91.seq - Constructed sequence entries, part 91.
703. gbcon92.seq - Constructed sequence entries, part 92.
704. gbcon93.seq - Constructed sequence entries, part 93.
705. gbcon94.seq - Constructed sequence entries, part 94.
706. gbcon95.seq - Constructed sequence entries, part 95.
707. gbcon96.seq - Constructed sequence entries, part 96.
708. gbcon97.seq - Constructed sequence entries, part 97.
709. gbcon98.seq - Constructed sequence entries, part 98.
710. gbcon99.seq - Constructed sequence entries, part 99.
711. gbdel.txt - Accession numbers of entries deleted since the previous release.
712. gbenv1.seq - Environmental sampling sequence entries, part 1.
713. gbenv10.seq - Environmental sampling sequence entries, part 10.
714. gbenv11.seq - Environmental sampling sequence entries, part 11.
715. gbenv12.seq - Environmental sampling sequence entries, part 12.
716. gbenv13.seq - Environmental sampling sequence entries, part 13.
717. gbenv14.seq - Environmental sampling sequence entries, part 14.
718. gbenv15.seq - Environmental sampling sequence entries, part 15.
719. gbenv16.seq - Environmental sampling sequence entries, part 16.
720. gbenv17.seq - Environmental sampling sequence entries, part 17.
721. gbenv18.seq - Environmental sampling sequence entries, part 18.
722. gbenv19.seq - Environmental sampling sequence entries, part 19.
723. gbenv2.seq - Environmental sampling sequence entries, part 2.
724. gbenv20.seq - Environmental sampling sequence entries, part 20.
725. gbenv21.seq - Environmental sampling sequence entries, part 21.
726. gbenv22.seq - Environmental sampling sequence entries, part 22.
727. gbenv23.seq - Environmental sampling sequence entries, part 23.
728. gbenv24.seq - Environmental sampling sequence entries, part 24.
729. gbenv25.seq - Environmental sampling sequence entries, part 25.
730. gbenv26.seq - Environmental sampling sequence entries, part 26.
731. gbenv27.seq - Environmental sampling sequence entries, part 27.
732. gbenv28.seq - Environmental sampling sequence entries, part 28.
733. gbenv29.seq - Environmental sampling sequence entries, part 29.
734. gbenv3.seq - Environmental sampling sequence entries, part 3.
735. gbenv30.seq - Environmental sampling sequence entries, part 30.
736. gbenv31.seq - Environmental sampling sequence entries, part 31.
737. gbenv32.seq - Environmental sampling sequence entries, part 32.
738. gbenv33.seq - Environmental sampling sequence entries, part 33.
739. gbenv34.seq - Environmental sampling sequence entries, part 34.
740. gbenv35.seq - Environmental sampling sequence entries, part 35.
741. gbenv36.seq - Environmental sampling sequence entries, part 36.
742. gbenv37.seq - Environmental sampling sequence entries, part 37.
743. gbenv38.seq - Environmental sampling sequence entries, part 38.
744. gbenv39.seq - Environmental sampling sequence entries, part 39.
745. gbenv4.seq - Environmental sampling sequence entries, part 4.
746. gbenv40.seq - Environmental sampling sequence entries, part 40.
747. gbenv41.seq - Environmental sampling sequence entries, part 41.
748. gbenv42.seq - Environmental sampling sequence entries, part 42.
749. gbenv43.seq - Environmental sampling sequence entries, part 43.
750. gbenv44.seq - Environmental sampling sequence entries, part 44.
751. gbenv45.seq - Environmental sampling sequence entries, part 45.
752. gbenv46.seq - Environmental sampling sequence entries, part 46.
753. gbenv47.seq - Environmental sampling sequence entries, part 47.
754. gbenv48.seq - Environmental sampling sequence entries, part 48.
755. gbenv49.seq - Environmental sampling sequence entries, part 49.
756. gbenv5.seq - Environmental sampling sequence entries, part 5.
757. gbenv50.seq - Environmental sampling sequence entries, part 50.
758. gbenv51.seq - Environmental sampling sequence entries, part 51.
759. gbenv52.seq - Environmental sampling sequence entries, part 52.
760. gbenv53.seq - Environmental sampling sequence entries, part 53.
761. gbenv54.seq - Environmental sampling sequence entries, part 54.
762. gbenv55.seq - Environmental sampling sequence entries, part 55.
763. gbenv56.seq - Environmental sampling sequence entries, part 56.
764. gbenv57.seq - Environmental sampling sequence entries, part 57.
765. gbenv58.seq - Environmental sampling sequence entries, part 58.
766. gbenv59.seq - Environmental sampling sequence entries, part 59.
767. gbenv6.seq - Environmental sampling sequence entries, part 6.
768. gbenv60.seq - Environmental sampling sequence entries, part 60.
769. gbenv61.seq - Environmental sampling sequence entries, part 61.
770. gbenv62.seq - Environmental sampling sequence entries, part 62.
771. gbenv63.seq - Environmental sampling sequence entries, part 63.
772. gbenv64.seq - Environmental sampling sequence entries, part 64.
773. gbenv65.seq - Environmental sampling sequence entries, part 65.
774. gbenv66.seq - Environmental sampling sequence entries, part 66.
775. gbenv67.seq - Environmental sampling sequence entries, part 67.
776. gbenv68.seq - Environmental sampling sequence entries, part 68.
777. gbenv69.seq - Environmental sampling sequence entries, part 69.
778. gbenv7.seq - Environmental sampling sequence entries, part 7.
779. gbenv70.seq - Environmental sampling sequence entries, part 70.
780. gbenv71.seq - Environmental sampling sequence entries, part 71.
781. gbenv72.seq - Environmental sampling sequence entries, part 72.
782. gbenv73.seq - Environmental sampling sequence entries, part 73.
783. gbenv74.seq - Environmental sampling sequence entries, part 74.
784. gbenv75.seq - Environmental sampling sequence entries, part 75.
785. gbenv76.seq - Environmental sampling sequence entries, part 76.
786. gbenv77.seq - Environmental sampling sequence entries, part 77.
787. gbenv78.seq - Environmental sampling sequence entries, part 78.
788. gbenv79.seq - Environmental sampling sequence entries, part 79.
789. gbenv8.seq - Environmental sampling sequence entries, part 8.
790. gbenv80.seq - Environmental sampling sequence entries, part 80.
791. gbenv81.seq - Environmental sampling sequence entries, part 81.
792. gbenv82.seq - Environmental sampling sequence entries, part 82.
793. gbenv83.seq - Environmental sampling sequence entries, part 83.
794. gbenv84.seq - Environmental sampling sequence entries, part 84.
795. gbenv85.seq - Environmental sampling sequence entries, part 85.
796. gbenv86.seq - Environmental sampling sequence entries, part 86.
797. gbenv87.seq - Environmental sampling sequence entries, part 87.
798. gbenv88.seq - Environmental sampling sequence entries, part 88.
799. gbenv89.seq - Environmental sampling sequence entries, part 89.
800. gbenv9.seq - Environmental sampling sequence entries, part 9.
801. gbenv90.seq - Environmental sampling sequence entries, part 90.
802. gbenv91.seq - Environmental sampling sequence entries, part 91.
803. gbenv92.seq - Environmental sampling sequence entries, part 92.
804. gbenv93.seq - Environmental sampling sequence entries, part 93.
805. gbenv94.seq - Environmental sampling sequence entries, part 94.
806. gbenv95.seq - Environmental sampling sequence entries, part 95.
807. gbenv96.seq - Environmental sampling sequence entries, part 96.
808. gbenv97.seq - Environmental sampling sequence entries, part 97.
809. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
810. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
811. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
812. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
813. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
814. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
815. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
816. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
817. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
818. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
819. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
820. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
821. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
822. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
823. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
824. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
825. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
826. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
827. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
828. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
829. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
830. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
831. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
832. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
833. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
834. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
835. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
836. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
837. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
838. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
839. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
840. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
841. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
842. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
843. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
844. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
845. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
846. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
847. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
848. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
849. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
850. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
851. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
852. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
853. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
854. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
855. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
856. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
857. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
858. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
859. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
860. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
861. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
862. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
863. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
864. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
865. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
866. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
867. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
868. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
869. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
870. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
871. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
872. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
873. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
874. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
875. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
876. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
877. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
878. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
879. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
880. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
881. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
882. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
883. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
884. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
885. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
886. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
887. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
888. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
889. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
890. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
891. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
892. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
893. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
894. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
895. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
896. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
897. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
898. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
899. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
900. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
901. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
902. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
903. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
904. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
905. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
906. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
907. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
908. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
909. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
910. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
911. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
912. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
913. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
914. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
915. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
916. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
917. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
918. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
919. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
920. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
921. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
922. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
923. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
924. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
925. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
926. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
927. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
928. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
929. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
930. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
931. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
932. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
933. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
934. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
935. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
936. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
937. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
938. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
939. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
940. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
941. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
942. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
943. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
944. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
945. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
946. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
947. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
948. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
949. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
950. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
951. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
952. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
953. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
954. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
955. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
956. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
957. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
958. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
959. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
960. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
961. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
962. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
963. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
964. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
965. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
966. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
967. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
968. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
969. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
970. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
971. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
972. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
973. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
974. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
975. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
976. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
977. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
978. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
979. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
980. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
981. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
982. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
983. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
984. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
985. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
986. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
987. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
988. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
989. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
990. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
991. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
992. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
993. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
994. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
995. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
996. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
997. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
998. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
999. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1000. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1001. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1002. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1003. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1004. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1005. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1006. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1007. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1008. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1009. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1010. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1011. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1012. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1013. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1014. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1015. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1016. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1017. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1018. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1019. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1020. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1021. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1022. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1023. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1024. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1025. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1026. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1027. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1028. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1029. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1030. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1031. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1032. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1033. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1034. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1035. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1036. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1037. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1038. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1039. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1040. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1041. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1042. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1043. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1044. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1045. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1046. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1047. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1048. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1049. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1050. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1051. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1052. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1053. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1054. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1055. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1056. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1057. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1058. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1059. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1060. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1061. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1062. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1063. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1064. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1065. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1066. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1067. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1068. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1069. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1070. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1071. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1072. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1073. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1074. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1075. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1076. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1077. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1078. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1079. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1080. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1081. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1082. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1083. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1084. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1085. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1086. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1087. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1088. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1089. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1090. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1091. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1092. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1093. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1094. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1095. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1096. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1097. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1098. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1099. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1100. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1101. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1102. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1103. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1104. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1105. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1106. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1107. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1108. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1109. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1110. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1111. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1112. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1113. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1114. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1115. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1116. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1117. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1118. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1119. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1120. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1121. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1122. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1123. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1124. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1125. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1126. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1127. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1128. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1129. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1130. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1131. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1132. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1133. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1134. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1135. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1136. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1137. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1138. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1139. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1140. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1141. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1142. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1143. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1144. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1145. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1146. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1147. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1148. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1149. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1150. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1151. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1152. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1153. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1154. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1155. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1156. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1157. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1158. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1159. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1160. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1161. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1162. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1163. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1164. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1165. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1166. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1167. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1168. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1169. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1170. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1171. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1172. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1173. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1174. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1175. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1176. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1177. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1178. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1179. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1180. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1181. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1182. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1183. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1184. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1185. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1186. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1187. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1188. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1189. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1190. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1191. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1192. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1193. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1194. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1195. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1196. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1197. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1198. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1199. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1200. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1201. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1202. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1203. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1204. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1205. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1206. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1207. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1208. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1209. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1210. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1211. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1212. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1213. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1214. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1215. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1216. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1217. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1218. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1219. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1220. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1221. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1222. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1223. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1224. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1225. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1226. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1227. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1228. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1229. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1230. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1231. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1232. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1233. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1234. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1235. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1236. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1237. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1238. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1239. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1240. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1241. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1242. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1243. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1244. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1245. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1246. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1247. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1248. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1249. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1250. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1251. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1252. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1253. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1254. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1255. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1256. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1257. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1258. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1259. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1260. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1261. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1262. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1263. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1264. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1265. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1266. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1267. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1268. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1269. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1270. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1271. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1272. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1273. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1274. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1275. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1276. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1277. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1278. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1279. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1280. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1281. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1282. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1283. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1284. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1285. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1286. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1287. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1288. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1289. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1290. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1291. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1292. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1293. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1294. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1295. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1296. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1297. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1298. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1299. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1300. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1301. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1302. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1303. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1304. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1305. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1306. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1307. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1308. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1309. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1310. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1311. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1312. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1313. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1314. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1315. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1316. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1317. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1318. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1319. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1320. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1321. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1322. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1323. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1324. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1325. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1326. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1327. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1328. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1329. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1330. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1331. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1332. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1333. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1334. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1335. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1336. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1337. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1338. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1339. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1340. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1341. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1342. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1343. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1344. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1345. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1346. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1347. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1348. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1349. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1350. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1351. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1352. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1353. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1354. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1355. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1356. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1357. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1358. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1359. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1360. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1361. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1362. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1363. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1364. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1365. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1366. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1367. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1368. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1369. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1370. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1371. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1372. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1373. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1374. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1375. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1376. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1377. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1378. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1379. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1380. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1381. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1382. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1383. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1384. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1385. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1386. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1387. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1388. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1389. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1390. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1391. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1392. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1393. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1394. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1395. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1396. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1397. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1398. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1399. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1400. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1401. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1402. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1403. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1404. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1405. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1406. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1407. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1408. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1409. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1410. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1411. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1412. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1413. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1414. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1415. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1416. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1417. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1418. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1419. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1420. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1421. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1422. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1423. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1424. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1425. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1426. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1427. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1428. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1429. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1430. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1431. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1432. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1433. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1434. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1435. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1436. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1437. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1438. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1439. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1440. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1441. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1442. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1443. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1444. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1445. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1446. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1447. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1448. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1449. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1450. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1451. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1452. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1453. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1454. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1455. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1456. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1457. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1458. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1459. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1460. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1461. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1462. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1463. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1464. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1465. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1466. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1467. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1468. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1469. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1470. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1471. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1472. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1473. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1474. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1475. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1476. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1477. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1478. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1479. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1480. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1481. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1482. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1483. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1484. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1485. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1486. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1487. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1488. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1489. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1490. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1491. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1492. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1493. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1494. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1495. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1496. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1497. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1498. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1499. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1500. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1501. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1502. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1503. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1504. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1505. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1506. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1507. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1508. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1509. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1510. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1511. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1512. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1513. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1514. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1515. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1516. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1517. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1518. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1519. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1520. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1521. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1522. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1523. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1524. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1525. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1526. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1527. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1528. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1529. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1530. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1531. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1532. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1533. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1534. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1535. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1536. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1537. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1538. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1539. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1540. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1541. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1542. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1543. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1544. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1545. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1546. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1547. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1548. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1549. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1550. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1551. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1552. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1553. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1554. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1555. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1556. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1557. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1558. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1559. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1560. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1561. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1562. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1563. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1564. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1565. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1566. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1567. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1568. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1569. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1570. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1571. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1572. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1573. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1574. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1575. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1576. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1577. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1578. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1579. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1580. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1581. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1582. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1583. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1584. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1585. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1586. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1587. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1588. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1589. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1590. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1591. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1592. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1593. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1594. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1595. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1596. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1597. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1598. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1599. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1600. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1601. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1602. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1603. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1604. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1605. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1606. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1607. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1608. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1609. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1610. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1611. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1612. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1613. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1614. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1615. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1616. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1617. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1618. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1619. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1620. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1621. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1622. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1623. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1624. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1625. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1626. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1627. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1628. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1629. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1630. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1631. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1632. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1633. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1634. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1635. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1636. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1637. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1638. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1639. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1640. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1641. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1642. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1643. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1644. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1645. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1646. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1647. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1648. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1649. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1650. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1651. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1652. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1653. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1654. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1655. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1656. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1657. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1658. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1659. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1660. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1661. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1662. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1663. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1664. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1665. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1666. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1667. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1668. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1669. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1670. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1671. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1672. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1673. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1674. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1675. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1676. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1677. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1678. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1679. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1680. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1681. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1682. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1683. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1684. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1685. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1686. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1687. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1688. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1689. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1690. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1691. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1692. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1693. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1694. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1695. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1696. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1697. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1698. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1699. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1700. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1701. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1702. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1703. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1704. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1705. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1706. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1707. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1708. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1709. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1710. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1711. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1712. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1713. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1714. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1715. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1716. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1717. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1718. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1719. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1720. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1721. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1722. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1723. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1724. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1725. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1726. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1727. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1728. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1729. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1730. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1731. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1732. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1733. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1734. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1735. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1736. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1737. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1738. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1739. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1740. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1741. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1742. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1743. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1744. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1745. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1746. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1747. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1748. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1749. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1750. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1751. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1752. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1753. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1754. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1755. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1756. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1757. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1758. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1759. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1760. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1761. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1762. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1763. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1764. gbinv1.seq - Invertebrate sequence entries, part 1.
1765. gbinv10.seq - Invertebrate sequence entries, part 10.
1766. gbinv100.seq - Invertebrate sequence entries, part 100.
1767. gbinv101.seq - Invertebrate sequence entries, part 101.
1768. gbinv102.seq - Invertebrate sequence entries, part 102.
1769. gbinv103.seq - Invertebrate sequence entries, part 103.
1770. gbinv104.seq - Invertebrate sequence entries, part 104.
1771. gbinv105.seq - Invertebrate sequence entries, part 105.
1772. gbinv106.seq - Invertebrate sequence entries, part 106.
1773. gbinv107.seq - Invertebrate sequence entries, part 107.
1774. gbinv108.seq - Invertebrate sequence entries, part 108.
1775. gbinv109.seq - Invertebrate sequence entries, part 109.
1776. gbinv11.seq - Invertebrate sequence entries, part 11.
1777. gbinv110.seq - Invertebrate sequence entries, part 110.
1778. gbinv111.seq - Invertebrate sequence entries, part 111.
1779. gbinv112.seq - Invertebrate sequence entries, part 112.
1780. gbinv113.seq - Invertebrate sequence entries, part 113.
1781. gbinv114.seq - Invertebrate sequence entries, part 114.
1782. gbinv115.seq - Invertebrate sequence entries, part 115.
1783. gbinv116.seq - Invertebrate sequence entries, part 116.
1784. gbinv117.seq - Invertebrate sequence entries, part 117.
1785. gbinv118.seq - Invertebrate sequence entries, part 118.
1786. gbinv119.seq - Invertebrate sequence entries, part 119.
1787. gbinv12.seq - Invertebrate sequence entries, part 12.
1788. gbinv120.seq - Invertebrate sequence entries, part 120.
1789. gbinv121.seq - Invertebrate sequence entries, part 121.
1790. gbinv122.seq - Invertebrate sequence entries, part 122.
1791. gbinv123.seq - Invertebrate sequence entries, part 123.
1792. gbinv124.seq - Invertebrate sequence entries, part 124.
1793. gbinv125.seq - Invertebrate sequence entries, part 125.
1794. gbinv126.seq - Invertebrate sequence entries, part 126.
1795. gbinv127.seq - Invertebrate sequence entries, part 127.
1796. gbinv128.seq - Invertebrate sequence entries, part 128.
1797. gbinv129.seq - Invertebrate sequence entries, part 129.
1798. gbinv13.seq - Invertebrate sequence entries, part 13.
1799. gbinv130.seq - Invertebrate sequence entries, part 130.
1800. gbinv131.seq - Invertebrate sequence entries, part 131.
1801. gbinv132.seq - Invertebrate sequence entries, part 132.
1802. gbinv133.seq - Invertebrate sequence entries, part 133.
1803. gbinv134.seq - Invertebrate sequence entries, part 134.
1804. gbinv135.seq - Invertebrate sequence entries, part 135.
1805. gbinv136.seq - Invertebrate sequence entries, part 136.
1806. gbinv137.seq - Invertebrate sequence entries, part 137.
1807. gbinv138.seq - Invertebrate sequence entries, part 138.
1808. gbinv139.seq - Invertebrate sequence entries, part 139.
1809. gbinv14.seq - Invertebrate sequence entries, part 14.
1810. gbinv140.seq - Invertebrate sequence entries, part 140.
1811. gbinv141.seq - Invertebrate sequence entries, part 141.
1812. gbinv142.seq - Invertebrate sequence entries, part 142.
1813. gbinv143.seq - Invertebrate sequence entries, part 143.
1814. gbinv144.seq - Invertebrate sequence entries, part 144.
1815. gbinv145.seq - Invertebrate sequence entries, part 145.
1816. gbinv146.seq - Invertebrate sequence entries, part 146.
1817. gbinv147.seq - Invertebrate sequence entries, part 147.
1818. gbinv148.seq - Invertebrate sequence entries, part 148.
1819. gbinv149.seq - Invertebrate sequence entries, part 149.
1820. gbinv15.seq - Invertebrate sequence entries, part 15.
1821. gbinv150.seq - Invertebrate sequence entries, part 150.
1822. gbinv151.seq - Invertebrate sequence entries, part 151.
1823. gbinv152.seq - Invertebrate sequence entries, part 152.
1824. gbinv153.seq - Invertebrate sequence entries, part 153.
1825. gbinv16.seq - Invertebrate sequence entries, part 16.
1826. gbinv17.seq - Invertebrate sequence entries, part 17.
1827. gbinv18.seq - Invertebrate sequence entries, part 18.
1828. gbinv19.seq - Invertebrate sequence entries, part 19.
1829. gbinv2.seq - Invertebrate sequence entries, part 2.
1830. gbinv20.seq - Invertebrate sequence entries, part 20.
1831. gbinv21.seq - Invertebrate sequence entries, part 21.
1832. gbinv22.seq - Invertebrate sequence entries, part 22.
1833. gbinv23.seq - Invertebrate sequence entries, part 23.
1834. gbinv24.seq - Invertebrate sequence entries, part 24.
1835. gbinv25.seq - Invertebrate sequence entries, part 25.
1836. gbinv26.seq - Invertebrate sequence entries, part 26.
1837. gbinv27.seq - Invertebrate sequence entries, part 27.
1838. gbinv28.seq - Invertebrate sequence entries, part 28.
1839. gbinv29.seq - Invertebrate sequence entries, part 29.
1840. gbinv3.seq - Invertebrate sequence entries, part 3.
1841. gbinv30.seq - Invertebrate sequence entries, part 30.
1842. gbinv31.seq - Invertebrate sequence entries, part 31.
1843. gbinv32.seq - Invertebrate sequence entries, part 32.
1844. gbinv33.seq - Invertebrate sequence entries, part 33.
1845. gbinv34.seq - Invertebrate sequence entries, part 34.
1846. gbinv35.seq - Invertebrate sequence entries, part 35.
1847. gbinv36.seq - Invertebrate sequence entries, part 36.
1848. gbinv37.seq - Invertebrate sequence entries, part 37.
1849. gbinv38.seq - Invertebrate sequence entries, part 38.
1850. gbinv39.seq - Invertebrate sequence entries, part 39.
1851. gbinv4.seq - Invertebrate sequence entries, part 4.
1852. gbinv40.seq - Invertebrate sequence entries, part 40.
1853. gbinv41.seq - Invertebrate sequence entries, part 41.
1854. gbinv42.seq - Invertebrate sequence entries, part 42.
1855. gbinv43.seq - Invertebrate sequence entries, part 43.
1856. gbinv44.seq - Invertebrate sequence entries, part 44.
1857. gbinv45.seq - Invertebrate sequence entries, part 45.
1858. gbinv46.seq - Invertebrate sequence entries, part 46.
1859. gbinv47.seq - Invertebrate sequence entries, part 47.
1860. gbinv48.seq - Invertebrate sequence entries, part 48.
1861. gbinv49.seq - Invertebrate sequence entries, part 49.
1862. gbinv5.seq - Invertebrate sequence entries, part 5.
1863. gbinv50.seq - Invertebrate sequence entries, part 50.
1864. gbinv51.seq - Invertebrate sequence entries, part 51.
1865. gbinv52.seq - Invertebrate sequence entries, part 52.
1866. gbinv53.seq - Invertebrate sequence entries, part 53.
1867. gbinv54.seq - Invertebrate sequence entries, part 54.
1868. gbinv55.seq - Invertebrate sequence entries, part 55.
1869. gbinv56.seq - Invertebrate sequence entries, part 56.
1870. gbinv57.seq - Invertebrate sequence entries, part 57.
1871. gbinv58.seq - Invertebrate sequence entries, part 58.
1872. gbinv59.seq - Invertebrate sequence entries, part 59.
1873. gbinv6.seq - Invertebrate sequence entries, part 6.
1874. gbinv60.seq - Invertebrate sequence entries, part 60.
1875. gbinv61.seq - Invertebrate sequence entries, part 61.
1876. gbinv62.seq - Invertebrate sequence entries, part 62.
1877. gbinv63.seq - Invertebrate sequence entries, part 63.
1878. gbinv64.seq - Invertebrate sequence entries, part 64.
1879. gbinv65.seq - Invertebrate sequence entries, part 65.
1880. gbinv66.seq - Invertebrate sequence entries, part 66.
1881. gbinv67.seq - Invertebrate sequence entries, part 67.
1882. gbinv68.seq - Invertebrate sequence entries, part 68.
1883. gbinv69.seq - Invertebrate sequence entries, part 69.
1884. gbinv7.seq - Invertebrate sequence entries, part 7.
1885. gbinv70.seq - Invertebrate sequence entries, part 70.
1886. gbinv71.seq - Invertebrate sequence entries, part 71.
1887. gbinv72.seq - Invertebrate sequence entries, part 72.
1888. gbinv73.seq - Invertebrate sequence entries, part 73.
1889. gbinv74.seq - Invertebrate sequence entries, part 74.
1890. gbinv75.seq - Invertebrate sequence entries, part 75.
1891. gbinv76.seq - Invertebrate sequence entries, part 76.
1892. gbinv77.seq - Invertebrate sequence entries, part 77.
1893. gbinv78.seq - Invertebrate sequence entries, part 78.
1894. gbinv79.seq - Invertebrate sequence entries, part 79.
1895. gbinv8.seq - Invertebrate sequence entries, part 8.
1896. gbinv80.seq - Invertebrate sequence entries, part 80.
1897. gbinv81.seq - Invertebrate sequence entries, part 81.
1898. gbinv82.seq - Invertebrate sequence entries, part 82.
1899. gbinv83.seq - Invertebrate sequence entries, part 83.
1900. gbinv84.seq - Invertebrate sequence entries, part 84.
1901. gbinv85.seq - Invertebrate sequence entries, part 85.
1902. gbinv86.seq - Invertebrate sequence entries, part 86.
1903. gbinv87.seq - Invertebrate sequence entries, part 87.
1904. gbinv88.seq - Invertebrate sequence entries, part 88.
1905. gbinv89.seq - Invertebrate sequence entries, part 89.
1906. gbinv9.seq - Invertebrate sequence entries, part 9.
1907. gbinv90.seq - Invertebrate sequence entries, part 90.
1908. gbinv91.seq - Invertebrate sequence entries, part 91.
1909. gbinv92.seq - Invertebrate sequence entries, part 92.
1910. gbinv93.seq - Invertebrate sequence entries, part 93.
1911. gbinv94.seq - Invertebrate sequence entries, part 94.
1912. gbinv95.seq - Invertebrate sequence entries, part 95.
1913. gbinv96.seq - Invertebrate sequence entries, part 96.
1914. gbinv97.seq - Invertebrate sequence entries, part 97.
1915. gbinv98.seq - Invertebrate sequence entries, part 98.
1916. gbinv99.seq - Invertebrate sequence entries, part 99.
1917. gbmam1.seq - Other mammalian sequence entries, part 1.
1918. gbmam10.seq - Other mammalian sequence entries, part 10.
1919. gbmam11.seq - Other mammalian sequence entries, part 11.
1920. gbmam12.seq - Other mammalian sequence entries, part 12.
1921. gbmam13.seq - Other mammalian sequence entries, part 13.
1922. gbmam14.seq - Other mammalian sequence entries, part 14.
1923. gbmam15.seq - Other mammalian sequence entries, part 15.
1924. gbmam16.seq - Other mammalian sequence entries, part 16.
1925. gbmam17.seq - Other mammalian sequence entries, part 17.
1926. gbmam18.seq - Other mammalian sequence entries, part 18.
1927. gbmam19.seq - Other mammalian sequence entries, part 19.
1928. gbmam2.seq - Other mammalian sequence entries, part 2.
1929. gbmam20.seq - Other mammalian sequence entries, part 20.
1930. gbmam21.seq - Other mammalian sequence entries, part 21.
1931. gbmam22.seq - Other mammalian sequence entries, part 22.
1932. gbmam23.seq - Other mammalian sequence entries, part 23.
1933. gbmam24.seq - Other mammalian sequence entries, part 24.
1934. gbmam25.seq - Other mammalian sequence entries, part 25.
1935. gbmam26.seq - Other mammalian sequence entries, part 26.
1936. gbmam27.seq - Other mammalian sequence entries, part 27.
1937. gbmam28.seq - Other mammalian sequence entries, part 28.
1938. gbmam29.seq - Other mammalian sequence entries, part 29.
1939. gbmam3.seq - Other mammalian sequence entries, part 3.
1940. gbmam30.seq - Other mammalian sequence entries, part 30.
1941. gbmam31.seq - Other mammalian sequence entries, part 31.
1942. gbmam32.seq - Other mammalian sequence entries, part 32.
1943. gbmam33.seq - Other mammalian sequence entries, part 33.
1944. gbmam34.seq - Other mammalian sequence entries, part 34.
1945. gbmam35.seq - Other mammalian sequence entries, part 35.
1946. gbmam36.seq - Other mammalian sequence entries, part 36.
1947. gbmam37.seq - Other mammalian sequence entries, part 37.
1948. gbmam38.seq - Other mammalian sequence entries, part 38.
1949. gbmam39.seq - Other mammalian sequence entries, part 39.
1950. gbmam4.seq - Other mammalian sequence entries, part 4.
1951. gbmam5.seq - Other mammalian sequence entries, part 5.
1952. gbmam6.seq - Other mammalian sequence entries, part 6.
1953. gbmam7.seq - Other mammalian sequence entries, part 7.
1954. gbmam8.seq - Other mammalian sequence entries, part 8.
1955. gbmam9.seq - Other mammalian sequence entries, part 9.
1956. gbnew.txt - Accession numbers of entries new since the previous release.
1957. gbpat1.seq - Patent sequence entries, part 1.
1958. gbpat10.seq - Patent sequence entries, part 10.
1959. gbpat100.seq - Patent sequence entries, part 100.
1960. gbpat101.seq - Patent sequence entries, part 101.
1961. gbpat102.seq - Patent sequence entries, part 102.
1962. gbpat103.seq - Patent sequence entries, part 103.
1963. gbpat104.seq - Patent sequence entries, part 104.
1964. gbpat105.seq - Patent sequence entries, part 105.
1965. gbpat106.seq - Patent sequence entries, part 106.
1966. gbpat107.seq - Patent sequence entries, part 107.
1967. gbpat108.seq - Patent sequence entries, part 108.
1968. gbpat109.seq - Patent sequence entries, part 109.
1969. gbpat11.seq - Patent sequence entries, part 11.
1970. gbpat110.seq - Patent sequence entries, part 110.
1971. gbpat111.seq - Patent sequence entries, part 111.
1972. gbpat112.seq - Patent sequence entries, part 112.
1973. gbpat113.seq - Patent sequence entries, part 113.
1974. gbpat114.seq - Patent sequence entries, part 114.
1975. gbpat115.seq - Patent sequence entries, part 115.
1976. gbpat116.seq - Patent sequence entries, part 116.
1977. gbpat117.seq - Patent sequence entries, part 117.
1978. gbpat118.seq - Patent sequence entries, part 118.
1979. gbpat119.seq - Patent sequence entries, part 119.
1980. gbpat12.seq - Patent sequence entries, part 12.
1981. gbpat120.seq - Patent sequence entries, part 120.
1982. gbpat121.seq - Patent sequence entries, part 121.
1983. gbpat122.seq - Patent sequence entries, part 122.
1984. gbpat123.seq - Patent sequence entries, part 123.
1985. gbpat124.seq - Patent sequence entries, part 124.
1986. gbpat125.seq - Patent sequence entries, part 125.
1987. gbpat126.seq - Patent sequence entries, part 126.
1988. gbpat127.seq - Patent sequence entries, part 127.
1989. gbpat128.seq - Patent sequence entries, part 128.
1990. gbpat129.seq - Patent sequence entries, part 129.
1991. gbpat13.seq - Patent sequence entries, part 13.
1992. gbpat130.seq - Patent sequence entries, part 130.
1993. gbpat131.seq - Patent sequence entries, part 131.
1994. gbpat132.seq - Patent sequence entries, part 132.
1995. gbpat133.seq - Patent sequence entries, part 133.
1996. gbpat134.seq - Patent sequence entries, part 134.
1997. gbpat135.seq - Patent sequence entries, part 135.
1998. gbpat136.seq - Patent sequence entries, part 136.
1999. gbpat137.seq - Patent sequence entries, part 137.
2000. gbpat138.seq - Patent sequence entries, part 138.
2001. gbpat139.seq - Patent sequence entries, part 139.
2002. gbpat14.seq - Patent sequence entries, part 14.
2003. gbpat140.seq - Patent sequence entries, part 140.
2004. gbpat141.seq - Patent sequence entries, part 141.
2005. gbpat142.seq - Patent sequence entries, part 142.
2006. gbpat143.seq - Patent sequence entries, part 143.
2007. gbpat144.seq - Patent sequence entries, part 144.
2008. gbpat145.seq - Patent sequence entries, part 145.
2009. gbpat146.seq - Patent sequence entries, part 146.
2010. gbpat147.seq - Patent sequence entries, part 147.
2011. gbpat148.seq - Patent sequence entries, part 148.
2012. gbpat149.seq - Patent sequence entries, part 149.
2013. gbpat15.seq - Patent sequence entries, part 15.
2014. gbpat150.seq - Patent sequence entries, part 150.
2015. gbpat151.seq - Patent sequence entries, part 151.
2016. gbpat152.seq - Patent sequence entries, part 152.
2017. gbpat153.seq - Patent sequence entries, part 153.
2018. gbpat154.seq - Patent sequence entries, part 154.
2019. gbpat155.seq - Patent sequence entries, part 155.
2020. gbpat156.seq - Patent sequence entries, part 156.
2021. gbpat157.seq - Patent sequence entries, part 157.
2022. gbpat158.seq - Patent sequence entries, part 158.
2023. gbpat159.seq - Patent sequence entries, part 159.
2024. gbpat16.seq - Patent sequence entries, part 16.
2025. gbpat160.seq - Patent sequence entries, part 160.
2026. gbpat161.seq - Patent sequence entries, part 161.
2027. gbpat162.seq - Patent sequence entries, part 162.
2028. gbpat163.seq - Patent sequence entries, part 163.
2029. gbpat164.seq - Patent sequence entries, part 164.
2030. gbpat165.seq - Patent sequence entries, part 165.
2031. gbpat166.seq - Patent sequence entries, part 166.
2032. gbpat167.seq - Patent sequence entries, part 167.
2033. gbpat168.seq - Patent sequence entries, part 168.
2034. gbpat169.seq - Patent sequence entries, part 169.
2035. gbpat17.seq - Patent sequence entries, part 17.
2036. gbpat170.seq - Patent sequence entries, part 170.
2037. gbpat171.seq - Patent sequence entries, part 171.
2038. gbpat172.seq - Patent sequence entries, part 172.
2039. gbpat173.seq - Patent sequence entries, part 173.
2040. gbpat174.seq - Patent sequence entries, part 174.
2041. gbpat175.seq - Patent sequence entries, part 175.
2042. gbpat176.seq - Patent sequence entries, part 176.
2043. gbpat177.seq - Patent sequence entries, part 177.
2044. gbpat178.seq - Patent sequence entries, part 178.
2045. gbpat179.seq - Patent sequence entries, part 179.
2046. gbpat18.seq - Patent sequence entries, part 18.
2047. gbpat180.seq - Patent sequence entries, part 180.
2048. gbpat181.seq - Patent sequence entries, part 181.
2049. gbpat182.seq - Patent sequence entries, part 182.
2050. gbpat183.seq - Patent sequence entries, part 183.
2051. gbpat184.seq - Patent sequence entries, part 184.
2052. gbpat185.seq - Patent sequence entries, part 185.
2053. gbpat186.seq - Patent sequence entries, part 186.
2054. gbpat187.seq - Patent sequence entries, part 187.
2055. gbpat188.seq - Patent sequence entries, part 188.
2056. gbpat189.seq - Patent sequence entries, part 189.
2057. gbpat19.seq - Patent sequence entries, part 19.
2058. gbpat190.seq - Patent sequence entries, part 190.
2059. gbpat191.seq - Patent sequence entries, part 191.
2060. gbpat192.seq - Patent sequence entries, part 192.
2061. gbpat193.seq - Patent sequence entries, part 193.
2062. gbpat194.seq - Patent sequence entries, part 194.
2063. gbpat195.seq - Patent sequence entries, part 195.
2064. gbpat196.seq - Patent sequence entries, part 196.
2065. gbpat197.seq - Patent sequence entries, part 197.
2066. gbpat198.seq - Patent sequence entries, part 198.
2067. gbpat199.seq - Patent sequence entries, part 199.
2068. gbpat2.seq - Patent sequence entries, part 2.
2069. gbpat20.seq - Patent sequence entries, part 20.
2070. gbpat200.seq - Patent sequence entries, part 200.
2071. gbpat201.seq - Patent sequence entries, part 201.
2072. gbpat202.seq - Patent sequence entries, part 202.
2073. gbpat203.seq - Patent sequence entries, part 203.
2074. gbpat204.seq - Patent sequence entries, part 204.
2075. gbpat205.seq - Patent sequence entries, part 205.
2076. gbpat206.seq - Patent sequence entries, part 206.
2077. gbpat207.seq - Patent sequence entries, part 207.
2078. gbpat208.seq - Patent sequence entries, part 208.
2079. gbpat209.seq - Patent sequence entries, part 209.
2080. gbpat21.seq - Patent sequence entries, part 21.
2081. gbpat210.seq - Patent sequence entries, part 210.
2082. gbpat211.seq - Patent sequence entries, part 211.
2083. gbpat212.seq - Patent sequence entries, part 212.
2084. gbpat213.seq - Patent sequence entries, part 213.
2085. gbpat214.seq - Patent sequence entries, part 214.
2086. gbpat215.seq - Patent sequence entries, part 215.
2087. gbpat216.seq - Patent sequence entries, part 216.
2088. gbpat217.seq - Patent sequence entries, part 217.
2089. gbpat218.seq - Patent sequence entries, part 218.
2090. gbpat219.seq - Patent sequence entries, part 219.
2091. gbpat22.seq - Patent sequence entries, part 22.
2092. gbpat220.seq - Patent sequence entries, part 220.
2093. gbpat221.seq - Patent sequence entries, part 221.
2094. gbpat222.seq - Patent sequence entries, part 222.
2095. gbpat223.seq - Patent sequence entries, part 223.
2096. gbpat224.seq - Patent sequence entries, part 224.
2097. gbpat225.seq - Patent sequence entries, part 225.
2098. gbpat226.seq - Patent sequence entries, part 226.
2099. gbpat227.seq - Patent sequence entries, part 227.
2100. gbpat228.seq - Patent sequence entries, part 228.
2101. gbpat229.seq - Patent sequence entries, part 229.
2102. gbpat23.seq - Patent sequence entries, part 23.
2103. gbpat230.seq - Patent sequence entries, part 230.
2104. gbpat231.seq - Patent sequence entries, part 231.
2105. gbpat232.seq - Patent sequence entries, part 232.
2106. gbpat233.seq - Patent sequence entries, part 233.
2107. gbpat234.seq - Patent sequence entries, part 234.
2108. gbpat235.seq - Patent sequence entries, part 235.
2109. gbpat236.seq - Patent sequence entries, part 236.
2110. gbpat237.seq - Patent sequence entries, part 237.
2111. gbpat238.seq - Patent sequence entries, part 238.
2112. gbpat239.seq - Patent sequence entries, part 239.
2113. gbpat24.seq - Patent sequence entries, part 24.
2114. gbpat240.seq - Patent sequence entries, part 240.
2115. gbpat241.seq - Patent sequence entries, part 241.
2116. gbpat242.seq - Patent sequence entries, part 242.
2117. gbpat243.seq - Patent sequence entries, part 243.
2118. gbpat244.seq - Patent sequence entries, part 244.
2119. gbpat245.seq - Patent sequence entries, part 245.
2120. gbpat246.seq - Patent sequence entries, part 246.
2121. gbpat247.seq - Patent sequence entries, part 247.
2122. gbpat248.seq - Patent sequence entries, part 248.
2123. gbpat249.seq - Patent sequence entries, part 249.
2124. gbpat25.seq - Patent sequence entries, part 25.
2125. gbpat250.seq - Patent sequence entries, part 250.
2126. gbpat251.seq - Patent sequence entries, part 251.
2127. gbpat252.seq - Patent sequence entries, part 252.
2128. gbpat253.seq - Patent sequence entries, part 253.
2129. gbpat254.seq - Patent sequence entries, part 254.
2130. gbpat255.seq - Patent sequence entries, part 255.
2131. gbpat256.seq - Patent sequence entries, part 256.
2132. gbpat257.seq - Patent sequence entries, part 257.
2133. gbpat258.seq - Patent sequence entries, part 258.
2134. gbpat259.seq - Patent sequence entries, part 259.
2135. gbpat26.seq - Patent sequence entries, part 26.
2136. gbpat260.seq - Patent sequence entries, part 260.
2137. gbpat261.seq - Patent sequence entries, part 261.
2138. gbpat262.seq - Patent sequence entries, part 262.
2139. gbpat263.seq - Patent sequence entries, part 263.
2140. gbpat264.seq - Patent sequence entries, part 264.
2141. gbpat265.seq - Patent sequence entries, part 265.
2142. gbpat266.seq - Patent sequence entries, part 266.
2143. gbpat267.seq - Patent sequence entries, part 267.
2144. gbpat268.seq - Patent sequence entries, part 268.
2145. gbpat269.seq - Patent sequence entries, part 269.
2146. gbpat27.seq - Patent sequence entries, part 27.
2147. gbpat270.seq - Patent sequence entries, part 270.
2148. gbpat271.seq - Patent sequence entries, part 271.
2149. gbpat272.seq - Patent sequence entries, part 272.
2150. gbpat273.seq - Patent sequence entries, part 273.
2151. gbpat274.seq - Patent sequence entries, part 274.
2152. gbpat275.seq - Patent sequence entries, part 275.
2153. gbpat276.seq - Patent sequence entries, part 276.
2154. gbpat277.seq - Patent sequence entries, part 277.
2155. gbpat278.seq - Patent sequence entries, part 278.
2156. gbpat279.seq - Patent sequence entries, part 279.
2157. gbpat28.seq - Patent sequence entries, part 28.
2158. gbpat280.seq - Patent sequence entries, part 280.
2159. gbpat281.seq - Patent sequence entries, part 281.
2160. gbpat282.seq - Patent sequence entries, part 282.
2161. gbpat283.seq - Patent sequence entries, part 283.
2162. gbpat284.seq - Patent sequence entries, part 284.
2163. gbpat285.seq - Patent sequence entries, part 285.
2164. gbpat286.seq - Patent sequence entries, part 286.
2165. gbpat287.seq - Patent sequence entries, part 287.
2166. gbpat288.seq - Patent sequence entries, part 288.
2167. gbpat289.seq - Patent sequence entries, part 289.
2168. gbpat29.seq - Patent sequence entries, part 29.
2169. gbpat290.seq - Patent sequence entries, part 290.
2170. gbpat3.seq - Patent sequence entries, part 3.
2171. gbpat30.seq - Patent sequence entries, part 30.
2172. gbpat31.seq - Patent sequence entries, part 31.
2173. gbpat32.seq - Patent sequence entries, part 32.
2174. gbpat33.seq - Patent sequence entries, part 33.
2175. gbpat34.seq - Patent sequence entries, part 34.
2176. gbpat35.seq - Patent sequence entries, part 35.
2177. gbpat36.seq - Patent sequence entries, part 36.
2178. gbpat37.seq - Patent sequence entries, part 37.
2179. gbpat38.seq - Patent sequence entries, part 38.
2180. gbpat39.seq - Patent sequence entries, part 39.
2181. gbpat4.seq - Patent sequence entries, part 4.
2182. gbpat40.seq - Patent sequence entries, part 40.
2183. gbpat41.seq - Patent sequence entries, part 41.
2184. gbpat42.seq - Patent sequence entries, part 42.
2185. gbpat43.seq - Patent sequence entries, part 43.
2186. gbpat44.seq - Patent sequence entries, part 44.
2187. gbpat45.seq - Patent sequence entries, part 45.
2188. gbpat46.seq - Patent sequence entries, part 46.
2189. gbpat47.seq - Patent sequence entries, part 47.
2190. gbpat48.seq - Patent sequence entries, part 48.
2191. gbpat49.seq - Patent sequence entries, part 49.
2192. gbpat5.seq - Patent sequence entries, part 5.
2193. gbpat50.seq - Patent sequence entries, part 50.
2194. gbpat51.seq - Patent sequence entries, part 51.
2195. gbpat52.seq - Patent sequence entries, part 52.
2196. gbpat53.seq - Patent sequence entries, part 53.
2197. gbpat54.seq - Patent sequence entries, part 54.
2198. gbpat55.seq - Patent sequence entries, part 55.
2199. gbpat56.seq - Patent sequence entries, part 56.
2200. gbpat57.seq - Patent sequence entries, part 57.
2201. gbpat58.seq - Patent sequence entries, part 58.
2202. gbpat59.seq - Patent sequence entries, part 59.
2203. gbpat6.seq - Patent sequence entries, part 6.
2204. gbpat60.seq - Patent sequence entries, part 60.
2205. gbpat61.seq - Patent sequence entries, part 61.
2206. gbpat62.seq - Patent sequence entries, part 62.
2207. gbpat63.seq - Patent sequence entries, part 63.
2208. gbpat64.seq - Patent sequence entries, part 64.
2209. gbpat65.seq - Patent sequence entries, part 65.
2210. gbpat66.seq - Patent sequence entries, part 66.
2211. gbpat67.seq - Patent sequence entries, part 67.
2212. gbpat68.seq - Patent sequence entries, part 68.
2213. gbpat69.seq - Patent sequence entries, part 69.
2214. gbpat7.seq - Patent sequence entries, part 7.
2215. gbpat70.seq - Patent sequence entries, part 70.
2216. gbpat71.seq - Patent sequence entries, part 71.
2217. gbpat72.seq - Patent sequence entries, part 72.
2218. gbpat73.seq - Patent sequence entries, part 73.
2219. gbpat74.seq - Patent sequence entries, part 74.
2220. gbpat75.seq - Patent sequence entries, part 75.
2221. gbpat76.seq - Patent sequence entries, part 76.
2222. gbpat77.seq - Patent sequence entries, part 77.
2223. gbpat78.seq - Patent sequence entries, part 78.
2224. gbpat79.seq - Patent sequence entries, part 79.
2225. gbpat8.seq - Patent sequence entries, part 8.
2226. gbpat80.seq - Patent sequence entries, part 80.
2227. gbpat81.seq - Patent sequence entries, part 81.
2228. gbpat82.seq - Patent sequence entries, part 82.
2229. gbpat83.seq - Patent sequence entries, part 83.
2230. gbpat84.seq - Patent sequence entries, part 84.
2231. gbpat85.seq - Patent sequence entries, part 85.
2232. gbpat86.seq - Patent sequence entries, part 86.
2233. gbpat87.seq - Patent sequence entries, part 87.
2234. gbpat88.seq - Patent sequence entries, part 88.
2235. gbpat89.seq - Patent sequence entries, part 89.
2236. gbpat9.seq - Patent sequence entries, part 9.
2237. gbpat90.seq - Patent sequence entries, part 90.
2238. gbpat91.seq - Patent sequence entries, part 91.
2239. gbpat92.seq - Patent sequence entries, part 92.
2240. gbpat93.seq - Patent sequence entries, part 93.
2241. gbpat94.seq - Patent sequence entries, part 94.
2242. gbpat95.seq - Patent sequence entries, part 95.
2243. gbpat96.seq - Patent sequence entries, part 96.
2244. gbpat97.seq - Patent sequence entries, part 97.
2245. gbpat98.seq - Patent sequence entries, part 98.
2246. gbpat99.seq - Patent sequence entries, part 99.
2247. gbphg1.seq - Phage sequence entries, part 1.
2248. gbphg2.seq - Phage sequence entries, part 2.
2249. gbphg3.seq - Phage sequence entries, part 3.
2250. gbphg4.seq - Phage sequence entries, part 4.
2251. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2252. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2253. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2254. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2255. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2256. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2257. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2258. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2259. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2260. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2261. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2262. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2263. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2264. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2265. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2266. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2267. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2268. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2269. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2270. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2271. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2272. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2273. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2274. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2275. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2276. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2277. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2278. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2279. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2280. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2281. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2282. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2283. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2284. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2285. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2286. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2287. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2288. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2289. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2290. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2291. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2292. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2293. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2294. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2295. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2296. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2297. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2298. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2299. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2300. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2301. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2302. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2303. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2304. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2305. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2306. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2307. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2308. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2309. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2310. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2311. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2312. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2313. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2314. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2315. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2316. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2317. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2318. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2319. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2320. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2321. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2322. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2323. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2324. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2325. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2326. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2327. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2328. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2329. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2330. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2331. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2332. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2333. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2334. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2335. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2336. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2337. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2338. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2339. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2340. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2341. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2342. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2343. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2344. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2345. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2346. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2347. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2348. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2349. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2350. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2351. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2352. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2353. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2354. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2355. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2356. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2357. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2358. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2359. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2360. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2361. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2362. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2363. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2364. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2365. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2366. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2367. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2368. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2369. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2370. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2371. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2372. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2373. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2374. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2375. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2376. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2377. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2378. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2379. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2380. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2381. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2382. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2383. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2384. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2385. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2386. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2387. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2388. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2389. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2390. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2391. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2392. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2393. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2394. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2395. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2396. gbpri1.seq - Primate sequence entries, part 1.
2397. gbpri10.seq - Primate sequence entries, part 10.
2398. gbpri11.seq - Primate sequence entries, part 11.
2399. gbpri12.seq - Primate sequence entries, part 12.
2400. gbpri13.seq - Primate sequence entries, part 13.
2401. gbpri14.seq - Primate sequence entries, part 14.
2402. gbpri15.seq - Primate sequence entries, part 15.
2403. gbpri16.seq - Primate sequence entries, part 16.
2404. gbpri17.seq - Primate sequence entries, part 17.
2405. gbpri18.seq - Primate sequence entries, part 18.
2406. gbpri19.seq - Primate sequence entries, part 19.
2407. gbpri2.seq - Primate sequence entries, part 2.
2408. gbpri20.seq - Primate sequence entries, part 20.
2409. gbpri21.seq - Primate sequence entries, part 21.
2410. gbpri22.seq - Primate sequence entries, part 22.
2411. gbpri23.seq - Primate sequence entries, part 23.
2412. gbpri24.seq - Primate sequence entries, part 24.
2413. gbpri25.seq - Primate sequence entries, part 25.
2414. gbpri26.seq - Primate sequence entries, part 26.
2415. gbpri27.seq - Primate sequence entries, part 27.
2416. gbpri28.seq - Primate sequence entries, part 28.
2417. gbpri29.seq - Primate sequence entries, part 29.
2418. gbpri3.seq - Primate sequence entries, part 3.
2419. gbpri30.seq - Primate sequence entries, part 30.
2420. gbpri31.seq - Primate sequence entries, part 31.
2421. gbpri32.seq - Primate sequence entries, part 32.
2422. gbpri33.seq - Primate sequence entries, part 33.
2423. gbpri34.seq - Primate sequence entries, part 34.
2424. gbpri35.seq - Primate sequence entries, part 35.
2425. gbpri36.seq - Primate sequence entries, part 36.
2426. gbpri37.seq - Primate sequence entries, part 37.
2427. gbpri38.seq - Primate sequence entries, part 38.
2428. gbpri39.seq - Primate sequence entries, part 39.
2429. gbpri4.seq - Primate sequence entries, part 4.
2430. gbpri40.seq - Primate sequence entries, part 40.
2431. gbpri41.seq - Primate sequence entries, part 41.
2432. gbpri42.seq - Primate sequence entries, part 42.
2433. gbpri43.seq - Primate sequence entries, part 43.
2434. gbpri44.seq - Primate sequence entries, part 44.
2435. gbpri45.seq - Primate sequence entries, part 45.
2436. gbpri46.seq - Primate sequence entries, part 46.
2437. gbpri47.seq - Primate sequence entries, part 47.
2438. gbpri48.seq - Primate sequence entries, part 48.
2439. gbpri49.seq - Primate sequence entries, part 49.
2440. gbpri5.seq - Primate sequence entries, part 5.
2441. gbpri50.seq - Primate sequence entries, part 50.
2442. gbpri51.seq - Primate sequence entries, part 51.
2443. gbpri52.seq - Primate sequence entries, part 52.
2444. gbpri53.seq - Primate sequence entries, part 53.
2445. gbpri54.seq - Primate sequence entries, part 54.
2446. gbpri55.seq - Primate sequence entries, part 55.
2447. gbpri56.seq - Primate sequence entries, part 56.
2448. gbpri6.seq - Primate sequence entries, part 6.
2449. gbpri7.seq - Primate sequence entries, part 7.
2450. gbpri8.seq - Primate sequence entries, part 8.
2451. gbpri9.seq - Primate sequence entries, part 9.
2452. gbrel.txt - Release notes (this document).
2453. gbrod1.seq - Rodent sequence entries, part 1.
2454. gbrod10.seq - Rodent sequence entries, part 10.
2455. gbrod11.seq - Rodent sequence entries, part 11.
2456. gbrod12.seq - Rodent sequence entries, part 12.
2457. gbrod13.seq - Rodent sequence entries, part 13.
2458. gbrod14.seq - Rodent sequence entries, part 14.
2459. gbrod15.seq - Rodent sequence entries, part 15.
2460. gbrod16.seq - Rodent sequence entries, part 16.
2461. gbrod17.seq - Rodent sequence entries, part 17.
2462. gbrod18.seq - Rodent sequence entries, part 18.
2463. gbrod19.seq - Rodent sequence entries, part 19.
2464. gbrod2.seq - Rodent sequence entries, part 2.
2465. gbrod20.seq - Rodent sequence entries, part 20.
2466. gbrod21.seq - Rodent sequence entries, part 21.
2467. gbrod22.seq - Rodent sequence entries, part 22.
2468. gbrod23.seq - Rodent sequence entries, part 23.
2469. gbrod24.seq - Rodent sequence entries, part 24.
2470. gbrod25.seq - Rodent sequence entries, part 25.
2471. gbrod26.seq - Rodent sequence entries, part 26.
2472. gbrod27.seq - Rodent sequence entries, part 27.
2473. gbrod28.seq - Rodent sequence entries, part 28.
2474. gbrod29.seq - Rodent sequence entries, part 29.
2475. gbrod3.seq - Rodent sequence entries, part 3.
2476. gbrod30.seq - Rodent sequence entries, part 30.
2477. gbrod4.seq - Rodent sequence entries, part 4.
2478. gbrod5.seq - Rodent sequence entries, part 5.
2479. gbrod6.seq - Rodent sequence entries, part 6.
2480. gbrod7.seq - Rodent sequence entries, part 7.
2481. gbrod8.seq - Rodent sequence entries, part 8.
2482. gbrod9.seq - Rodent sequence entries, part 9.
2483. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2484. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2485. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2486. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2487. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2488. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2489. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2490. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2491. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2492. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2493. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2494. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2495. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2496. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2497. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2498. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2499. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2500. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2501. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2502. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2503. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2504. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2505. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2506. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2507. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2508. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2509. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2510. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2511. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2512. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2513. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2514. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2515. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2516. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2517. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2518. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2519. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2520. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2521. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2522. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2523. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2524. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2525. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2526. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2527. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2528. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2529. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2530. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2531. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2532. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2533. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2534. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2535. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2536. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2537. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2538. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2539. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2540. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2541. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2542. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2543. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2544. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2545. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2546. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2547. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2548. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2549. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2550. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2551. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2552. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2553. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2554. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2555. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2556. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2557. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2558. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2559. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2560. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2561. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2562. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2563. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2564. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2565. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2566. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2567. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2568. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2569. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2570. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2571. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2572. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2573. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2574. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2575. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2576. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2577. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2578. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2579. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2580. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2581. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2582. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2583. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2584. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2585. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2586. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2587. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2588. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2589. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2590. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2591. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2592. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2593. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2594. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2595. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2596. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2597. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2598. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2599. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2600. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2601. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2602. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2603. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2604. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2605. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2606. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2607. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2608. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2609. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2610. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2611. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2612. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2613. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2614. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2615. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2616. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2617. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2618. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2619. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2620. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2621. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2622. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2623. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2624. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2625. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2626. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2627. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2628. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2629. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2630. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2631. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2632. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2633. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2634. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2635. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2636. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2637. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2638. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2639. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2640. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2641. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2642. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2643. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2644. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2645. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2646. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2647. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2648. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2649. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2650. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2651. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2652. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2653. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2654. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2655. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2656. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2657. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2658. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2659. gbtsa230.seq - TSA (transcriptome shotgun assembly) sequence entries, part 230.
2660. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2661. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2662. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2663. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2664. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2665. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2666. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2667. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2668. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2669. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2670. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2671. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2672. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2673. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2674. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2675. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2676. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2677. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2678. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2679. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2680. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2681. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2682. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2683. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2684. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2685. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2686. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2687. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2688. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2689. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2690. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2691. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2692. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2693. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2694. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2695. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2696. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2697. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2698. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2699. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2700. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2701. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2702. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2703. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2704. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2705. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2706. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2707. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2708. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2709. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2710. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2711. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2712. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2713. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2714. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2715. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2716. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2717. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2718. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2719. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2720. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2721. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2722. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2723. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2724. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2725. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2726. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2727. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2728. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2729. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2730. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2731. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2732. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2733. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2734. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2735. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2736. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2737. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2738. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2739. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2740. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2741. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2742. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2743. gbuna1.seq - Unannotated sequence entries, part 1.
2744. gbvrl1.seq - Viral sequence entries, part 1.
2745. gbvrl10.seq - Viral sequence entries, part 10.
2746. gbvrl11.seq - Viral sequence entries, part 11.
2747. gbvrl12.seq - Viral sequence entries, part 12.
2748. gbvrl13.seq - Viral sequence entries, part 13.
2749. gbvrl14.seq - Viral sequence entries, part 14.
2750. gbvrl15.seq - Viral sequence entries, part 15.
2751. gbvrl16.seq - Viral sequence entries, part 16.
2752. gbvrl17.seq - Viral sequence entries, part 17.
2753. gbvrl18.seq - Viral sequence entries, part 18.
2754. gbvrl19.seq - Viral sequence entries, part 19.
2755. gbvrl2.seq - Viral sequence entries, part 2.
2756. gbvrl20.seq - Viral sequence entries, part 20.
2757. gbvrl21.seq - Viral sequence entries, part 21.
2758. gbvrl22.seq - Viral sequence entries, part 22.
2759. gbvrl23.seq - Viral sequence entries, part 23.
2760. gbvrl24.seq - Viral sequence entries, part 24.
2761. gbvrl25.seq - Viral sequence entries, part 25.
2762. gbvrl26.seq - Viral sequence entries, part 26.
2763. gbvrl27.seq - Viral sequence entries, part 27.
2764. gbvrl28.seq - Viral sequence entries, part 28.
2765. gbvrl29.seq - Viral sequence entries, part 29.
2766. gbvrl3.seq - Viral sequence entries, part 3.
2767. gbvrl30.seq - Viral sequence entries, part 30.
2768. gbvrl31.seq - Viral sequence entries, part 31.
2769. gbvrl32.seq - Viral sequence entries, part 32.
2770. gbvrl33.seq - Viral sequence entries, part 33.
2771. gbvrl34.seq - Viral sequence entries, part 34.
2772. gbvrl35.seq - Viral sequence entries, part 35.
2773. gbvrl36.seq - Viral sequence entries, part 36.
2774. gbvrl37.seq - Viral sequence entries, part 37.
2775. gbvrl38.seq - Viral sequence entries, part 38.
2776. gbvrl39.seq - Viral sequence entries, part 39.
2777. gbvrl4.seq - Viral sequence entries, part 4.
2778. gbvrl40.seq - Viral sequence entries, part 40.
2779. gbvrl41.seq - Viral sequence entries, part 41.
2780. gbvrl42.seq - Viral sequence entries, part 42.
2781. gbvrl43.seq - Viral sequence entries, part 43.
2782. gbvrl44.seq - Viral sequence entries, part 44.
2783. gbvrl45.seq - Viral sequence entries, part 45.
2784. gbvrl46.seq - Viral sequence entries, part 46.
2785. gbvrl47.seq - Viral sequence entries, part 47.
2786. gbvrl48.seq - Viral sequence entries, part 48.
2787. gbvrl5.seq - Viral sequence entries, part 5.
2788. gbvrl6.seq - Viral sequence entries, part 6.
2789. gbvrl7.seq - Viral sequence entries, part 7.
2790. gbvrl8.seq - Viral sequence entries, part 8.
2791. gbvrl9.seq - Viral sequence entries, part 9.
2792. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2793. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2794. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2795. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2796. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2797. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2798. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2799. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2800. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2801. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2802. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2803. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2804. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2805. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2806. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2807. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2808. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2809. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2810. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2811. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2812. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2813. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2814. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2815. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2816. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2817. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2818. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2819. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2820. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2821. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2822. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2823. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2824. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2825. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2826. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2827. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2828. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2829. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2830. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2831. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2832. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2833. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2834. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2835. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2836. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2837. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2838. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2839. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2840. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2841. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2842. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2843. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2844. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2845. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2846. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2847. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2848. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2849. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2850. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2851. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2852. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2853. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2854. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2855. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 219.0 flatfiles require roughly 821 GB (sequence
files only) or 821 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 246698632     gbbct1.seq
 243186829     gbbct10.seq
 241012345     gbbct100.seq
 241358394     gbbct101.seq
 240018347     gbbct102.seq
 237108148     gbbct103.seq
 241190701     gbbct104.seq
 204399263     gbbct105.seq
 244951420     gbbct106.seq
 235498599     gbbct107.seq
 240783558     gbbct108.seq
 242814959     gbbct109.seq
 237996308     gbbct11.seq
 242411390     gbbct110.seq
 242434146     gbbct111.seq
 239090331     gbbct112.seq
 237594527     gbbct113.seq
 245342633     gbbct114.seq
 242483671     gbbct115.seq
 240647175     gbbct116.seq
  36013258     gbbct117.seq
 241009164     gbbct118.seq
 241974693     gbbct119.seq
 238416935     gbbct12.seq
 243500014     gbbct120.seq
 241387503     gbbct121.seq
 244812366     gbbct122.seq
 244756218     gbbct123.seq
 237984021     gbbct124.seq
 231635900     gbbct125.seq
 238709327     gbbct126.seq
 143350592     gbbct127.seq
 243058380     gbbct128.seq
 235808240     gbbct129.seq
 242959359     gbbct13.seq
 242577869     gbbct130.seq
 239278573     gbbct131.seq
 236141816     gbbct132.seq
 239446304     gbbct133.seq
 244768601     gbbct134.seq
  76137111     gbbct135.seq
 244041852     gbbct136.seq
 241424666     gbbct137.seq
 243791898     gbbct138.seq
 237903544     gbbct139.seq
 241120117     gbbct14.seq
 244652163     gbbct140.seq
 241891105     gbbct141.seq
 245324510     gbbct142.seq
  30889453     gbbct143.seq
 241267591     gbbct144.seq
 242274259     gbbct145.seq
 241254593     gbbct146.seq
 243283773     gbbct147.seq
 244745856     gbbct148.seq
 244912245     gbbct149.seq
 240253917     gbbct15.seq
 235821469     gbbct150.seq
  95908239     gbbct151.seq
 235947126     gbbct152.seq
 241659306     gbbct153.seq
 244596380     gbbct154.seq
 243579885     gbbct155.seq
 232929844     gbbct156.seq
 239933327     gbbct157.seq
 239914890     gbbct158.seq
 241359557     gbbct159.seq
 243306393     gbbct16.seq
  13752576     gbbct160.seq
 241763950     gbbct161.seq
 245556833     gbbct162.seq
 236678318     gbbct163.seq
 236759589     gbbct164.seq
 245282704     gbbct165.seq
 234896991     gbbct166.seq
 238204679     gbbct167.seq
 102437327     gbbct168.seq
 242963876     gbbct169.seq
 235569768     gbbct17.seq
 240826487     gbbct170.seq
 244503225     gbbct171.seq
 240458524     gbbct172.seq
 241567722     gbbct173.seq
 243381670     gbbct174.seq
 237440690     gbbct175.seq
 237888511     gbbct176.seq
 154882835     gbbct177.seq
 233085843     gbbct178.seq
 237937589     gbbct179.seq
 237921144     gbbct18.seq
 242426155     gbbct180.seq
 242364303     gbbct181.seq
 235904812     gbbct182.seq
 241195492     gbbct183.seq
 242917481     gbbct184.seq
 243981111     gbbct185.seq
 241815993     gbbct186.seq
 241648715     gbbct187.seq
 244137557     gbbct188.seq
 244498659     gbbct189.seq
 234798448     gbbct19.seq
 245195844     gbbct190.seq
 233761316     gbbct191.seq
 243950959     gbbct192.seq
 240029997     gbbct193.seq
 243596630     gbbct194.seq
 238220716     gbbct195.seq
 240467471     gbbct196.seq
 240963533     gbbct197.seq
 242686455     gbbct198.seq
 244811087     gbbct199.seq
 244959132     gbbct2.seq
 238510782     gbbct20.seq
 245063558     gbbct200.seq
 245355033     gbbct201.seq
 234470667     gbbct202.seq
 243091412     gbbct203.seq
 240285856     gbbct204.seq
  21002537     gbbct205.seq
 237214298     gbbct206.seq
 244446992     gbbct207.seq
 241744432     gbbct208.seq
 236084238     gbbct209.seq
 242506264     gbbct21.seq
 244808414     gbbct210.seq
 239724273     gbbct211.seq
 239225777     gbbct212.seq
  47377463     gbbct213.seq
 238321777     gbbct214.seq
 240982114     gbbct215.seq
 237920436     gbbct216.seq
 242909694     gbbct217.seq
 240203158     gbbct218.seq
 237994673     gbbct219.seq
 116759714     gbbct22.seq
 244413437     gbbct220.seq
 236227210     gbbct221.seq
 239012310     gbbct222.seq
 183469147     gbbct223.seq
 241589236     gbbct224.seq
 243260116     gbbct225.seq
 237047156     gbbct226.seq
 241007412     gbbct227.seq
 237160585     gbbct228.seq
 238117733     gbbct229.seq
 238475957     gbbct23.seq
 243269036     gbbct230.seq
 242881034     gbbct231.seq
 242806357     gbbct232.seq
 231882053     gbbct233.seq
 187137045     gbbct234.seq
 233269735     gbbct235.seq
 242138292     gbbct236.seq
 239180661     gbbct237.seq
 241539672     gbbct238.seq
 236789342     gbbct239.seq
 242847946     gbbct24.seq
 244921999     gbbct240.seq
 242262870     gbbct241.seq
 239647296     gbbct242.seq
 240731626     gbbct243.seq
 240626828     gbbct244.seq
 235349254     gbbct245.seq
 126716645     gbbct246.seq
 242879699     gbbct247.seq
 225730833     gbbct248.seq
 240100899     gbbct249.seq
 240193409     gbbct25.seq
 236477102     gbbct250.seq
 240164712     gbbct251.seq
 235998605     gbbct252.seq
 236700046     gbbct253.seq
 243135515     gbbct254.seq
 238915415     gbbct255.seq
 236920687     gbbct256.seq
 240987949     gbbct257.seq
 242953202     gbbct258.seq
 239002101     gbbct259.seq
 241298666     gbbct26.seq
   8102842     gbbct260.seq
 241240772     gbbct261.seq
 244838542     gbbct262.seq
 241162996     gbbct263.seq
 242379531     gbbct264.seq
 238273250     gbbct265.seq
 238292577     gbbct266.seq
 236802121     gbbct267.seq
 242788604     gbbct268.seq
 245618536     gbbct269.seq
 239812641     gbbct27.seq
 242881317     gbbct270.seq
 160613377     gbbct271.seq
 235295489     gbbct272.seq
 240110439     gbbct273.seq
 245106140     gbbct274.seq
 238724153     gbbct275.seq
 244337120     gbbct276.seq
 239588559     gbbct277.seq
  17480694     gbbct278.seq
 237007360     gbbct279.seq
 240518745     gbbct28.seq
 242237419     gbbct280.seq
 239680697     gbbct281.seq
 244912867     gbbct282.seq
 242456230     gbbct283.seq
 245027154     gbbct284.seq
 245108321     gbbct285.seq
 241057887     gbbct286.seq
 241777198     gbbct287.seq
 241748384     gbbct288.seq
 243400477     gbbct289.seq
 238521741     gbbct29.seq
 238146624     gbbct290.seq
 242915650     gbbct291.seq
 201260553     gbbct292.seq
 233406141     gbbct293.seq
  72258987     gbbct294.seq
   6830747     gbbct295.seq
  14103583     gbbct296.seq
  22748284     gbbct297.seq
  44381100     gbbct298.seq
  86365324     gbbct299.seq
 242090517     gbbct3.seq
 235255560     gbbct30.seq
 168088431     gbbct300.seq
 246523383     gbbct301.seq
 246578126     gbbct302.seq
 244642220     gbbct303.seq
 242729619     gbbct304.seq
 236419049     gbbct305.seq
 231697285     gbbct306.seq
 242661739     gbbct307.seq
 240928588     gbbct308.seq
 245481375     gbbct309.seq
 214069574     gbbct31.seq
 246085151     gbbct310.seq
  72884715     gbbct311.seq
 242138986     gbbct312.seq
 240838054     gbbct313.seq
 245130785     gbbct314.seq
 243477009     gbbct315.seq
 236169344     gbbct316.seq
 245797163     gbbct317.seq
 246805309     gbbct318.seq
 246774002     gbbct319.seq
 238466083     gbbct32.seq
  17355778     gbbct320.seq
 247248303     gbbct321.seq
 247071403     gbbct322.seq
 246794595     gbbct323.seq
  45854957     gbbct324.seq
 246593353     gbbct325.seq
 246467623     gbbct326.seq
  66344376     gbbct327.seq
 246585593     gbbct328.seq
 181288190     gbbct329.seq
 241226685     gbbct33.seq
 246571836     gbbct330.seq
 198934061     gbbct331.seq
 246164267     gbbct332.seq
 247895001     gbbct333.seq
 240257919     gbbct334.seq
 245902282     gbbct335.seq
 240766092     gbbct336.seq
 223068807     gbbct337.seq
 244826012     gbbct338.seq
 245565175     gbbct339.seq
 244099087     gbbct34.seq
 236496535     gbbct340.seq
 237830058     gbbct341.seq
 243977628     gbbct342.seq
 241643783     gbbct343.seq
 240820511     gbbct344.seq
 240360753     gbbct345.seq
 235145639     gbbct346.seq
 244763503     gbbct347.seq
 237384519     gbbct348.seq
 245945981     gbbct349.seq
 243481703     gbbct35.seq
  89464125     gbbct350.seq
 244681275     gbbct36.seq
 239919309     gbbct37.seq
 242840677     gbbct38.seq
 245488589     gbbct39.seq
 245045591     gbbct4.seq
 245337443     gbbct40.seq
 236556384     gbbct41.seq
 240090941     gbbct42.seq
 245077382     gbbct43.seq
 162408471     gbbct44.seq
 242787985     gbbct45.seq
 242493574     gbbct46.seq
 243797213     gbbct47.seq
 242244300     gbbct48.seq
 237720264     gbbct49.seq
 245980616     gbbct5.seq
 242315653     gbbct50.seq
 244624140     gbbct51.seq
 244508694     gbbct52.seq
 235493144     gbbct53.seq
 244399840     gbbct54.seq
 244495481     gbbct55.seq
 240636169     gbbct56.seq
  48491099     gbbct57.seq
 240165716     gbbct58.seq
 241070974     gbbct59.seq
  55002188     gbbct6.seq
 234868442     gbbct60.seq
 243317179     gbbct61.seq
 235596172     gbbct62.seq
 242893951     gbbct63.seq
 245494162     gbbct64.seq
 242971298     gbbct65.seq
 243140416     gbbct66.seq
 244001741     gbbct67.seq
 243778204     gbbct68.seq
 243121095     gbbct69.seq
 235538325     gbbct7.seq
 245104269     gbbct70.seq
  62612063     gbbct71.seq
 244230375     gbbct72.seq
 243884458     gbbct73.seq
 245361154     gbbct74.seq
 242089920     gbbct75.seq
 235903248     gbbct76.seq
 239117493     gbbct77.seq
 245196106     gbbct78.seq
 239754152     gbbct79.seq
 159233432     gbbct8.seq
 242162951     gbbct80.seq
 243095519     gbbct81.seq
 240202840     gbbct82.seq
 237375517     gbbct83.seq
 238746356     gbbct84.seq
  92149913     gbbct85.seq
 245122820     gbbct86.seq
 241152367     gbbct87.seq
 240887935     gbbct88.seq
 242537359     gbbct89.seq
 245243456     gbbct9.seq
 244598510     gbbct90.seq
 242081055     gbbct91.seq
 243899082     gbbct92.seq
 237478881     gbbct93.seq
 242260265     gbbct94.seq
 243675938     gbbct95.seq
  25829273     gbbct96.seq
 244190624     gbbct97.seq
 235211178     gbbct98.seq
 244826039     gbbct99.seq
   2738484     gbchg.txt
 247012309     gbcon1.seq
 248352988     gbcon10.seq
 245659825     gbcon100.seq
  72154848     gbcon101.seq
 245734548     gbcon102.seq
 245473840     gbcon103.seq
 245205520     gbcon104.seq
 246063494     gbcon105.seq
 245561449     gbcon106.seq
  31855944     gbcon107.seq
 245197080     gbcon108.seq
 245251679     gbcon109.seq
 245523610     gbcon11.seq
 246071166     gbcon110.seq
 245919009     gbcon111.seq
 204932657     gbcon112.seq
 245448256     gbcon113.seq
 244738279     gbcon114.seq
 244676272     gbcon115.seq
 244553080     gbcon116.seq
 244621646     gbcon117.seq
 140546008     gbcon118.seq
 244574412     gbcon119.seq
 245558570     gbcon12.seq
 244655234     gbcon120.seq
 244670621     gbcon121.seq
 244435276     gbcon122.seq
 244726178     gbcon123.seq
 163052632     gbcon124.seq
 244498414     gbcon125.seq
 244448673     gbcon126.seq
 244064775     gbcon127.seq
 239770050     gbcon128.seq
 173591655     gbcon129.seq
 229693611     gbcon13.seq
 249550004     gbcon130.seq
 245069410     gbcon131.seq
  50482501     gbcon132.seq
 245480105     gbcon133.seq
 248652006     gbcon134.seq
 209440095     gbcon135.seq
 199346006     gbcon136.seq
 243338925     gbcon137.seq
 239942158     gbcon138.seq
 241200237     gbcon139.seq
 241914881     gbcon14.seq
 247010693     gbcon140.seq
 249134789     gbcon141.seq
 155319177     gbcon142.seq
 248344398     gbcon143.seq
 248665894     gbcon144.seq
 247179448     gbcon145.seq
 244013501     gbcon146.seq
 249922466     gbcon147.seq
 246259418     gbcon148.seq
 245713254     gbcon149.seq
 240854379     gbcon15.seq
  93461245     gbcon150.seq
 247095165     gbcon151.seq
 247087199     gbcon152.seq
 248307563     gbcon153.seq
 246060089     gbcon154.seq
 248824923     gbcon155.seq
 247345712     gbcon156.seq
 241416842     gbcon157.seq
 247641238     gbcon158.seq
  76908660     gbcon159.seq
 230884408     gbcon16.seq
 246098035     gbcon160.seq
 246786676     gbcon161.seq
 245623260     gbcon162.seq
 246904268     gbcon163.seq
 145185825     gbcon164.seq
 247884609     gbcon165.seq
 246829478     gbcon166.seq
 244869090     gbcon167.seq
 247126626     gbcon168.seq
 248386621     gbcon169.seq
 239671836     gbcon17.seq
 247265084     gbcon170.seq
 248516139     gbcon171.seq
 182058022     gbcon172.seq
 249004510     gbcon173.seq
 248418172     gbcon174.seq
 249123537     gbcon175.seq
 249187777     gbcon176.seq
 201306432     gbcon177.seq
 247163153     gbcon178.seq
 245901200     gbcon179.seq
 243677140     gbcon18.seq
 243907625     gbcon180.seq
 245941726     gbcon181.seq
 242916699     gbcon182.seq
 247735443     gbcon183.seq
 247918376     gbcon184.seq
 248274939     gbcon185.seq
 249437990     gbcon186.seq
 225955697     gbcon187.seq
 247228567     gbcon188.seq
 248528094     gbcon189.seq
 245439792     gbcon19.seq
 246295705     gbcon190.seq
 247385250     gbcon191.seq
 247928395     gbcon192.seq
 248309727     gbcon193.seq
  29448158     gbcon194.seq
 247271812     gbcon195.seq
 248119274     gbcon196.seq
 245655250     gbcon197.seq
 246621136     gbcon198.seq
 234657883     gbcon199.seq
 245708048     gbcon2.seq
 244787972     gbcon20.seq
 247943693     gbcon200.seq
 248252762     gbcon201.seq
 245908619     gbcon202.seq
 247015621     gbcon203.seq
 248406506     gbcon204.seq
 247549405     gbcon205.seq
 248244879     gbcon206.seq
 248568686     gbcon207.seq
  66894920     gbcon208.seq
 248536659     gbcon209.seq
 239365109     gbcon21.seq
 248524941     gbcon210.seq
 248533313     gbcon211.seq
 248427170     gbcon212.seq
 204294589     gbcon213.seq
 248343426     gbcon214.seq
 248277404     gbcon215.seq
 248442179     gbcon216.seq
 248463213     gbcon217.seq
 162860809     gbcon218.seq
 248345102     gbcon219.seq
 243016915     gbcon22.seq
 248813880     gbcon220.seq
 247373713     gbcon221.seq
 248004736     gbcon222.seq
 248042949     gbcon223.seq
 245036332     gbcon224.seq
 245832724     gbcon225.seq
 247789480     gbcon226.seq
 247840737     gbcon227.seq
 247689150     gbcon228.seq
 248045474     gbcon229.seq
 143356499     gbcon23.seq
 248285828     gbcon230.seq
 182648370     gbcon231.seq
 248586969     gbcon232.seq
 248835282     gbcon233.seq
 249475883     gbcon234.seq
 248953302     gbcon235.seq
 220618733     gbcon236.seq
 248457927     gbcon237.seq
 247842887     gbcon238.seq
 248877822     gbcon239.seq
 247215576     gbcon24.seq
 248217566     gbcon240.seq
 107071688     gbcon241.seq
 245512173     gbcon242.seq
 249198826     gbcon243.seq
 247101624     gbcon244.seq
 243820920     gbcon245.seq
 247363659     gbcon246.seq
 191722522     gbcon247.seq
 248286359     gbcon248.seq
 245104181     gbcon249.seq
 248782070     gbcon25.seq
 245598118     gbcon250.seq
 247291200     gbcon251.seq
 247784218     gbcon252.seq
 246286174     gbcon253.seq
 242923492     gbcon254.seq
 249329712     gbcon255.seq
  21513584     gbcon256.seq
 248942577     gbcon257.seq
 248255979     gbcon258.seq
 247459719     gbcon259.seq
 247587299     gbcon26.seq
 247555034     gbcon260.seq
 247083481     gbcon261.seq
 125431570     gbcon262.seq
 247449532     gbcon263.seq
 247021804     gbcon264.seq
 247147525     gbcon265.seq
 248782359     gbcon266.seq
 247581416     gbcon267.seq
 249238540     gbcon268.seq
 182648816     gbcon269.seq
 248928360     gbcon27.seq
 248970094     gbcon270.seq
 248566801     gbcon271.seq
 247534137     gbcon272.seq
 247853711     gbcon273.seq
 247001583     gbcon274.seq
 247254870     gbcon275.seq
 246793888     gbcon276.seq
  24386588     gbcon277.seq
 247159716     gbcon278.seq
 248502640     gbcon279.seq
 248618777     gbcon28.seq
 246721503     gbcon280.seq
 246785108     gbcon281.seq
 247991581     gbcon282.seq
 117758078     gbcon283.seq
 247418417     gbcon284.seq
 248396830     gbcon285.seq
 248623476     gbcon286.seq
 247277985     gbcon287.seq
 249292783     gbcon288.seq
 122673350     gbcon289.seq
 248505589     gbcon29.seq
 249136803     gbcon290.seq
 248637550     gbcon291.seq
 248811810     gbcon292.seq
 247564177     gbcon293.seq
 248719175     gbcon294.seq
 116660512     gbcon295.seq
 248727273     gbcon296.seq
 249111152     gbcon297.seq
 247199995     gbcon298.seq
 248855149     gbcon299.seq
 244985682     gbcon3.seq
  91061201     gbcon30.seq
 247898849     gbcon300.seq
 249106083     gbcon301.seq
 138371066     gbcon302.seq
 242917322     gbcon303.seq
 242027214     gbcon304.seq
 241679148     gbcon305.seq
 245093560     gbcon306.seq
 247929376     gbcon307.seq
 249195190     gbcon308.seq
 249318086     gbcon309.seq
 248325310     gbcon31.seq
 248959561     gbcon310.seq
  90920628     gbcon311.seq
 247999282     gbcon312.seq
 247104149     gbcon313.seq
 247478858     gbcon314.seq
 246030608     gbcon315.seq
 247011419     gbcon316.seq
 246620792     gbcon317.seq
  71852881     gbcon318.seq
 248769665     gbcon319.seq
 248272381     gbcon32.seq
 248520117     gbcon320.seq
 248968617     gbcon321.seq
 248527315     gbcon322.seq
 247867770     gbcon323.seq
 244821165     gbcon324.seq
 245304773     gbcon325.seq
 247243007     gbcon326.seq
  65155315     gbcon327.seq
 248295427     gbcon328.seq
 248319862     gbcon329.seq
 245157503     gbcon33.seq
 248438668     gbcon330.seq
 245009441     gbcon331.seq
 242351527     gbcon332.seq
  61428054     gbcon333.seq
 242981137     gbcon334.seq
 248744506     gbcon335.seq
 248852949     gbcon336.seq
 248037337     gbcon337.seq
 246271018     gbcon338.seq
 248235776     gbcon339.seq
 247834675     gbcon34.seq
 248703193     gbcon340.seq
 244673577     gbcon341.seq
 246438213     gbcon342.seq
 247746345     gbcon343.seq
  91858514     gbcon344.seq
 248604923     gbcon345.seq
 248960003     gbcon346.seq
 248587704     gbcon347.seq
 248896451     gbcon348.seq
  42587236     gbcon349.seq
 243217707     gbcon35.seq
 249015165     gbcon350.seq
 249015968     gbcon351.seq
 246892468     gbcon352.seq
 246102704     gbcon353.seq
 247796542     gbcon354.seq
 247641806     gbcon355.seq
 246808503     gbcon356.seq
 246695329     gbcon357.seq
 241275312     gbcon358.seq
    126063     gbcon359.seq
 244656920     gbcon36.seq
 248018242     gbcon37.seq
  38248009     gbcon38.seq
 247325269     gbcon39.seq
 243924770     gbcon4.seq
 248016257     gbcon40.seq
 129883267     gbcon41.seq
 126402495     gbcon42.seq
 247645058     gbcon43.seq
 244344328     gbcon44.seq
 246299610     gbcon45.seq
 248996679     gbcon46.seq
 125138711     gbcon47.seq
 249004598     gbcon48.seq
 249005060     gbcon49.seq
 247933028     gbcon5.seq
 249001951     gbcon50.seq
 249004984     gbcon51.seq
 243744541     gbcon52.seq
 208038988     gbcon53.seq
 244963332     gbcon54.seq
 245018060     gbcon55.seq
 244932384     gbcon56.seq
 244983449     gbcon57.seq
 244951127     gbcon58.seq
 244992927     gbcon59.seq
 248612836     gbcon6.seq
  72075020     gbcon60.seq
 244968625     gbcon61.seq
 244992955     gbcon62.seq
 244995119     gbcon63.seq
 244966215     gbcon64.seq
 244967157     gbcon65.seq
  52119117     gbcon66.seq
 245114339     gbcon67.seq
 245008606     gbcon68.seq
 244971894     gbcon69.seq
 197379599     gbcon7.seq
 244975476     gbcon70.seq
 245003744     gbcon71.seq
  45534365     gbcon72.seq
 244956120     gbcon73.seq
 244985706     gbcon74.seq
 245065519     gbcon75.seq
 245058789     gbcon76.seq
 245007339     gbcon77.seq
 160295691     gbcon78.seq
 245842573     gbcon79.seq
 248149247     gbcon8.seq
 246436492     gbcon80.seq
 246168337     gbcon81.seq
 246333848     gbcon82.seq
 191796136     gbcon83.seq
 246291627     gbcon84.seq
 246645081     gbcon85.seq
 246223486     gbcon86.seq
 246268624     gbcon87.seq
 246254741     gbcon88.seq
   7088771     gbcon89.seq
 244886614     gbcon9.seq
 246258910     gbcon90.seq
 246546856     gbcon91.seq
 245226657     gbcon92.seq
 245635933     gbcon93.seq
 245556656     gbcon94.seq
 106467293     gbcon95.seq
 245064167     gbcon96.seq
 245238793     gbcon97.seq
 245212034     gbcon98.seq
 245127599     gbcon99.seq
     62717     gbdel.txt
 247843647     gbenv1.seq
 248257332     gbenv10.seq
 248266399     gbenv11.seq
 248568485     gbenv12.seq
  60377813     gbenv13.seq
 248514567     gbenv14.seq
 248194247     gbenv15.seq
 248533372     gbenv16.seq
 248456302     gbenv17.seq
 248307897     gbenv18.seq
 247780169     gbenv19.seq
 248090542     gbenv2.seq
 247870328     gbenv20.seq
 249165047     gbenv21.seq
   8291807     gbenv22.seq
 249102768     gbenv23.seq
 248319922     gbenv24.seq
 248152174     gbenv25.seq
 248280504     gbenv26.seq
 181156795     gbenv27.seq
 248146376     gbenv28.seq
 248055754     gbenv29.seq
 248061554     gbenv3.seq
 248196074     gbenv30.seq
 248033573     gbenv31.seq
 248008665     gbenv32.seq
 248013333     gbenv33.seq
  78540285     gbenv34.seq
 249124120     gbenv35.seq
 248643821     gbenv36.seq
 248445066     gbenv37.seq
 248527634     gbenv38.seq
 186916167     gbenv39.seq
 247249146     gbenv4.seq
 248366612     gbenv40.seq
 248165601     gbenv41.seq
 248094284     gbenv42.seq
 249091083     gbenv43.seq
 248874952     gbenv44.seq
 249129304     gbenv45.seq
  54449790     gbenv46.seq
 248990841     gbenv47.seq
 247899235     gbenv48.seq
 248371007     gbenv49.seq
 241248593     gbenv5.seq
 248261114     gbenv50.seq
 197920906     gbenv51.seq
 247587567     gbenv52.seq
 249393516     gbenv53.seq
 249409298     gbenv54.seq
 249078658     gbenv55.seq
 248351480     gbenv56.seq
  89119804     gbenv57.seq
 248708645     gbenv58.seq
 248643920     gbenv59.seq
 247934653     gbenv6.seq
 248716474     gbenv60.seq
 248150293     gbenv61.seq
 248376311     gbenv62.seq
 220493445     gbenv63.seq
 248321375     gbenv64.seq
 248557343     gbenv65.seq
 248438883     gbenv66.seq
 247574585     gbenv67.seq
 248462945     gbenv68.seq
  93034177     gbenv69.seq
 248351549     gbenv7.seq
 248685311     gbenv70.seq
 247786562     gbenv71.seq
 247958961     gbenv72.seq
 246991544     gbenv73.seq
 248353861     gbenv74.seq
 153682001     gbenv75.seq
 247621512     gbenv76.seq
 247970489     gbenv77.seq
 248310557     gbenv78.seq
 248163748     gbenv79.seq
 186457364     gbenv8.seq
 248058119     gbenv80.seq
  98695715     gbenv81.seq
 248448234     gbenv82.seq
 248369436     gbenv83.seq
 247958069     gbenv84.seq
 248040469     gbenv85.seq
 195773616     gbenv86.seq
 248024341     gbenv87.seq
 247829366     gbenv88.seq
 247766936     gbenv89.seq
 248095697     gbenv9.seq
 248063892     gbenv90.seq
  99622117     gbenv91.seq
 247369435     gbenv92.seq
 247614683     gbenv93.seq
 247696716     gbenv94.seq
 248295541     gbenv95.seq
 248277216     gbenv96.seq
 152342318     gbenv97.seq
 522376327     gbest1.seq
 522269791     gbest10.seq
 521255028     gbest100.seq
 521183396     gbest101.seq
 521780907     gbest102.seq
 521883148     gbest103.seq
 350373682     gbest104.seq
 522200932     gbest105.seq
 522026433     gbest106.seq
 522535963     gbest107.seq
 381781433     gbest108.seq
 385217424     gbest109.seq
 522257315     gbest11.seq
 379158797     gbest110.seq
 379803716     gbest111.seq
 376738109     gbest112.seq
 380925044     gbest113.seq
 385189358     gbest114.seq
 384288224     gbest115.seq
 383120815     gbest116.seq
 379466788     gbest117.seq
 402749949     gbest118.seq
 481878084     gbest119.seq
 522268918     gbest12.seq
 522129535     gbest120.seq
 521937303     gbest121.seq
 522355897     gbest122.seq
 522232516     gbest123.seq
 468643751     gbest124.seq
 521840866     gbest125.seq
 522248590     gbest126.seq
 522240912     gbest127.seq
 522251486     gbest128.seq
 522310707     gbest129.seq
 142919175     gbest13.seq
 522029296     gbest130.seq
 521903044     gbest131.seq
 521653472     gbest132.seq
 522214091     gbest133.seq
 522171582     gbest134.seq
 522438626     gbest135.seq
 522408938     gbest136.seq
 287852009     gbest137.seq
 522044593     gbest138.seq
 521119193     gbest139.seq
 521461339     gbest14.seq
 522263231     gbest140.seq
 522116033     gbest141.seq
 522327929     gbest142.seq
 522554407     gbest143.seq
 522275393     gbest144.seq
 522256570     gbest145.seq
 522676401     gbest146.seq
 522717332     gbest147.seq
 522631131     gbest148.seq
 522640983     gbest149.seq
 522108604     gbest15.seq
 522621795     gbest150.seq
 467767650     gbest151.seq
 522154844     gbest152.seq
 521989068     gbest153.seq
 522176445     gbest154.seq
 521694764     gbest155.seq
 521398573     gbest156.seq
 521905347     gbest157.seq
 522281096     gbest158.seq
 522438901     gbest159.seq
 521929188     gbest16.seq
 522262827     gbest160.seq
 522236237     gbest161.seq
 522475536     gbest162.seq
 522093205     gbest163.seq
 237192705     gbest164.seq
 522329808     gbest165.seq
 521790325     gbest166.seq
 522390069     gbest167.seq
 522427872     gbest168.seq
 522328613     gbest169.seq
 521736780     gbest17.seq
 521803005     gbest170.seq
 522254279     gbest171.seq
 522107965     gbest172.seq
 522617395     gbest173.seq
 522062702     gbest174.seq
 522036041     gbest175.seq
 522714132     gbest176.seq
 522233156     gbest177.seq
  92247551     gbest178.seq
 522031804     gbest179.seq
 521649713     gbest18.seq
 521764194     gbest180.seq
 522278545     gbest181.seq
 521569106     gbest182.seq
 522144997     gbest183.seq
 522247779     gbest184.seq
 522457481     gbest185.seq
 521991312     gbest186.seq
 522329146     gbest187.seq
 522244091     gbest188.seq
 522250780     gbest189.seq
 522081557     gbest19.seq
 522458016     gbest190.seq
 456448610     gbest191.seq
 522379351     gbest192.seq
 522581699     gbest193.seq
 522435816     gbest194.seq
 522500820     gbest195.seq
 522564199     gbest196.seq
 522247512     gbest197.seq
 522020106     gbest198.seq
 522025847     gbest199.seq
 522340439     gbest2.seq
 521679510     gbest20.seq
 522053756     gbest200.seq
 522087089     gbest201.seq
 522047847     gbest202.seq
 522028181     gbest203.seq
 522021599     gbest204.seq
  40614067     gbest205.seq
 521826831     gbest206.seq
 521510581     gbest207.seq
 521874374     gbest208.seq
 521759735     gbest209.seq
 521513550     gbest21.seq
 521460993     gbest210.seq
 521552066     gbest211.seq
 521551629     gbest212.seq
 522349157     gbest213.seq
 521273331     gbest214.seq
 521000807     gbest215.seq
 471314230     gbest216.seq
 521736503     gbest217.seq
 521459156     gbest218.seq
 522533688     gbest219.seq
 489889791     gbest22.seq
 522362461     gbest220.seq
 521551021     gbest221.seq
 522186481     gbest222.seq
 522948229     gbest223.seq
 522299086     gbest224.seq
 522207609     gbest225.seq
 522431640     gbest226.seq
 521366716     gbest227.seq
 522495138     gbest228.seq
 461060139     gbest229.seq
 489746695     gbest23.seq
 522496219     gbest230.seq
 522693302     gbest231.seq
 522419166     gbest232.seq
 522603039     gbest233.seq
 522441997     gbest234.seq
 522564406     gbest235.seq
 522668805     gbest236.seq
 522423152     gbest237.seq
 522250727     gbest238.seq
 522639410     gbest239.seq
 501053821     gbest24.seq
 522473898     gbest240.seq
 522010413     gbest241.seq
 522099479     gbest242.seq
 522262913     gbest243.seq
 249650389     gbest244.seq
 522120688     gbest245.seq
 522388604     gbest246.seq
 522266648     gbest247.seq
 521501259     gbest248.seq
 521803166     gbest249.seq
 323539995     gbest25.seq
 522206957     gbest250.seq
 521247906     gbest251.seq
 517507934     gbest252.seq
 522112892     gbest253.seq
 522009820     gbest254.seq
 522177976     gbest255.seq
 331370237     gbest256.seq
 522263867     gbest257.seq
 521886146     gbest258.seq
 521660179     gbest259.seq
 521558556     gbest26.seq
 521987710     gbest260.seq
 522157576     gbest261.seq
 521147254     gbest262.seq
 520425116     gbest263.seq
 521588901     gbest264.seq
 521658348     gbest265.seq
 520674548     gbest266.seq
 217903044     gbest267.seq
 522147426     gbest268.seq
 521967963     gbest269.seq
 521437064     gbest27.seq
 521964470     gbest270.seq
 521517684     gbest271.seq
 522099669     gbest272.seq
 521545553     gbest273.seq
 521535333     gbest274.seq
 521397815     gbest275.seq
 521748261     gbest276.seq
 521895678     gbest277.seq
 521678584     gbest278.seq
 369824830     gbest279.seq
 521930908     gbest28.seq
 521833958     gbest280.seq
 521896643     gbest281.seq
 522425970     gbest282.seq
 522460555     gbest283.seq
 522116965     gbest284.seq
 520638312     gbest285.seq
 520582681     gbest286.seq
 522205418     gbest287.seq
 521915062     gbest288.seq
 522050400     gbest289.seq
 522390924     gbest29.seq
 522106005     gbest290.seq
 287012512     gbest291.seq
 521355198     gbest292.seq
 521980595     gbest293.seq
 521810552     gbest294.seq
 522132743     gbest295.seq
 521487854     gbest296.seq
 522122984     gbest297.seq
 521961910     gbest298.seq
 521658675     gbest299.seq
 486472725     gbest3.seq
 522225379     gbest30.seq
 521784531     gbest300.seq
 521689737     gbest301.seq
 467095654     gbest302.seq
 323793053     gbest303.seq
 472922234     gbest304.seq
 470048678     gbest305.seq
 521691158     gbest306.seq
 521735123     gbest307.seq
 522248633     gbest308.seq
 522150180     gbest309.seq
 522478098     gbest31.seq
 522451866     gbest310.seq
 522036295     gbest311.seq
 521892721     gbest312.seq
 522178352     gbest313.seq
 521935858     gbest314.seq
 522043680     gbest315.seq
 377076135     gbest316.seq
 521978454     gbest317.seq
 522085947     gbest318.seq
 521787220     gbest319.seq
 522259638     gbest32.seq
 521901114     gbest320.seq
 522391856     gbest321.seq
 522276526     gbest322.seq
 522231710     gbest323.seq
 522401453     gbest324.seq
 522199679     gbest325.seq
 522189420     gbest326.seq
 521803759     gbest327.seq
 512281287     gbest328.seq
 515130076     gbest329.seq
 522177888     gbest33.seq
 227506640     gbest330.seq
 522183055     gbest331.seq
 522027980     gbest332.seq
 522277357     gbest333.seq
 522303625     gbest334.seq
 521434140     gbest335.seq
 522350215     gbest336.seq
 493440353     gbest337.seq
 522467982     gbest338.seq
 522371091     gbest339.seq
 507849472     gbest34.seq
 522530651     gbest340.seq
 522065035     gbest341.seq
 521247152     gbest342.seq
 521891791     gbest343.seq
 334002906     gbest344.seq
 521975417     gbest345.seq
 522234165     gbest346.seq
 522426988     gbest347.seq
 522385995     gbest348.seq
 521685917     gbest349.seq
 485223416     gbest35.seq
 522033152     gbest350.seq
 508636476     gbest351.seq
 521659117     gbest352.seq
 522631984     gbest353.seq
 523262860     gbest354.seq
 522376729     gbest355.seq
 522464622     gbest356.seq
 522223175     gbest357.seq
 522067932     gbest358.seq
 141734178     gbest359.seq
 486948893     gbest36.seq
 522111751     gbest360.seq
 521620399     gbest361.seq
 520953644     gbest362.seq
 520825254     gbest363.seq
 521658502     gbest364.seq
 522312840     gbest365.seq
 522379523     gbest366.seq
 522147360     gbest367.seq
 521624119     gbest368.seq
 521101653     gbest369.seq
 485797043     gbest37.seq
 521803921     gbest370.seq
  65710643     gbest371.seq
 521291677     gbest372.seq
 521421613     gbest373.seq
 521421490     gbest374.seq
 522277784     gbest375.seq
 521512448     gbest376.seq
 522051013     gbest377.seq
 489580299     gbest378.seq
 521724073     gbest379.seq
 480477490     gbest38.seq
 522092268     gbest380.seq
 521991661     gbest381.seq
 521692523     gbest382.seq
 263877542     gbest383.seq
 521419996     gbest384.seq
 521553710     gbest385.seq
 521593673     gbest386.seq
 521616008     gbest387.seq
 521476713     gbest388.seq
 521223779     gbest389.seq
 484515434     gbest39.seq
 521291104     gbest390.seq
 521535594     gbest391.seq
 521316964     gbest392.seq
 521511765     gbest393.seq
 185011951     gbest394.seq
 521664699     gbest395.seq
 521881110     gbest396.seq
 521969412     gbest397.seq
 522109203     gbest398.seq
 522070709     gbest399.seq
 522231299     gbest4.seq
 132055569     gbest40.seq
 522070212     gbest400.seq
 522105357     gbest401.seq
 522067662     gbest402.seq
 521809323     gbest403.seq
 521944042     gbest404.seq
 521998865     gbest405.seq
 522284548     gbest406.seq
 391159923     gbest407.seq
 522231406     gbest408.seq
 521831253     gbest409.seq
 522972019     gbest41.seq
 522276768     gbest410.seq
 521799159     gbest411.seq
 521939686     gbest412.seq
 521937916     gbest413.seq
 522166047     gbest414.seq
 521896664     gbest415.seq
 522205672     gbest416.seq
 521898173     gbest417.seq
 521714210     gbest418.seq
 522326203     gbest419.seq
 522559380     gbest42.seq
 522447905     gbest420.seq
   5883061     gbest421.seq
 522121167     gbest422.seq
 521999903     gbest423.seq
 521791692     gbest424.seq
 522205384     gbest425.seq
 521871538     gbest426.seq
 521876903     gbest427.seq
 522445208     gbest428.seq
 522922476     gbest429.seq
 522093759     gbest43.seq
 523173723     gbest430.seq
 522679150     gbest431.seq
 522139456     gbest432.seq
 522493406     gbest433.seq
 522368263     gbest434.seq
 522307912     gbest435.seq
 181119538     gbest436.seq
 521850180     gbest437.seq
 521770156     gbest438.seq
 522225658     gbest439.seq
 522216710     gbest44.seq
 521902322     gbest440.seq
 522207040     gbest441.seq
 521562484     gbest442.seq
 522177262     gbest443.seq
 521816901     gbest444.seq
 521217848     gbest445.seq
 522046612     gbest446.seq
 522068240     gbest447.seq
 522346458     gbest448.seq
  98199393     gbest449.seq
 522263065     gbest45.seq
 522383242     gbest450.seq
 521384320     gbest451.seq
 521750964     gbest452.seq
 521404407     gbest453.seq
 521511520     gbest454.seq
 521742231     gbest455.seq
 521742099     gbest456.seq
 521635946     gbest457.seq
 521518758     gbest458.seq
 521513571     gbest459.seq
 522266143     gbest46.seq
 521654249     gbest460.seq
  35734710     gbest461.seq
 521566470     gbest462.seq
 521397433     gbest463.seq
 521548725     gbest464.seq
 521867044     gbest465.seq
 521482285     gbest466.seq
 522171921     gbest467.seq
 522189114     gbest468.seq
 522043148     gbest469.seq
 522315704     gbest47.seq
 521679871     gbest470.seq
 522200122     gbest471.seq
 522124405     gbest472.seq
 392782716     gbest473.seq
 521751589     gbest474.seq
 521875454     gbest475.seq
 521796040     gbest476.seq
 521694285     gbest477.seq
 521693409     gbest478.seq
 521810169     gbest479.seq
 522176208     gbest48.seq
 521766692     gbest480.seq
 522381424     gbest481.seq
 522439103     gbest482.seq
  40913247     gbest483.seq
 522207653     gbest49.seq
 522254539     gbest5.seq
 522182263     gbest50.seq
 522239412     gbest51.seq
 522212902     gbest52.seq
 522374639     gbest53.seq
 234017140     gbest54.seq
 522111353     gbest55.seq
 522142929     gbest56.seq
 522145286     gbest57.seq
 522219527     gbest58.seq
 522251160     gbest59.seq
 522222311     gbest6.seq
 522142662     gbest60.seq
 522205811     gbest61.seq
 522049230     gbest62.seq
 522028654     gbest63.seq
 522269108     gbest64.seq
 522354034     gbest65.seq
 522223143     gbest66.seq
 443904797     gbest67.seq
 522341332     gbest68.seq
 521742764     gbest69.seq
 522231568     gbest7.seq
 521931575     gbest70.seq
 521401274     gbest71.seq
 521858608     gbest72.seq
 521606478     gbest73.seq
 522127263     gbest74.seq
 522568494     gbest75.seq
 522495151     gbest76.seq
 522237148     gbest77.seq
 522242927     gbest78.seq
 522432491     gbest79.seq
 522126319     gbest8.seq
 165157491     gbest80.seq
 522155720     gbest81.seq
 521524480     gbest82.seq
 521367013     gbest83.seq
 521661935     gbest84.seq
 521528218     gbest85.seq
 522190992     gbest86.seq
 522415828     gbest87.seq
 522151980     gbest88.seq
 522226191     gbest89.seq
 522262432     gbest9.seq
 522292327     gbest90.seq
 522317684     gbest91.seq
 445458461     gbest92.seq
 522259531     gbest93.seq
 522454058     gbest94.seq
 522443634     gbest95.seq
 522452715     gbest96.seq
 522369051     gbest97.seq
 521964661     gbest98.seq
 521379355     gbest99.seq
 521876586     gbgss1.seq
 522564424     gbgss10.seq
 522253178     gbgss100.seq
 522307260     gbgss101.seq
 522286609     gbgss102.seq
 521958633     gbgss103.seq
 414203086     gbgss104.seq
 521611339     gbgss105.seq
 521927041     gbgss106.seq
 521507656     gbgss107.seq
 521417292     gbgss108.seq
 521355629     gbgss109.seq
 522509426     gbgss11.seq
 521387050     gbgss110.seq
 521404328     gbgss111.seq
 521417569     gbgss112.seq
 521421381     gbgss113.seq
 521461565     gbgss114.seq
 521739803     gbgss115.seq
  51160519     gbgss116.seq
 522427889     gbgss117.seq
 521906427     gbgss118.seq
 521715183     gbgss119.seq
 522360554     gbgss12.seq
 521910578     gbgss120.seq
 521801022     gbgss121.seq
 521778126     gbgss122.seq
 521664573     gbgss123.seq
 521674314     gbgss124.seq
 521596811     gbgss125.seq
 521601840     gbgss126.seq
 521944885     gbgss127.seq
 521999322     gbgss128.seq
 197037880     gbgss129.seq
 522395021     gbgss13.seq
 521896526     gbgss130.seq
 521877707     gbgss131.seq
 521878472     gbgss132.seq
 521859355     gbgss133.seq
 521883513     gbgss134.seq
 521765708     gbgss135.seq
 521800319     gbgss136.seq
 521961605     gbgss137.seq
 521595769     gbgss138.seq
 502332380     gbgss139.seq
 522160671     gbgss14.seq
 494759618     gbgss140.seq
 176512414     gbgss141.seq
 520720810     gbgss142.seq
 520564929     gbgss143.seq
 521621243     gbgss144.seq
 521533920     gbgss145.seq
 521698657     gbgss146.seq
 521748080     gbgss147.seq
 521948335     gbgss148.seq
 521896110     gbgss149.seq
 522185886     gbgss15.seq
 521021843     gbgss150.seq
 521055704     gbgss151.seq
 323209869     gbgss152.seq
 521298059     gbgss153.seq
 522084970     gbgss154.seq
 521728999     gbgss155.seq
 522390752     gbgss156.seq
 521976368     gbgss157.seq
 521717488     gbgss158.seq
 521576009     gbgss159.seq
 522037974     gbgss16.seq
 521624211     gbgss160.seq
 521251006     gbgss161.seq
 521188553     gbgss162.seq
 522039427     gbgss163.seq
 522190162     gbgss164.seq
 128926883     gbgss165.seq
 521325269     gbgss166.seq
 521592169     gbgss167.seq
 521883234     gbgss168.seq
 521402770     gbgss169.seq
 521897424     gbgss17.seq
 521379525     gbgss170.seq
 521388419     gbgss171.seq
 521363071     gbgss172.seq
 417175126     gbgss173.seq
 248883249     gbgss174.seq
 248912021     gbgss175.seq
 248658744     gbgss176.seq
 249100815     gbgss177.seq
  31461371     gbgss178.seq
 249107064     gbgss179.seq
 521794298     gbgss18.seq
 249096537     gbgss180.seq
 249095770     gbgss181.seq
 249055895     gbgss182.seq
 223175840     gbgss183.seq
 248935605     gbgss184.seq
 248867864     gbgss185.seq
 248938271     gbgss186.seq
 248799219     gbgss187.seq
 193065001     gbgss188.seq
 249063412     gbgss189.seq
 298130634     gbgss19.seq
 249156170     gbgss190.seq
 249179792     gbgss191.seq
 249191704     gbgss192.seq
 248762289     gbgss193.seq
  70806387     gbgss194.seq
 248436329     gbgss195.seq
   2100461     gbgss196.seq
  80022020     gbgss197.seq
 248581172     gbgss198.seq
 248900832     gbgss199.seq
 522097000     gbgss2.seq
 521933794     gbgss20.seq
  87008754     gbgss200.seq
 248654420     gbgss201.seq
 248666314     gbgss202.seq
 248642086     gbgss203.seq
 201078896     gbgss204.seq
 248918906     gbgss205.seq
 248757070     gbgss206.seq
 248603829     gbgss207.seq
 244913372     gbgss208.seq
 248618523     gbgss209.seq
 522124463     gbgss21.seq
 248644924     gbgss210.seq
 248938283     gbgss211.seq
 243274459     gbgss212.seq
 248461184     gbgss213.seq
 248513057     gbgss214.seq
 249046926     gbgss215.seq
 249029360     gbgss216.seq
 126057159     gbgss217.seq
 248881809     gbgss218.seq
 248688250     gbgss219.seq
 522085779     gbgss22.seq
 248758898     gbgss220.seq
 248655791     gbgss221.seq
  91650785     gbgss222.seq
 248402364     gbgss223.seq
 248367912     gbgss224.seq
 248479482     gbgss225.seq
 248479689     gbgss226.seq
 248585932     gbgss227.seq
 145393060     gbgss228.seq
 248641288     gbgss229.seq
 521864563     gbgss23.seq
 248649538     gbgss230.seq
 248629475     gbgss231.seq
 248665759     gbgss232.seq
  84639050     gbgss233.seq
 248547784     gbgss234.seq
 248674373     gbgss235.seq
 248666634     gbgss236.seq
 248670827     gbgss237.seq
 248937162     gbgss238.seq
 248868569     gbgss239.seq
 521786199     gbgss24.seq
 107127255     gbgss240.seq
 248844719     gbgss241.seq
 248836578     gbgss242.seq
 248830164     gbgss243.seq
  55933471     gbgss244.seq
  53076689     gbgss245.seq
 248681722     gbgss246.seq
 248660031     gbgss247.seq
 248671316     gbgss248.seq
 248526381     gbgss249.seq
 521977447     gbgss25.seq
 248704346     gbgss250.seq
 248714189     gbgss251.seq
 219893284     gbgss252.seq
 248724550     gbgss253.seq
 248742121     gbgss254.seq
 248757350     gbgss255.seq
 248746842     gbgss256.seq
  26340705     gbgss257.seq
 248764805     gbgss258.seq
 248729658     gbgss259.seq
 521890147     gbgss26.seq
 248668496     gbgss260.seq
 248951636     gbgss261.seq
 248815702     gbgss262.seq
 248836293     gbgss263.seq
 189186111     gbgss264.seq
 248389699     gbgss265.seq
 248474244     gbgss266.seq
 248498578     gbgss267.seq
 226335896     gbgss268.seq
 248466150     gbgss269.seq
 522079321     gbgss27.seq
 248612321     gbgss270.seq
 248819733     gbgss271.seq
 248978294     gbgss272.seq
 249094812     gbgss273.seq
 249148339     gbgss274.seq
 151268526     gbgss275.seq
 249147512     gbgss276.seq
 249131291     gbgss277.seq
 248821087     gbgss278.seq
 248842990     gbgss279.seq
 521834765     gbgss28.seq
 231268569     gbgss280.seq
 248815183     gbgss281.seq
 249155815     gbgss282.seq
 249156659     gbgss283.seq
 248868547     gbgss284.seq
 248825245     gbgss285.seq
 121352082     gbgss286.seq
 248672544     gbgss287.seq
 248689514     gbgss288.seq
 248685000     gbgss289.seq
 522338082     gbgss29.seq
 248673033     gbgss290.seq
 220808522     gbgss291.seq
 248548505     gbgss292.seq
 248539863     gbgss293.seq
 248468200     gbgss294.seq
 248500185     gbgss295.seq
  91068247     gbgss296.seq
 248440009     gbgss297.seq
 248496447     gbgss298.seq
 248501722     gbgss299.seq
 522178613     gbgss3.seq
 521804579     gbgss30.seq
 248697173     gbgss300.seq
 248840513     gbgss301.seq
 248899493     gbgss302.seq
 141428035     gbgss303.seq
  59102415     gbgss31.seq
 521749205     gbgss32.seq
 521458259     gbgss33.seq
 521434168     gbgss34.seq
 521418324     gbgss35.seq
 521507720     gbgss36.seq
 521736011     gbgss37.seq
 521781382     gbgss38.seq
 496349538     gbgss39.seq
 522279575     gbgss4.seq
 521866085     gbgss40.seq
 521856864     gbgss41.seq
 522034029     gbgss42.seq
  38200232     gbgss43.seq
 521908510     gbgss44.seq
 522048035     gbgss45.seq
 521906218     gbgss46.seq
 521836127     gbgss47.seq
 225090107     gbgss48.seq
 522080390     gbgss49.seq
 159427852     gbgss5.seq
 522130775     gbgss50.seq
 522125948     gbgss51.seq
 521929079     gbgss52.seq
 521902014     gbgss53.seq
 521936753     gbgss54.seq
 521850295     gbgss55.seq
 521854620     gbgss56.seq
 521983130     gbgss57.seq
 521762873     gbgss58.seq
 521946220     gbgss59.seq
 522338983     gbgss6.seq
  46208452     gbgss60.seq
 522054841     gbgss61.seq
 522180381     gbgss62.seq
 522181383     gbgss63.seq
 458024711     gbgss64.seq
 522251891     gbgss65.seq
 522076244     gbgss66.seq
 522001949     gbgss67.seq
 521651245     gbgss68.seq
 521716175     gbgss69.seq
 522287827     gbgss7.seq
 520895712     gbgss70.seq
 522024804     gbgss71.seq
 522079557     gbgss72.seq
 522013173     gbgss73.seq
 522012344     gbgss74.seq
 521855905     gbgss75.seq
 521613207     gbgss76.seq
  49794105     gbgss77.seq
 521538415     gbgss78.seq
 521920661     gbgss79.seq
 522298703     gbgss8.seq
 521502609     gbgss80.seq
 521344927     gbgss81.seq
 521619857     gbgss82.seq
 522427189     gbgss83.seq
 522247721     gbgss84.seq
 522333877     gbgss85.seq
 522289065     gbgss86.seq
 522270894     gbgss87.seq
 522306773     gbgss88.seq
 385059599     gbgss89.seq
 522541277     gbgss9.seq
 522198602     gbgss90.seq
 522223384     gbgss91.seq
 522271656     gbgss92.seq
 522290766     gbgss93.seq
 522269971     gbgss94.seq
 522217041     gbgss95.seq
 522220331     gbgss96.seq
 522243583     gbgss97.seq
 522244462     gbgss98.seq
 522237458     gbgss99.seq
 249241620     gbhtc1.seq
 248251780     gbhtc10.seq
 248598610     gbhtc11.seq
 144784741     gbhtc12.seq
 249117751     gbhtc13.seq
 248567064     gbhtc14.seq
 150942435     gbhtc15.seq
 249519676     gbhtc2.seq
 249520696     gbhtc3.seq
 249533552     gbhtc4.seq
 249445918     gbhtc5.seq
 249375990     gbhtc6.seq
 249116160     gbhtc7.seq
  84998539     gbhtc8.seq
 248989225     gbhtc9.seq
 249919153     gbhtg1.seq
 249935836     gbhtg10.seq
 249898576     gbhtg100.seq
 249852524     gbhtg101.seq
 249535042     gbhtg102.seq
 249889459     gbhtg103.seq
   3688160     gbhtg104.seq
 249800075     gbhtg105.seq
 249873423     gbhtg106.seq
 249831755     gbhtg107.seq
 249889564     gbhtg108.seq
 249966252     gbhtg109.seq
    799293     gbhtg11.seq
 249770747     gbhtg110.seq
 167846999     gbhtg111.seq
 249851942     gbhtg112.seq
 249939795     gbhtg113.seq
 249870722     gbhtg114.seq
 249909675     gbhtg115.seq
 249769671     gbhtg116.seq
 249967908     gbhtg117.seq
 249944117     gbhtg118.seq
 219057303     gbhtg119.seq
 249868150     gbhtg12.seq
 249829964     gbhtg120.seq
 249879699     gbhtg121.seq
 249966184     gbhtg122.seq
 249884839     gbhtg123.seq
 249896355     gbhtg124.seq
 249950772     gbhtg125.seq
 249847034     gbhtg126.seq
 249920794     gbhtg127.seq
 249843961     gbhtg128.seq
 249906927     gbhtg129.seq
 249954412     gbhtg13.seq
 249736436     gbhtg130.seq
    526879     gbhtg131.seq
 249657899     gbhtg132.seq
 248470536     gbhtg133.seq
 246160992     gbhtg134.seq
 249667321     gbhtg135.seq
 249935302     gbhtg136.seq
 141385226     gbhtg137.seq
 249654318     gbhtg138.seq
 249823531     gbhtg139.seq
 249572144     gbhtg14.seq
 249804865     gbhtg140.seq
 249896134     gbhtg141.seq
 249813210     gbhtg142.seq
 134507510     gbhtg143.seq
 249941270     gbhtg144.seq
 249798909     gbhtg145.seq
 249818887     gbhtg146.seq
 249889499     gbhtg147.seq
 249716481     gbhtg148.seq
 249776382     gbhtg149.seq
 249759969     gbhtg15.seq
 249858818     gbhtg150.seq
 249884448     gbhtg151.seq
 249978083     gbhtg152.seq
 249340146     gbhtg153.seq
 240878684     gbhtg154.seq
 249725738     gbhtg16.seq
 249153261     gbhtg17.seq
 249967707     gbhtg18.seq
 249644077     gbhtg19.seq
 249965224     gbhtg2.seq
 249968559     gbhtg20.seq
 237128242     gbhtg21.seq
 249744362     gbhtg22.seq
 249850450     gbhtg23.seq
 249969276     gbhtg24.seq
 249905147     gbhtg25.seq
 249744537     gbhtg26.seq
 249873073     gbhtg27.seq
 249943900     gbhtg28.seq
 249822796     gbhtg29.seq
 249964185     gbhtg3.seq
 249975125     gbhtg30.seq
 225308603     gbhtg31.seq
 249809694     gbhtg32.seq
 249901546     gbhtg33.seq
 249911478     gbhtg34.seq
 249900907     gbhtg35.seq
 249840804     gbhtg36.seq
 249797332     gbhtg37.seq
 249749931     gbhtg38.seq
 249608861     gbhtg39.seq
 249939536     gbhtg4.seq
 249820205     gbhtg40.seq
 224341810     gbhtg41.seq
 249856186     gbhtg42.seq
 249766073     gbhtg43.seq
 249956077     gbhtg44.seq
 249761282     gbhtg45.seq
 249952973     gbhtg46.seq
 249693087     gbhtg47.seq
 249849728     gbhtg48.seq
 249877767     gbhtg49.seq
 249892890     gbhtg5.seq
 249886034     gbhtg50.seq
 234806350     gbhtg51.seq
 249721503     gbhtg52.seq
 249957951     gbhtg53.seq
 249770763     gbhtg54.seq
 249706591     gbhtg55.seq
 249946653     gbhtg56.seq
  18794743     gbhtg57.seq
 249847082     gbhtg58.seq
 249814632     gbhtg59.seq
 249976728     gbhtg6.seq
 249983755     gbhtg60.seq
 249909487     gbhtg61.seq
 225117385     gbhtg62.seq
 249870223     gbhtg63.seq
 249893600     gbhtg64.seq
 249785570     gbhtg65.seq
 249748161     gbhtg66.seq
 249813247     gbhtg67.seq
  16218631     gbhtg68.seq
 249969751     gbhtg69.seq
 249792485     gbhtg7.seq
 249868129     gbhtg70.seq
 249949360     gbhtg71.seq
 249753364     gbhtg72.seq
 223400888     gbhtg73.seq
 249933093     gbhtg74.seq
 249872582     gbhtg75.seq
 249837217     gbhtg76.seq
 249937956     gbhtg77.seq
 235159885     gbhtg78.seq
 249866049     gbhtg79.seq
 249809049     gbhtg8.seq
 249964523     gbhtg80.seq
 249852745     gbhtg81.seq
 249879093     gbhtg82.seq
 202287872     gbhtg83.seq
 249856467     gbhtg84.seq
 249933696     gbhtg85.seq
 249853639     gbhtg86.seq
 249872937     gbhtg87.seq
 206007602     gbhtg88.seq
 249876374     gbhtg89.seq
 249937148     gbhtg9.seq
 249862442     gbhtg90.seq
 249766212     gbhtg91.seq
 249878098     gbhtg92.seq
 194400971     gbhtg93.seq
 249961002     gbhtg94.seq
 249970885     gbhtg95.seq
 249861638     gbhtg96.seq
 249785608     gbhtg97.seq
 161649781     gbhtg98.seq
 249859736     gbhtg99.seq
 247383467     gbinv1.seq
 246403205     gbinv10.seq
 249066703     gbinv100.seq
 249455566     gbinv101.seq
 249466633     gbinv102.seq
 249333532     gbinv103.seq
  79829301     gbinv104.seq
 249377473     gbinv105.seq
 249875763     gbinv106.seq
 249788266     gbinv107.seq
 249902000     gbinv108.seq
 249740854     gbinv109.seq
 247942729     gbinv11.seq
 249502584     gbinv110.seq
 249795782     gbinv111.seq
  88799608     gbinv112.seq
 249738245     gbinv113.seq
 249605315     gbinv114.seq
 249910922     gbinv115.seq
 249633619     gbinv116.seq
 249790574     gbinv117.seq
 249345024     gbinv118.seq
 249604179     gbinv119.seq
 249094022     gbinv12.seq
 249724781     gbinv120.seq
 249303223     gbinv121.seq
 151008199     gbinv122.seq
 248652115     gbinv123.seq
 249493176     gbinv124.seq
 249674112     gbinv125.seq
 249476315     gbinv126.seq
 249915749     gbinv127.seq
 249586639     gbinv128.seq
 243045836     gbinv129.seq
 246658739     gbinv13.seq
  52917687     gbinv130.seq
 249870848     gbinv131.seq
 249219731     gbinv132.seq
 249909822     gbinv133.seq
 249447726     gbinv134.seq
  28299519     gbinv135.seq
 249442749     gbinv136.seq
 249123508     gbinv137.seq
  59646188     gbinv138.seq
 248533283     gbinv139.seq
 182585856     gbinv14.seq
 248684169     gbinv140.seq
 249825507     gbinv141.seq
 249739033     gbinv142.seq
 147926547     gbinv143.seq
 249585935     gbinv144.seq
 249458505     gbinv145.seq
 249275721     gbinv146.seq
 249007364     gbinv147.seq
 248635921     gbinv148.seq
 248236320     gbinv149.seq
 246531817     gbinv15.seq
 248649590     gbinv150.seq
 247921606     gbinv151.seq
 246615971     gbinv152.seq
 238541418     gbinv153.seq
 246534528     gbinv16.seq
 246360157     gbinv17.seq
 164061890     gbinv18.seq
 247317495     gbinv19.seq
 247182139     gbinv2.seq
 246958228     gbinv20.seq
 247257618     gbinv21.seq
 245902357     gbinv22.seq
 246320721     gbinv23.seq
   1700290     gbinv24.seq
 228606913     gbinv25.seq
 175319053     gbinv26.seq
 247353728     gbinv27.seq
 246132193     gbinv28.seq
 224677126     gbinv29.seq
 249738028     gbinv3.seq
 246206234     gbinv30.seq
 246312592     gbinv31.seq
 246098106     gbinv32.seq
 246112892     gbinv33.seq
 180508098     gbinv34.seq
 246724576     gbinv35.seq
 246137737     gbinv36.seq
 246433227     gbinv37.seq
 246288894     gbinv38.seq
 186424008     gbinv39.seq
 204598468     gbinv4.seq
 246274118     gbinv40.seq
 246223401     gbinv41.seq
 246326040     gbinv42.seq
 246364585     gbinv43.seq
 123793578     gbinv44.seq
 245774685     gbinv45.seq
 245794958     gbinv46.seq
 245616324     gbinv47.seq
 246125170     gbinv48.seq
 102145825     gbinv49.seq
 248139207     gbinv5.seq
 246276872     gbinv50.seq
 245789328     gbinv51.seq
 245710622     gbinv52.seq
 245598409     gbinv53.seq
 109800519     gbinv54.seq
 245774866     gbinv55.seq
 245829271     gbinv56.seq
 245869232     gbinv57.seq
 245833596     gbinv58.seq
 245926645     gbinv59.seq
 247052749     gbinv6.seq
 245846650     gbinv60.seq
 199657953     gbinv61.seq
 246538660     gbinv62.seq
 246603306     gbinv63.seq
 246191321     gbinv64.seq
 246269456     gbinv65.seq
 246482566     gbinv66.seq
 243593335     gbinv67.seq
 248936888     gbinv68.seq
   3090084     gbinv69.seq
 247985485     gbinv7.seq
 248859084     gbinv70.seq
 248594183     gbinv71.seq
 248375587     gbinv72.seq
 200162106     gbinv73.seq
 249433116     gbinv74.seq
 249541367     gbinv75.seq
 247414776     gbinv76.seq
 249735371     gbinv77.seq
 249834859     gbinv78.seq
 249622160     gbinv79.seq
 231941092     gbinv8.seq
 249682025     gbinv80.seq
 220938359     gbinv81.seq
 249873697     gbinv82.seq
 249774169     gbinv83.seq
 249565387     gbinv84.seq
 249079309     gbinv85.seq
  51444196     gbinv86.seq
 249293006     gbinv87.seq
 249904433     gbinv88.seq
 249840048     gbinv89.seq
 246814221     gbinv9.seq
 249582643     gbinv90.seq
 249936667     gbinv91.seq
 249889090     gbinv92.seq
 249821847     gbinv93.seq
 249444246     gbinv94.seq
 249148498     gbinv95.seq
 223890431     gbinv96.seq
 248674114     gbinv97.seq
 249792318     gbinv98.seq
 249585380     gbinv99.seq
 249008835     gbmam1.seq
 338653931     gbmam10.seq
 315434407     gbmam11.seq
 162425847     gbmam12.seq
 150157334     gbmam13.seq
 159032538     gbmam14.seq
 136269230     gbmam15.seq
 122412955     gbmam16.seq
 248159396     gbmam17.seq
 202955071     gbmam18.seq
 208310866     gbmam19.seq
 249519021     gbmam2.seq
 209752346     gbmam20.seq
 197940543     gbmam21.seq
 230561841     gbmam22.seq
 220222444     gbmam23.seq
 123191120     gbmam24.seq
 191446162     gbmam25.seq
   9943649     gbmam26.seq
  43990057     gbmam27.seq
  91323211     gbmam28.seq
  88811754     gbmam29.seq
  85576153     gbmam3.seq
   6365657     gbmam30.seq
  20918368     gbmam31.seq
 247230513     gbmam32.seq
 202306696     gbmam33.seq
 246783059     gbmam34.seq
 246749371     gbmam35.seq
 247086155     gbmam36.seq
 242185962     gbmam37.seq
 249678496     gbmam38.seq
   3848453     gbmam39.seq
  82805431     gbmam4.seq
  71293630     gbmam5.seq
  22570876     gbmam6.seq
   1268710     gbmam7.seq
   2477871     gbmam8.seq
 375834657     gbmam9.seq
  26871296     gbnew.txt
 247016471     gbpat1.seq
 248211273     gbpat10.seq
 247497490     gbpat100.seq
 247502208     gbpat101.seq
 247504293     gbpat102.seq
 247505203     gbpat103.seq
 147255929     gbpat104.seq
 245198790     gbpat105.seq
 247355645     gbpat106.seq
 248369348     gbpat107.seq
 249770979     gbpat108.seq
 248160768     gbpat109.seq
 178363745     gbpat11.seq
 190629335     gbpat110.seq
 246842211     gbpat111.seq
 246498579     gbpat112.seq
 247411218     gbpat113.seq
  79630198     gbpat114.seq
 248112425     gbpat115.seq
 247362141     gbpat116.seq
 247469497     gbpat117.seq
 247782641     gbpat118.seq
 248073239     gbpat119.seq
 247641287     gbpat12.seq
  66592255     gbpat120.seq
 247286955     gbpat121.seq
 247897132     gbpat122.seq
 245014887     gbpat123.seq
 246398856     gbpat124.seq
 158318500     gbpat125.seq
 245491398     gbpat126.seq
 247821183     gbpat127.seq
 232922383     gbpat128.seq
 248194762     gbpat129.seq
 248647813     gbpat13.seq
 249667639     gbpat130.seq
 247971299     gbpat131.seq
 247591442     gbpat132.seq
 249369707     gbpat133.seq
  66704646     gbpat134.seq
 249521285     gbpat135.seq
 247850032     gbpat136.seq
 247498251     gbpat137.seq
 248095431     gbpat138.seq
 248314034     gbpat139.seq
 248665034     gbpat14.seq
  18315777     gbpat140.seq
 247823649     gbpat141.seq
 247412132     gbpat142.seq
 247446077     gbpat143.seq
 247557988     gbpat144.seq
  46542320     gbpat145.seq
 247929134     gbpat146.seq
 247745597     gbpat147.seq
 247404609     gbpat148.seq
 231335480     gbpat149.seq
 248432398     gbpat15.seq
 247157441     gbpat150.seq
 246114552     gbpat151.seq
 246911474     gbpat152.seq
  85307000     gbpat153.seq
 246214518     gbpat154.seq
 247272595     gbpat155.seq
 248428726     gbpat156.seq
  63176303     gbpat157.seq
 246194626     gbpat158.seq
 246131633     gbpat159.seq
 248587976     gbpat16.seq
 247071713     gbpat160.seq
 247606041     gbpat161.seq
 247798621     gbpat162.seq
 246461357     gbpat163.seq
 220993334     gbpat164.seq
 246219941     gbpat165.seq
 246220201     gbpat166.seq
 246220201     gbpat167.seq
 217209465     gbpat168.seq
 246228209     gbpat169.seq
  74949389     gbpat17.seq
 246552944     gbpat170.seq
 246991774     gbpat171.seq
  12281335     gbpat172.seq
 247632194     gbpat173.seq
 248710659     gbpat174.seq
 247548800     gbpat175.seq
 246949563     gbpat176.seq
  91098681     gbpat177.seq
 246707500     gbpat178.seq
 248266605     gbpat179.seq
 248092004     gbpat18.seq
 246953577     gbpat180.seq
 247226822     gbpat181.seq
   9082408     gbpat182.seq
 247336062     gbpat183.seq
 247778657     gbpat184.seq
 247794882     gbpat185.seq
 173562922     gbpat186.seq
 247813296     gbpat187.seq
 248712274     gbpat188.seq
 247749230     gbpat189.seq
 248001238     gbpat19.seq
 247990500     gbpat190.seq
  76132418     gbpat191.seq
 247466193     gbpat192.seq
 247845812     gbpat193.seq
 248026134     gbpat194.seq
 248526488     gbpat195.seq
 247668945     gbpat196.seq
 247222044     gbpat197.seq
  92410186     gbpat198.seq
 248695784     gbpat199.seq
 247469465     gbpat2.seq
 248637574     gbpat20.seq
 248713767     gbpat200.seq
 248826471     gbpat201.seq
 248473241     gbpat202.seq
 213276661     gbpat203.seq
 247894570     gbpat204.seq
 247893519     gbpat205.seq
 249631366     gbpat206.seq
 248405044     gbpat207.seq
 180060830     gbpat208.seq
 249498057     gbpat209.seq
 248136485     gbpat21.seq
 247318856     gbpat210.seq
 247968904     gbpat211.seq
 248922739     gbpat212.seq
 248577424     gbpat213.seq
 248181227     gbpat214.seq
  17960780     gbpat215.seq
 248510120     gbpat216.seq
 248037715     gbpat217.seq
 247892419     gbpat218.seq
 119207545     gbpat219.seq
 184966242     gbpat22.seq
 249185157     gbpat220.seq
 249422385     gbpat221.seq
 249147738     gbpat222.seq
 249471536     gbpat223.seq
 249420591     gbpat224.seq
 249429246     gbpat225.seq
 248879598     gbpat226.seq
 248350660     gbpat227.seq
  71242384     gbpat228.seq
 248448511     gbpat229.seq
 248216222     gbpat23.seq
 248508374     gbpat230.seq
 248738524     gbpat231.seq
 248523798     gbpat232.seq
 224625918     gbpat233.seq
 248789724     gbpat234.seq
 247697380     gbpat235.seq
 246989930     gbpat236.seq
 247601985     gbpat237.seq
  66123000     gbpat238.seq
 247730923     gbpat239.seq
 248072336     gbpat24.seq
 248303760     gbpat240.seq
 248768267     gbpat241.seq
 249465062     gbpat242.seq
 249493452     gbpat243.seq
 243522691     gbpat244.seq
 246447981     gbpat245.seq
 248067539     gbpat246.seq
 247873697     gbpat247.seq
 248007318     gbpat248.seq
  35396174     gbpat249.seq
 247796472     gbpat25.seq
 248015023     gbpat250.seq
 247961952     gbpat251.seq
 246397626     gbpat252.seq
 142737240     gbpat253.seq
 246334798     gbpat254.seq
 246519590     gbpat255.seq
 246376913     gbpat256.seq
  72941553     gbpat257.seq
 246376913     gbpat258.seq
 246449149     gbpat259.seq
 247540461     gbpat26.seq
 247447256     gbpat260.seq
 248368967     gbpat261.seq
 246819152     gbpat262.seq
 213887720     gbpat263.seq
 248558979     gbpat264.seq
 249378355     gbpat265.seq
 249737969     gbpat266.seq
 247658953     gbpat267.seq
 249498554     gbpat268.seq
 249520932     gbpat269.seq
  70625664     gbpat27.seq
  35605530     gbpat270.seq
 249430639     gbpat271.seq
 249430535     gbpat272.seq
 249429860     gbpat273.seq
 249430666     gbpat274.seq
 249094240     gbpat275.seq
 248062481     gbpat276.seq
 248274793     gbpat277.seq
 248162116     gbpat278.seq
 207222938     gbpat279.seq
 248662795     gbpat28.seq
 247924031     gbpat280.seq
 247720632     gbpat281.seq
 246136169     gbpat282.seq
 246951151     gbpat283.seq
 141834015     gbpat284.seq
 246782699     gbpat285.seq
 247873988     gbpat286.seq
 248018194     gbpat287.seq
 248019699     gbpat288.seq
 248021017     gbpat289.seq
 248776258     gbpat29.seq
 202944650     gbpat290.seq
 247763468     gbpat3.seq
 248391742     gbpat30.seq
 248645857     gbpat31.seq
 248206020     gbpat32.seq
 179050118     gbpat33.seq
 248349210     gbpat34.seq
 248324645     gbpat35.seq
 248294374     gbpat36.seq
 248679179     gbpat37.seq
 247938421     gbpat38.seq
 247907296     gbpat39.seq
 248000039     gbpat4.seq
 248386296     gbpat40.seq
 103268211     gbpat41.seq
 248659015     gbpat42.seq
 248548083     gbpat43.seq
 248095609     gbpat44.seq
 247986961     gbpat45.seq
 248264416     gbpat46.seq
 248425113     gbpat47.seq
 248695750     gbpat48.seq
 248414230     gbpat49.seq
  70920468     gbpat5.seq
 171225969     gbpat50.seq
 248116718     gbpat51.seq
 247660367     gbpat52.seq
 248370468     gbpat53.seq
 247250775     gbpat54.seq
 221808583     gbpat55.seq
 249612223     gbpat56.seq
 247404121     gbpat57.seq
 246159905     gbpat58.seq
 162822946     gbpat59.seq
 247671075     gbpat6.seq
 247604169     gbpat60.seq
 246399220     gbpat61.seq
 247724057     gbpat62.seq
 248285940     gbpat63.seq
 135056735     gbpat64.seq
 249006752     gbpat65.seq
 248766879     gbpat66.seq
 248695400     gbpat67.seq
 248693781     gbpat68.seq
 248692782     gbpat69.seq
 247627505     gbpat7.seq
 248378393     gbpat70.seq
 143462784     gbpat71.seq
 247537124     gbpat72.seq
 247598759     gbpat73.seq
 247597893     gbpat74.seq
 242999475     gbpat75.seq
 248967471     gbpat76.seq
 244457728     gbpat77.seq
 247876506     gbpat78.seq
 249984152     gbpat79.seq
 248151781     gbpat8.seq
 159266319     gbpat80.seq
 247885995     gbpat81.seq
 247885349     gbpat82.seq
 247885134     gbpat83.seq
 247885350     gbpat84.seq
 248674615     gbpat85.seq
 248708316     gbpat86.seq
  98814486     gbpat87.seq
 247989145     gbpat88.seq
 249781167     gbpat89.seq
 248146440     gbpat9.seq
 247691737     gbpat90.seq
 247494164     gbpat91.seq
 247514088     gbpat92.seq
 247539652     gbpat93.seq
 142908014     gbpat94.seq
 247630120     gbpat95.seq
 247497602     gbpat96.seq
 247498265     gbpat97.seq
 247498779     gbpat98.seq
 194852822     gbpat99.seq
 242970550     gbphg1.seq
 243149009     gbphg2.seq
 242962589     gbphg3.seq
  15586800     gbphg4.seq
 247686498     gbpln1.seq
 155760905     gbpln10.seq
  62494841     gbpln100.seq
 247381957     gbpln101.seq
 247385380     gbpln102.seq
 247274543     gbpln103.seq
 247206811     gbpln104.seq
 246901446     gbpln105.seq
  26750739     gbpln106.seq
 247128612     gbpln107.seq
 247120440     gbpln108.seq
 247753945     gbpln109.seq
 247836222     gbpln11.seq
 247529172     gbpln110.seq
  91104124     gbpln111.seq
 246857562     gbpln112.seq
 247016942     gbpln113.seq
 247629514     gbpln114.seq
 211276380     gbpln115.seq
 247332283     gbpln116.seq
 247286150     gbpln117.seq
 247141887     gbpln118.seq
 160487591     gbpln119.seq
 248741259     gbpln12.seq
 247240299     gbpln120.seq
 247185174     gbpln121.seq
 247452989     gbpln122.seq
 128262478     gbpln123.seq
 247273320     gbpln124.seq
 247318764     gbpln125.seq
 247307402     gbpln126.seq
 145823536     gbpln127.seq
 247484909     gbpln128.seq
 247096896     gbpln129.seq
 248464333     gbpln13.seq
 247220665     gbpln130.seq
 156136297     gbpln131.seq
 247287754     gbpln132.seq
 247376299     gbpln133.seq
 198530026     gbpln134.seq
 242809011     gbpln135.seq
 240376439     gbpln136.seq
 230979910     gbpln137.seq
 230146888     gbpln138.seq
 248452658     gbpln139.seq
 247975311     gbpln14.seq
 204529417     gbpln140.seq
 239897414     gbpln141.seq
 203498697     gbpln142.seq
 209308151     gbpln143.seq
 248507350     gbpln144.seq
  71607035     gbpln145.seq
 230137869     gbpln15.seq
 249415481     gbpln16.seq
 249451261     gbpln17.seq
 249433616     gbpln18.seq
  20472574     gbpln19.seq
 247388219     gbpln2.seq
 241026336     gbpln20.seq
 248620844     gbpln21.seq
 247443179     gbpln22.seq
 248668911     gbpln23.seq
 242963008     gbpln24.seq
 231415728     gbpln25.seq
 232511788     gbpln26.seq
 235239775     gbpln27.seq
 199014935     gbpln28.seq
 195869825     gbpln29.seq
 248232075     gbpln3.seq
 247523704     gbpln30.seq
  97776952     gbpln31.seq
 247648024     gbpln32.seq
 135372529     gbpln33.seq
 203989245     gbpln34.seq
  84436504     gbpln35.seq
 191631679     gbpln36.seq
 224133729     gbpln37.seq
 240516999     gbpln38.seq
 246573372     gbpln39.seq
 249078524     gbpln4.seq
 247093472     gbpln40.seq
 246934695     gbpln41.seq
 246176331     gbpln42.seq
 149898057     gbpln43.seq
 246174910     gbpln44.seq
 246820617     gbpln45.seq
 246630479     gbpln46.seq
 246281348     gbpln47.seq
 248600327     gbpln48.seq
 248901786     gbpln49.seq
 249718669     gbpln5.seq
  59099032     gbpln50.seq
 248360112     gbpln51.seq
 248117798     gbpln52.seq
 225114796     gbpln53.seq
 237545028     gbpln54.seq
 246931399     gbpln55.seq
 245832376     gbpln56.seq
 246350892     gbpln57.seq
 249208059     gbpln58.seq
 178862183     gbpln59.seq
 249868187     gbpln6.seq
 164620834     gbpln60.seq
  39990531     gbpln61.seq
  74855907     gbpln62.seq
 248258603     gbpln63.seq
 247539796     gbpln64.seq
 247557754     gbpln65.seq
 112679063     gbpln66.seq
 247345608     gbpln67.seq
 247426492     gbpln68.seq
 247321009     gbpln69.seq
 249896567     gbpln7.seq
 247139835     gbpln70.seq
 148699499     gbpln71.seq
 247031216     gbpln72.seq
 247187113     gbpln73.seq
 247855572     gbpln74.seq
 248092191     gbpln75.seq
 245840726     gbpln76.seq
 247804499     gbpln77.seq
 247987657     gbpln78.seq
  49315772     gbpln79.seq
 249915760     gbpln8.seq
 247547251     gbpln80.seq
  49775362     gbpln81.seq
 210355904     gbpln82.seq
 246739853     gbpln83.seq
 185594425     gbpln84.seq
 997331397     gbpln85.seq
  56469301     gbpln86.seq
 215009997     gbpln87.seq
 171793646     gbpln88.seq
 197391132     gbpln89.seq
 247942383     gbpln9.seq
 177950616     gbpln90.seq
 196456251     gbpln91.seq
 189037038     gbpln92.seq
 220764605     gbpln93.seq
 227204478     gbpln94.seq
 224027155     gbpln95.seq
 248372204     gbpln96.seq
 188700002     gbpln97.seq
 246742662     gbpln98.seq
 247457721     gbpln99.seq
 147974658     gbpri1.seq
 249839430     gbpri10.seq
 144942993     gbpri11.seq
 249939563     gbpri12.seq
 249866159     gbpri13.seq
 249871553     gbpri14.seq
 249924551     gbpri15.seq
 249848961     gbpri16.seq
 249852803     gbpri17.seq
 249743104     gbpri18.seq
 249906445     gbpri19.seq
 249009794     gbpri2.seq
 249934697     gbpri20.seq
 249933107     gbpri21.seq
 249942874     gbpri22.seq
 249882681     gbpri23.seq
  75095361     gbpri24.seq
 162653834     gbpri25.seq
 248314985     gbpri26.seq
 246252508     gbpri27.seq
 249551254     gbpri28.seq
 249758243     gbpri29.seq
 249713688     gbpri3.seq
 249971322     gbpri30.seq
 249959294     gbpri31.seq
 249852261     gbpri32.seq
 249326442     gbpri33.seq
 249346308     gbpri34.seq
 247537412     gbpri35.seq
  22843761     gbpri36.seq
 248549878     gbpri37.seq
 249085714     gbpri38.seq
 248362930     gbpri39.seq
 249843004     gbpri4.seq
 247314683     gbpri40.seq
 246976147     gbpri41.seq
 200182311     gbpri42.seq
 246989769     gbpri43.seq
 246191725     gbpri44.seq
 246761084     gbpri45.seq
 246361975     gbpri46.seq
 132768409     gbpri47.seq
 247089754     gbpri48.seq
 247419936     gbpri49.seq
 249963646     gbpri5.seq
 246125304     gbpri50.seq
 133673935     gbpri51.seq
 314294173     gbpri52.seq
 258775295     gbpri53.seq
 268666434     gbpri54.seq
 249261950     gbpri55.seq
 184444145     gbpri56.seq
 249914959     gbpri6.seq
 249925070     gbpri7.seq
 249894359     gbpri8.seq
 249747777     gbpri9.seq
    456802     gbrel.txt
 248704190     gbrod1.seq
 249796614     gbrod10.seq
  81897661     gbrod11.seq
 249854715     gbrod12.seq
 249768672     gbrod13.seq
 249976201     gbrod14.seq
 249636398     gbrod15.seq
 249938262     gbrod16.seq
 249869336     gbrod17.seq
 249923998     gbrod18.seq
 249192553     gbrod19.seq
 249949011     gbrod2.seq
 248988204     gbrod20.seq
 249823194     gbrod21.seq
 204866397     gbrod22.seq
 249324970     gbrod23.seq
 248186486     gbrod24.seq
 248909479     gbrod25.seq
 249963041     gbrod26.seq
 247556299     gbrod27.seq
 247477615     gbrod28.seq
 246785076     gbrod29.seq
 249842893     gbrod3.seq
 216645948     gbrod30.seq
 249877341     gbrod4.seq
 249819708     gbrod5.seq
 249979633     gbrod6.seq
 249869235     gbrod7.seq
 249773862     gbrod8.seq
 249962405     gbrod9.seq
 248896459     gbsts1.seq
 249245114     gbsts10.seq
 210330813     gbsts11.seq
 249243512     gbsts12.seq
 249145010     gbsts13.seq
 248693581     gbsts14.seq
 248539330     gbsts15.seq
  25904704     gbsts16.seq
 248561611     gbsts17.seq
 248767757     gbsts18.seq
 248691435     gbsts19.seq
 248903892     gbsts2.seq
 186815982     gbsts20.seq
 249144030     gbsts3.seq
 248988036     gbsts4.seq
  41893598     gbsts5.seq
 249292044     gbsts6.seq
 249293668     gbsts7.seq
 249291084     gbsts8.seq
 249273135     gbsts9.seq
 247371913     gbsyn1.seq
  15704652     gbsyn10.seq
 248399446     gbsyn2.seq
 248345503     gbsyn3.seq
 249917587     gbsyn4.seq
 249933018     gbsyn5.seq
 249905461     gbsyn6.seq
 249436262     gbsyn7.seq
 246499316     gbsyn8.seq
 247266585     gbsyn9.seq
 248284949     gbtsa1.seq
  56100825     gbtsa10.seq
 248821918     gbtsa100.seq
 248925489     gbtsa101.seq
 248855887     gbtsa102.seq
 249071348     gbtsa103.seq
 248780578     gbtsa104.seq
 107169693     gbtsa105.seq
 248960313     gbtsa106.seq
 248876134     gbtsa107.seq
 248812979     gbtsa108.seq
 248907374     gbtsa109.seq
 248118331     gbtsa11.seq
 248678347     gbtsa110.seq
 248603221     gbtsa111.seq
 227617267     gbtsa112.seq
 248469998     gbtsa113.seq
 248309279     gbtsa114.seq
 248867332     gbtsa115.seq
 248667681     gbtsa116.seq
 249187287     gbtsa117.seq
  16440605     gbtsa118.seq
 248504757     gbtsa119.seq
 249112261     gbtsa12.seq
 248692139     gbtsa120.seq
 248617797     gbtsa121.seq
 219584060     gbtsa122.seq
 248504756     gbtsa123.seq
 248901521     gbtsa124.seq
 248842179     gbtsa125.seq
 248621207     gbtsa126.seq
 248676616     gbtsa127.seq
 248928579     gbtsa128.seq
 172413778     gbtsa129.seq
 249088522     gbtsa13.seq
 249149397     gbtsa130.seq
 249113332     gbtsa131.seq
 249153945     gbtsa132.seq
 248990614     gbtsa133.seq
 248769689     gbtsa134.seq
 249113088     gbtsa135.seq
   8218945     gbtsa136.seq
 248910597     gbtsa137.seq
 248951358     gbtsa138.seq
 248864231     gbtsa139.seq
 248710913     gbtsa14.seq
 248951689     gbtsa140.seq
 135674302     gbtsa141.seq
 248771731     gbtsa142.seq
 248753472     gbtsa143.seq
 248812357     gbtsa144.seq
 248922644     gbtsa145.seq
  35710035     gbtsa146.seq
 248540415     gbtsa147.seq
 248864138     gbtsa148.seq
 248258660     gbtsa149.seq
 248700830     gbtsa15.seq
 248974326     gbtsa150.seq
 248774857     gbtsa151.seq
 248746969     gbtsa152.seq
 249125860     gbtsa153.seq
 248658754     gbtsa154.seq
  55717090     gbtsa155.seq
 248834873     gbtsa156.seq
 248829412     gbtsa157.seq
 248894060     gbtsa158.seq
 248920889     gbtsa159.seq
  20025172     gbtsa16.seq
 248412700     gbtsa160.seq
 248542190     gbtsa161.seq
  87978556     gbtsa162.seq
 248551339     gbtsa163.seq
 248669299     gbtsa164.seq
 248872623     gbtsa165.seq
 133206499     gbtsa166.seq
 249274305     gbtsa167.seq
 249340226     gbtsa168.seq
 249367479     gbtsa169.seq
 248934752     gbtsa17.seq
 249407565     gbtsa170.seq
 249446310     gbtsa171.seq
 249471855     gbtsa172.seq
 212034903     gbtsa173.seq
 248893499     gbtsa174.seq
 249133257     gbtsa175.seq
 249077438     gbtsa176.seq
 249431370     gbtsa177.seq
 249458100     gbtsa178.seq
 249498434     gbtsa179.seq
 248888824     gbtsa18.seq
 235072891     gbtsa180.seq
 249553244     gbtsa181.seq
 249557077     gbtsa182.seq
 249445893     gbtsa183.seq
 249428914     gbtsa184.seq
 249422445     gbtsa185.seq
 249414384     gbtsa186.seq
 249412321     gbtsa187.seq
 158431645     gbtsa188.seq
 249411698     gbtsa189.seq
 248775134     gbtsa19.seq
 249412052     gbtsa190.seq
 249407734     gbtsa191.seq
 249406266     gbtsa192.seq
 249406877     gbtsa193.seq
 249407855     gbtsa194.seq
 249392769     gbtsa195.seq
 249024501     gbtsa196.seq
 137011173     gbtsa197.seq
 248743426     gbtsa198.seq
 249337734     gbtsa199.seq
 248411530     gbtsa2.seq
 248964839     gbtsa20.seq
 248741137     gbtsa200.seq
 248801493     gbtsa201.seq
  17136348     gbtsa202.seq
 249216751     gbtsa203.seq
 249332757     gbtsa204.seq
 249426259     gbtsa205.seq
 249053925     gbtsa206.seq
 249118448     gbtsa207.seq
 173732613     gbtsa208.seq
 249117218     gbtsa209.seq
 183717243     gbtsa21.seq
 248905623     gbtsa210.seq
 249269024     gbtsa211.seq
 248782024     gbtsa212.seq
 249267569     gbtsa213.seq
 248801182     gbtsa214.seq
 248930609     gbtsa215.seq
 185462644     gbtsa216.seq
 248781134     gbtsa217.seq
 249385074     gbtsa218.seq
 248671549     gbtsa219.seq
 248864589     gbtsa22.seq
 249069941     gbtsa220.seq
 248804081     gbtsa221.seq
 248677740     gbtsa222.seq
 207868833     gbtsa223.seq
 248932710     gbtsa224.seq
 248965016     gbtsa225.seq
 248713462     gbtsa226.seq
 248999170     gbtsa227.seq
 248629027     gbtsa228.seq
 249053163     gbtsa229.seq
 249114852     gbtsa23.seq
 146248418     gbtsa230.seq
 248787074     gbtsa24.seq
 248595339     gbtsa25.seq
 148239852     gbtsa26.seq
 248797831     gbtsa27.seq
 248315577     gbtsa28.seq
 248095793     gbtsa29.seq
 248462600     gbtsa3.seq
 249256933     gbtsa30.seq
 249331980     gbtsa31.seq
  14556953     gbtsa32.seq
 249145253     gbtsa33.seq
 248693440     gbtsa34.seq
 248467118     gbtsa35.seq
 248513596     gbtsa36.seq
 248567641     gbtsa37.seq
 248541378     gbtsa38.seq
  75464800     gbtsa39.seq
 248304473     gbtsa4.seq
 248619472     gbtsa40.seq
 248701854     gbtsa41.seq
 248702087     gbtsa42.seq
 248879046     gbtsa43.seq
 248596113     gbtsa44.seq
 248409718     gbtsa45.seq
 248651101     gbtsa46.seq
  35395408     gbtsa47.seq
 248675555     gbtsa48.seq
 248914014     gbtsa49.seq
 153310345     gbtsa5.seq
 248510284     gbtsa50.seq
 248406241     gbtsa51.seq
  76804196     gbtsa52.seq
 248546008     gbtsa53.seq
 248582941     gbtsa54.seq
 248492564     gbtsa55.seq
 248859487     gbtsa56.seq
 158735878     gbtsa57.seq
 248731560     gbtsa58.seq
 248634008     gbtsa59.seq
 248435858     gbtsa6.seq
 249148549     gbtsa60.seq
 248780559     gbtsa61.seq
 248897155     gbtsa62.seq
 248836579     gbtsa63.seq
 248839811     gbtsa64.seq
 245139739     gbtsa65.seq
 248685888     gbtsa66.seq
 248935861     gbtsa67.seq
 248991579     gbtsa68.seq
 249035375     gbtsa69.seq
 248776230     gbtsa7.seq
 248809266     gbtsa70.seq
 248590459     gbtsa71.seq
 233189074     gbtsa72.seq
 247943338     gbtsa73.seq
 248809702     gbtsa74.seq
 248564751     gbtsa75.seq
 248675315     gbtsa76.seq
 248545887     gbtsa77.seq
 248967861     gbtsa78.seq
 183333033     gbtsa79.seq
 248537580     gbtsa8.seq
 248776425     gbtsa80.seq
 248715364     gbtsa81.seq
 248900238     gbtsa82.seq
 248901171     gbtsa83.seq
 248530740     gbtsa84.seq
 110996291     gbtsa85.seq
 248752531     gbtsa86.seq
 248668144     gbtsa87.seq
 248445924     gbtsa88.seq
 248637684     gbtsa89.seq
 248462676     gbtsa9.seq
 249086952     gbtsa90.seq
  45737407     gbtsa91.seq
 248581898     gbtsa92.seq
 248723880     gbtsa93.seq
 248686642     gbtsa94.seq
 248797176     gbtsa95.seq
 248974101     gbtsa96.seq
 150133862     gbtsa97.seq
 248920025     gbtsa98.seq
 248917877     gbtsa99.seq
    795117     gbuna1.seq
 245627111     gbvrl1.seq
 246576233     gbvrl10.seq
 246364304     gbvrl11.seq
 245540798     gbvrl12.seq
 245663406     gbvrl13.seq
 245922387     gbvrl14.seq
  77937778     gbvrl15.seq
 245905547     gbvrl16.seq
 246043818     gbvrl17.seq
 245827512     gbvrl18.seq
 245930316     gbvrl19.seq
 245904291     gbvrl2.seq
 225688792     gbvrl20.seq
 246016483     gbvrl21.seq
 245880681     gbvrl22.seq
 246028325     gbvrl23.seq
 245837107     gbvrl24.seq
 142741507     gbvrl25.seq
 245859649     gbvrl26.seq
 245513302     gbvrl27.seq
 246274458     gbvrl28.seq
 245896549     gbvrl29.seq
 245498797     gbvrl3.seq
 245861939     gbvrl30.seq
  75086365     gbvrl31.seq
 246176214     gbvrl32.seq
 246655804     gbvrl33.seq
 246192914     gbvrl34.seq
 246131125     gbvrl35.seq
 246437551     gbvrl36.seq
  37592198     gbvrl37.seq
 246234207     gbvrl38.seq
 246001859     gbvrl39.seq
 245606703     gbvrl4.seq
 246312139     gbvrl40.seq
 246538415     gbvrl41.seq
 219635374     gbvrl42.seq
 246515848     gbvrl43.seq
 246568744     gbvrl44.seq
 246260167     gbvrl45.seq
 246279728     gbvrl46.seq
 246189962     gbvrl47.seq
  13502019     gbvrl48.seq
 245745914     gbvrl5.seq
  86815339     gbvrl6.seq
 246490330     gbvrl7.seq
 246627568     gbvrl8.seq
 246670195     gbvrl9.seq
 247198230     gbvrt1.seq
 249850475     gbvrt10.seq
 249874681     gbvrt11.seq
 137103306     gbvrt12.seq
 249699425     gbvrt13.seq
 249853556     gbvrt14.seq
 249926569     gbvrt15.seq
 248085209     gbvrt16.seq
 246712217     gbvrt17.seq
 246560995     gbvrt18.seq
  61854526     gbvrt19.seq
 249772769     gbvrt2.seq
 246834551     gbvrt20.seq
 248434133     gbvrt21.seq
 246640755     gbvrt22.seq
 246501066     gbvrt23.seq
 246552465     gbvrt24.seq
 108603033     gbvrt25.seq
 247586699     gbvrt26.seq
 246763821     gbvrt27.seq
 246965636     gbvrt28.seq
 196666298     gbvrt29.seq
 248104237     gbvrt3.seq
 247285673     gbvrt30.seq
 246765624     gbvrt31.seq
  30509514     gbvrt32.seq
 246445237     gbvrt33.seq
 190378523     gbvrt34.seq
 246861899     gbvrt35.seq
 246590218     gbvrt36.seq
 246440877     gbvrt37.seq
 118344960     gbvrt38.seq
 248308618     gbvrt39.seq
 248893533     gbvrt4.seq
 247171810     gbvrt40.seq
 120443333     gbvrt41.seq
 247068044     gbvrt42.seq
 247377632     gbvrt43.seq
 243858909     gbvrt44.seq
 242025341     gbvrt45.seq
 246325360     gbvrt46.seq
 248773605     gbvrt47.seq
 247438412     gbvrt48.seq
 249933914     gbvrt49.seq
 229656762     gbvrt5.seq
 249949471     gbvrt50.seq
 249506845     gbvrt51.seq
  92442175     gbvrt52.seq
 247520397     gbvrt53.seq
 179752053     gbvrt54.seq
 246247409     gbvrt55.seq
 227142979     gbvrt56.seq
 249608551     gbvrt57.seq
 234447370     gbvrt58.seq
 249646941     gbvrt59.seq
 247019109     gbvrt6.seq
 249734594     gbvrt60.seq
 249778843     gbvrt61.seq
 249918302     gbvrt62.seq
 248778143     gbvrt63.seq
 140765016     gbvrt64.seq
 248278076     gbvrt7.seq
 248212153     gbvrt8.seq
 249857194     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63628      86429011
BCT10        14157      87882687
BCT100       59         111542017
BCT101       44         107663978
BCT102       42         105130602
BCT103       62         106991504
BCT104       46         108660243
BCT105       32         92188860
BCT106       29         106059433
BCT107       23         100309671
BCT108       22         102815068
BCT109       22         103205495
BCT11        2360       103149777
BCT110       22         103088812
BCT111       22         103089220
BCT112       22         101716543
BCT113       21         101640086
BCT114       23         106816508
BCT115       46         109374731
BCT116       38         105562991
BCT117       6          15890032
BCT118       50         111764861
BCT119       60         109369965
BCT12        70         115123597
BCT120       59         112733607
BCT121       67         111056909
BCT122       44         114099662
BCT123       50         116535583
BCT124       54         110434594
BCT125       25         102543884
BCT126       30         108112665
BCT127       28         66943977
BCT128       44         114207420
BCT129       46         113853781
BCT13        111        116076156
BCT130       61         113013046
BCT131       39         107930220
BCT132       36         110468738
BCT133       24         105876768
BCT134       52         113670469
BCT135       14         35659654
BCT136       28         113584725
BCT137       60         113829391
BCT138       48         109240533
BCT139       36         109739722
BCT14        70         113372788
BCT140       31         120103946
BCT141       47         115043801
BCT142       52         112290738
BCT143       13         14836380
BCT144       78         113214393
BCT145       41         111552967
BCT146       52         114895149
BCT147       69         109578631
BCT148       69         114363423
BCT149       57         117705409
BCT15        53         115328609
BCT150       55         103731733
BCT151       18         40428169
BCT152       62         99560423
BCT153       43         103972342
BCT154       31         107564841
BCT155       43         111146788
BCT156       69         105178122
BCT157       40         106930486
BCT158       63         103214676
BCT159       59         109908714
BCT16        74         122556134
BCT160       3          5977905
BCT161       48         109450542
BCT162       52         109603502
BCT163       49         106107943
BCT164       42         106127600
BCT165       50         109569448
BCT166       31         108773312
BCT167       46         105971387
BCT168       11         45172131
BCT169       35         106938488
BCT17        41         116033349
BCT170       33         108751417
BCT171       39         109930943
BCT172       36         107844857
BCT173       46         108994757
BCT174       47         109730440
BCT175       46         108277996
BCT176       36         108233016
BCT177       24         71230905
BCT178       93         99698834
BCT179       28         105910339
BCT18        68         116609452
BCT180       26         106807776
BCT181       26         106791919
BCT182       30         105001148
BCT183       53         111345508
BCT184       41         109889593
BCT185       59         109018123
BCT186       30         109071337
BCT187       39         108787172
BCT188       32         109347557
BCT189       50         108478863
BCT19        67         113662798
BCT190       57         109443511
BCT191       53         109163488
BCT192       99         108381810
BCT193       51         106146784
BCT194       44         108052927
BCT195       56         108771438
BCT196       37         104765115
BCT197       58         110929020
BCT198       70         107091033
BCT199       56         113594219
BCT2         32047      99641443
BCT20        67         115443289
BCT200       57         110829326
BCT201       32         107971097
BCT202       37         106777058
BCT203       78         112673391
BCT204       43         111510362
BCT205       8          9297509
BCT206       68         108609785
BCT207       43         109695697
BCT208       42         108803289
BCT209       50         106367913
BCT21        83         138261024
BCT210       63         105722279
BCT211       87         102463356
BCT212       47         106320436
BCT213       4          21185740
BCT214       46         106960142
BCT215       96         106643559
BCT216       31         105372309
BCT217       26         106805010
BCT218       49         106651249
BCT219       47         103607682
BCT22        16017      48619963
BCT220       35         107489664
BCT221       67         104712197
BCT222       46         108342243
BCT223       26         81261825
BCT224       64         110225618
BCT225       108        104825154
BCT226       60         107327528
BCT227       61         107795323
BCT228       53         102836312
BCT229       52         106485851
BCT23        53816      84836330
BCT230       74         108457079
BCT231       86         107960836
BCT232       36         104434144
BCT233       40         104611257
BCT234       39         85200679
BCT235       57         103978644
BCT236       70         107610987
BCT237       70         107051032
BCT238       56         106683509
BCT239       46         105724920
BCT24        86         109498452
BCT240       55         114276012
BCT241       86         112583980
BCT242       67         111078791
BCT243       42         108660545
BCT244       45         108549695
BCT245       53         105356910
BCT246       24         56109119
BCT247       57         112638189
BCT248       42         100091055
BCT249       59         109333202
BCT25        137        95492678
BCT250       47         104817714
BCT251       51         105800331
BCT252       62         106566440
BCT253       64         103497655
BCT254       53         108367367
BCT255       114        106783399
BCT256       36         109650325
BCT257       57         107728749
BCT258       55         110062496
BCT259       50         107714622
BCT26        57         111091737
BCT260       1          3544332
BCT261       57         107641125
BCT262       41         107620860
BCT263       45         110339026
BCT264       49         108486361
BCT265       46         111034233
BCT266       38         112691901
BCT267       47         107354092
BCT268       72         113063759
BCT269       48         110953964
BCT27        52         109549606
BCT270       61         107812063
BCT271       28         73695605
BCT272       87         112693125
BCT273       76         103647190
BCT274       71         110363264
BCT275       86         115297119
BCT276       69         115532791
BCT277       97         108194107
BCT278       2          7439652
BCT279       63         113808207
BCT28        46         112848420
BCT280       45         104174235
BCT281       52         104773529
BCT282       45         110154680
BCT283       51         108479125
BCT284       41         108488675
BCT285       46         114977289
BCT286       50         106703622
BCT287       59         118450337
BCT288       58         119459597
BCT289       42         107146698
BCT29        57         112994744
BCT290       71         110024014
BCT291       42         110624301
BCT292       76         85422737
BCT293       203        89845400
BCT294       325        25743984
BCT295       1589       2511957
BCT296       3172       5268484
BCT297       6338       7796395
BCT298       12613      14997742
BCT299       25523      27672627
BCT3         45         110044504
BCT30        66         108817610
BCT300       50568      54083158
BCT301       75853      77878188
BCT302       71329      76777169
BCT303       10365      92226034
BCT304       5305       94797455
BCT305       3323       102716745
BCT306       125        92772533
BCT307       39         103801273
BCT308       214        102743901
BCT309       6101       97980407
BCT31        36         96325907
BCT310       22121      93801026
BCT311       21155      21758975
BCT312       71365      73593068
BCT313       3689       102660265
BCT314       3947       100740033
BCT315       6493       97476161
BCT316       3878       96543194
BCT317       10720      103933675
BCT318       74845      78899708
BCT319       73409      78159395
BCT32        40         106881287
BCT320       4854       6038485
BCT321       75556      78482246
BCT322       72014      77189482
BCT323       72718      74005997
BCT324       12828      14826537
BCT325       70789      75431887
BCT326       72147      73767202
BCT327       20484      19518238
BCT328       66597      81010213
BCT329       49506      60830380
BCT33        59         107430269
BCT330       62252      83442408
BCT331       47617      72730788
BCT332       23186      104884117
BCT333       3546       154408192
BCT334       1371       170373272
BCT335       5548       105653517
BCT336       1705       104237801
BCT337       2903       109280805
BCT338       1876       107853158
BCT339       2532       116827553
BCT34        74         111675186
BCT340       1032       116758883
BCT341       1050       121978710
BCT342       666        134587537
BCT343       21         117256293
BCT344       25         117462462
BCT345       22         117303281
BCT346       21         114706495
BCT347       1499       121964483
BCT348       577        128618769
BCT349       13513      111242333
BCT35        55         110045255
BCT350       16876      31837899
BCT36        63         106845594
BCT37        55         109391464
BCT38        53         108650404
BCT39        46         110495229
BCT4         59         112453622
BCT40        95         109522868
BCT41        58         106383657
BCT42        67         109486091
BCT43        125        110095720
BCT44        37         71643089
BCT45        200        111474100
BCT46        54         111189650
BCT47        35         108859141
BCT48        59         107860764
BCT49        56         105257914
BCT5         24103      103626489
BCT50        45         109560296
BCT51        74         109517239
BCT52        64         110182754
BCT53        45         105399191
BCT54        59         110379618
BCT55        70         108888422
BCT56        77         109259381
BCT57        22         22714378
BCT58        67         109336234
BCT59        60         104664634
BCT6         13434      19705486
BCT60        53         102829098
BCT61        56         108908758
BCT62        58         105643854
BCT63        54         109754097
BCT64        72         109941269
BCT65        61         106056484
BCT66        70         111010690
BCT67        36         115917629
BCT68        79         110703954
BCT69        50         110061589
BCT7         39658      80452210
BCT70        61         113995855
BCT71        25         28242590
BCT72        43         109853786
BCT73        50         116699480
BCT74        66         111693041
BCT75        50         111467075
BCT76        53         109197672
BCT77        97         112945696
BCT78        73         112059377
BCT79        80         105609227
BCT8         1992       59265649
BCT80        61         114956262
BCT81        64         115718442
BCT82        53         114897025
BCT83        62         113790360
BCT84        47         110741363
BCT85        21         43870898
BCT86        48         118002347
BCT87        63         115290616
BCT88        248        115434499
BCT89        70         109982609
BCT9         7656       93380719
BCT90        297        115164977
BCT91        63         110836541
BCT92        68         108767418
BCT93        45         109031298
BCT94        61         108655373
BCT95        61         109296173
BCT96        4          12180716
BCT97        57         116195274
BCT98        61         106396448
BCT99        39         113384349
ENV1         92453      71792747
ENV10        86260      70391284
ENV11        93076      72832110
ENV12        82353      86609106
ENV13        21807      18677444
ENV14        84711      80822818
ENV15        118343     43037482
ENV16        89150      77075409
ENV17        96416      67757575
ENV18        96023      63235778
ENV19        109632     66853009
ENV2         95822      68803704
ENV20        121969     64266446
ENV21        59519      80371226
ENV22        1985       2665839
ENV23        64036      80463296
ENV24        90211      75812600
ENV25        125172     39265203
ENV26        122785     28945679
ENV27        90679      20907713
ENV28        123097     49753756
ENV29        97826      67184945
ENV3         93818      67822115
ENV30        115025     56511972
ENV31        135879     52802977
ENV32        109145     60809369
ENV33        94508      64670410
ENV34        25365      24126965
ENV35        62536      84995133
ENV36        88722      73276073
ENV37        102896     44274222
ENV38        96867      56282212
ENV39        70673      54653611
ENV4         76085      80463271
ENV40        111227     47246119
ENV41        100828     61075687
ENV42        107048     61675013
ENV43        63689      90608528
ENV44        72539      78869729
ENV45        62024      84275196
ENV46        13554      18435588
ENV47        70511      78327058
ENV48        107795     49575769
ENV49        112481     56191673
ENV5         38922      97328093
ENV50        104684     61473177
ENV51        80596      42559465
ENV52        100601     44023259
ENV53        42885      53351901
ENV54        41970      54596651
ENV55        57474      57083783
ENV56        96500      61609711
ENV57        35154      19530121
ENV58        92149      66866589
ENV59        80785      71288245
ENV6         69841      91136060
ENV60        78505      67768188
ENV61        85907      69827379
ENV62        95714      60414267
ENV63        83358      53464794
ENV64        109664     46034771
ENV65        90166      60778487
ENV66        101123     51562807
ENV67        93855      57093294
ENV68        80594      73546746
ENV69        31958      24896739
ENV7         90236      83949333
ENV70        74047      82695949
ENV71        82785      51571083
ENV72        86262      59358235
ENV73        56642      76521045
ENV74        105211     32167994
ENV75        66976      16918110
ENV76        78564      74345624
ENV77        91976      57749495
ENV78        101475     59816189
ENV79        108092     39990268
ENV8         78894      46003835
ENV80        108260     37627795
ENV81        34830      24684724
ENV82        98675      54408600
ENV83        116351     29438819
ENV84        107391     41885812
ENV85        104006     49435517
ENV86        90299      35173652
ENV87        101611     50118121
ENV88        114246     49893810
ENV89        121910     39843109
ENV9         131421     31025284
ENV90        111882     47657964
ENV91        34893      23833301
ENV92        91933      57861140
ENV93        98046      55397518
ENV94        98081      53296313
ENV95        78348      47433189
ENV96        94393      63205479
ENV97        56674      48398906
EST1         159555     61824227
EST10        168131     72514179
EST100       233407     141754425
EST101       238402     125266998
EST102       190911     104638260
EST103       184937     102293832
EST104       101046     70402934
EST105       160804     120303973
EST106       174198     106417350
EST107       134715     84640860
EST108       63908      23765769
EST109       63383      22286690
EST11        169539     73791824
EST110       63864      23096416
EST111       63904      26923343
EST112       64387      22974135
EST113       64613      24570827
EST114       63598      27084990
EST115       63798      26182699
EST116       64071      27302812
EST117       63917      25173189
EST118       61286      33755660
EST119       124193     62994290
EST12        168343     70653784
EST120       160496     85595506
EST121       186801     92666719
EST122       148728     95508575
EST123       158450     93339455
EST124       130860     85166396
EST125       188325     90253927
EST126       157038     83528781
EST127       157261     84359214
EST128       156762     84861541
EST129       152183     85253489
EST13        67562      32904021
EST130       173825     93264939
EST131       183567     117083245
EST132       202867     102663082
EST133       159756     87273956
EST134       162951     83015909
EST135       142529     83652420
EST136       144812     89956275
EST137       97998      51819992
EST138       172674     97598540
EST139       244029     112741272
EST14        217464     108980027
EST140       155885     84017979
EST141       167370     92290441
EST142       151125     88594694
EST143       133497     81307076
EST144       155008     97359597
EST145       156606     85956546
EST146       124207     63290886
EST147       121182     65038140
EST148       127641     57928928
EST149       127055     51228304
EST15        169675     106006024
EST150       128436     51179244
EST151       115279     42989143
EST152       164120     82773026
EST153       177062     74167297
EST154       162594     110599172
EST155       199695     122374481
EST156       213373     121217068
EST157       175159     97072155
EST158       154510     108145600
EST159       142560     95292183
EST16        181582     113584842
EST160       155215     96478767
EST161       157904     82720735
EST162       139700     78634090
EST163       168611     93738611
EST164       69430      43193328
EST165       150730     92271943
EST166       192369     110548255
EST167       146130     84118464
EST168       142842     72427503
EST169       150393     87710738
EST17        196118     115763063
EST170       191181     104862954
EST171       156749     96093287
EST172       168090     82976744
EST173       127035     86635935
EST174       171189     100414117
EST175       173374     100344884
EST176       121186     67798672
EST177       158133     91108979
EST178       30542      17726714
EST179       170884     103285975
EST18        194436     120866071
EST180       181397     119581988
EST181       143703     116740054
EST182       194432     99359550
EST183       153314     103352235
EST184       155024     101645963
EST185       141175     81728847
EST186       176791     71800276
EST187       150853     84453718
EST188       157406     99914924
EST189       156915     96493140
EST19        157763     113163477
EST190       140892     84026983
EST191       159112     96101846
EST192       146889     94035269
EST193       131478     91560301
EST194       142721     87529800
EST195       137346     89561679
EST196       132658     93992119
EST197       163931     87299271
EST198       174729     96025094
EST199       174085     96902088
EST2         162380     61685425
EST20        189891     100199271
EST200       171958     96533997
EST201       169419     94934133
EST202       172386     95811323
EST203       174112     95379823
EST204       174591     96203284
EST205       13690      7274191
EST206       189437     105533804
EST207       205999     105137867
EST208       172510     102444321
EST209       180685     102063420
EST21        218551     107518588
EST210       202177     123341203
EST211       195647     112834181
EST212       195600     124006919
EST213       138751     93563688
EST214       215440     137234645
EST215       234896     121743203
EST216       161695     105717178
EST217       182463     100790498
EST218       202166     98900719
EST219       132738     95265116
EST22        190344     62076896
EST220       147704     87573433
EST221       210706     116135410
EST222       161780     105318227
EST223       103249     107505569
EST224       153184     103914433
EST225       159116     95531615
EST226       142945     103196786
EST227       224844     104406638
EST228       137179     100990474
EST229       121926     86628281
EST23        138926     39571975
EST230       137907     97918884
EST231       122790     87936517
EST232       143777     89691138
EST233       129920     88652348
EST234       140428     105164559
EST235       132026     93231012
EST236       124179     84034528
EST237       142789     88115224
EST238       156796     120908835
EST239       127141     119266480
EST24        102691     27795556
EST240       139440     103480081
EST241       174807     106007411
EST242       167004     103530022
EST243       154495     99306334
EST244       86491      49570641
EST245       166837     125571155
EST246       143646     106127725
EST247       155629     100211897
EST248       212228     97689136
EST249       187721     112177866
EST25        122268     50953755
EST250       153402     86159862
EST251       217804     27223333
EST252       220409     89789043
EST253       163504     120521930
EST254       175216     102673969
EST255       162378     107946968
EST256       113840     70928370
EST257       155435     113579134
EST258       184993     112290083
EST259       188989     97733737
EST26        214501     97516374
EST260       176343     110279979
EST261       162391     111859500
EST262       230865     108319146
EST263       276081     121280314
EST264       193034     115012988
EST265       187886     36317633
EST266       258354     125855395
EST267       65600      39763464
EST268       153173     97666452
EST269       165840     102093977
EST27        219438     110308623
EST270       166140     114250915
EST271       198135     102959696
EST272       156518     106589117
EST273       196117     115090853
EST274       196784     48890625
EST275       206611     42170188
EST276       181585     103264877
EST277       171018     115309016
EST278       186456     116522091
EST279       126234     72572222
EST28        190571     88612373
EST280       175375     114210467
EST281       170869     74579440
EST282       133315     83110229
EST283       130658     85402238
EST284       155192     102523416
EST285       260789     27544582
EST286       264780     24330665
EST287       148895     104686715
EST288       169579     109696940
EST289       160109     102630428
EST29        158272     69018885
EST290       155917     92345813
EST291       152965     14100641
EST292       209895     74150504
EST293       164986     107690610
EST294       177020     106881453
EST295       154021     98606015
EST296       200098     108098653
EST297       154950     111200195
EST298       166350     101039358
EST299       187995     115218274
EST3         151392     53647626
EST30        171794     69708829
EST300       178941     102999302
EST301       185817     99210095
EST302       184133     64502286
EST303       127107     45082089
EST304       183962     71376298
EST305       184618     69635233
EST306       185635     96244813
EST307       182543     131140001
EST308       145731     84812356
EST309       152868     92355204
EST31        150111     63686778
EST310       131455     100600586
EST311       161024     97319844
EST312       171204     97937368
EST313       150906     97019042
EST314       168237     95573695
EST315       160474     107373565
EST316       100914     70869971
EST317       165120     108357102
EST318       157519     109036280
EST319       178717     151332725
EST32        168663     76272572
EST320       170773     111821902
EST321       141757     75950694
EST322       143923     98098369
EST323       147071     100973499
EST324       134889     90929001
EST325       149255     99520224
EST326       150066     101210409
EST327       177571     110620464
EST328       149008     82876068
EST329       149143     85544626
EST33        175545     67856845
EST330       65188      40148261
EST331       150548     108399171
EST332       161697     97050289
EST333       143763     91475469
EST334       141807     89347267
EST335       203928     111103720
EST336       138687     75663389
EST337       91345      54433123
EST338       130319     85725031
EST339       137141     87063102
EST34        118961     41066537
EST340       125782     80491977
EST341       158962     85255699
EST342       217337     85074606
EST343       171351     87523620
EST344       106586     63673738
EST345       165373     103535400
EST346       146960     89846187
EST347       133010     88559560
EST348       136155     88631683
EST349       185951     121850279
EST35        96421      29602556
EST350       161385     97653118
EST351       153765     78050962
EST352       188003     127498514
EST353       118343     82182077
EST354       73372      44179148
EST355       136788     75269883
EST356       130580     78257450
EST357       147608     58511357
EST358       158745     32267563
EST359       43069      8821197
EST36        96829      30264281
EST360       155610     42677154
EST361       190791     120873201
EST362       238303     113679537
EST363       247499     113104504
EST364       187910     102808539
EST365       141237     91606515
EST366       136580     86831565
EST367       152983     90142969
EST368       190398     117704669
EST369       227729     63655364
EST37        95741      29042016
EST370       177672     111596205
EST371       32380      14207665
EST372       214221     117622053
EST373       204816     121605762
EST374       203771     116468774
EST375       143641     69184040
EST376       198348     122112530
EST377       159876     101179030
EST378       166073     127323367
EST379       183315     145688879
EST38        97613      29518769
EST380       157057     92669163
EST381       164203     105287985
EST382       185597     106413430
EST383       95283      56183176
EST384       205019     111664581
EST385       195517     108717459
EST386       192545     118848383
EST387       191040     124061750
EST388       200937     132592354
EST389       219034     133303041
EST39        97785      30994957
EST390       210508     132952541
EST391       196775     152242593
EST392       212155     161807612
EST393       197246     120335226
EST394       57796      32698619
EST395       187547     102867172
EST396       172063     52520844
EST397       165874     13137853
EST398       155872     18134560
EST399       158551     32710314
EST4         171452     67343987
EST40        27755      7109915
EST400       158533     32750183
EST401       155980     49488239
EST402       158765     93416471
EST403       177153     116978989
EST404       167662     105175492
EST405       163646     108800603
EST406       143253     95785138
EST407       106872     75682373
EST408       147022     92971781
EST409       175641     125418667
EST41        101408     53010659
EST410       143768     94017647
EST411       177839     104028721
EST412       167985     26582200
EST413       167918     70102016
EST414       151700     108384474
EST415       170909     106365473
EST416       148934     92792814
EST417       170872     96376309
EST418       183905     125776484
EST419       140215     92677560
EST42        119782     50982162
EST420       131714     90297503
EST421       1490       902503
EST422       154838     95825388
EST423       163498     93883268
EST424       178524     96354591
EST425       149039     93353648
EST426       172733     98284122
EST427       172292     104746912
EST428       131761     85428517
EST429       97599      71662061
EST43        166530     92128690
EST430       79802      61003887
EST431       115214     74506286
EST432       153688     83777163
EST433       128301     78398661
EST434       137273     90867440
EST435       141733     83204839
EST436       49493      32937084
EST437       174257     97477697
EST438       180015     97516806
EST439       147582     96911803
EST44        170579     72181339
EST440       170629     102898170
EST441       166781     70352078
EST442       195059     110833689
EST443       150927     83606695
EST444       176633     103589938
EST445       219434     129047025
EST446       160280     104382820
EST447       158790     106108849
EST448       138895     85857580
EST449       25523      17505528
EST45        167845     85215169
EST450       136261     89185362
EST451       207727     75229621
EST452       181297     85425486
EST453       206060     88640136
EST454       198542     82595754
EST455       181906     110414010
EST456       182036     110710216
EST457       189491     110336778
EST458       197906     115547220
EST459       197471     123380349
EST46        168462     86873165
EST460       188278     87708201
EST461       12729      5805942
EST462       189568     120606194
EST463       204339     119355885
EST464       195836     118438912
EST465       173163     103756241
EST466       200630     124399919
EST467       151261     91846761
EST468       150178     111015318
EST469       160418     87573772
EST47        163616     88013158
EST470       186389     95630978
EST471       149338     79929831
EST472       154675     84769639
EST473       135890     71576764
EST474       181361     112801025
EST475       172374     101078673
EST476       178288     122353499
EST477       185225     121665908
EST478       185379     115129825
EST479       177048     103113020
EST48        162703     83148535
EST480       184112     92571596
EST481       170299     59097672
EST482       159268     62664410
EST483       16512      5051256
EST49        160286     91385964
EST5         169565     66409038
EST50        162295     88482317
EST51        157720     99217658
EST52        159903     70049608
EST53        147394     82626374
EST54        71477      47304875
EST55        167539     70092485
EST56        165244     74992232
EST57        165010     91108002
EST58        159205     97086781
EST59        156801     102133199
EST6         172265     67202895
EST60        165090     99238720
EST61        160311     108360404
EST62        172043     80609248
EST63        173975     93432036
EST64        155465     84284869
EST65        148880     81643739
EST66        159136     98571587
EST67        131300     74939809
EST68        150077     91968651
EST69        195890     108748923
EST7         170604     73086994
EST70        181357     95118944
EST71        222269     121812140
EST72        187088     111911014
EST73        203916     120915019
EST74        164645     90825256
EST75        132461     60433682
EST76        137954     67948881
EST77        157838     97913016
EST78        157471     97692924
EST79        142831     78793956
EST8         180226     73234634
EST80        46188      21482376
EST81        164087     100503268
EST82        212721     115150228
EST83        224864     124333400
EST84        200946     94559953
EST85        212137     93372291
EST86        161327     93002013
EST87        144193     87492396
EST88        164649     80971218
EST89        158801     79951435
EST9         168969     69443417
EST90        153613     102336342
EST91        151697     89015232
EST92        130910     84679216
EST93        156100     112961735
EST94        141253     103424814
EST95        142079     101605221
EST96        141281     97671182
EST97        147744     81887774
EST98        178965     111019710
EST99        223875     135647295
GSS1         200939     87994154
GSS10        132826     60814914
GSS100       145434     114442767
GSS101       141763     116184076
GSS102       143261     116672134
GSS103       166551     128250333
GSS104       149044     82061530
GSS105       191443     120806358
GSS106       168728     112791368
GSS107       198748     116492007
GSS108       205253     134908961
GSS109       209604     138168683
GSS11        137156     73819324
GSS110       207353     140812173
GSS111       206098     142298914
GSS112       205162     143530477
GSS113       204924     143950435
GSS114       202025     146602994
GSS115       182172     139430567
GSS116       16974      10147479
GSS117       133166     84217853
GSS118       170214     80242030
GSS119       183940     79409264
GSS12        148492     75939930
GSS120       170051     148175317
GSS121       177736     120655981
GSS122       179411     145656885
GSS123       187624     120684126
GSS124       186881     139143130
GSS125       192420     127226110
GSS126       192028     93305755
GSS127       167529     156510243
GSS128       163650     114009122
GSS129       60781      36747811
GSS13        145704     69201602
GSS130       170924     155391265
GSS131       172236     154355390
GSS132       172285     155047185
GSS133       173669     154061261
GSS134       171880     154918497
GSS135       180286     138244448
GSS136       177778     146362755
GSS137       166247     119417076
GSS138       192398     95144942
GSS139       258979     44246456
GSS14        171388     85572712
GSS140       258654     39860121
GSS141       92297      14195823
GSS142       254871     58954129
GSS143       266157     53788360
GSS144       190547     88835104
GSS145       196948     64513363
GSS146       185040     146410142
GSS147       181690     149604117
GSS148       167309     154586549
GSS149       170985     157782705
GSS15        161797     98274929
GSS150       233414     77030731
GSS151       230979     77203904
GSS152       130293     59615106
GSS153       213637     54260267
GSS154       157555     97574152
GSS155       182950     113537866
GSS156       135786     87096602
GSS157       165173     130022291
GSS158       183702     161463835
GSS159       193935     159495012
GSS16        173192     87194502
GSS160       190375     125588439
GSS161       217120     138274877
GSS162       221520     132814595
GSS163       160692     98930180
GSS164       150123     86028356
GSS165       37397      28653694
GSS166       211764     157998834
GSS167       192754     102631094
GSS168       171990     67672750
GSS169       206242     159862170
GSS17        184161     114501204
GSS170       207812     162102041
GSS171       207212     163842127
GSS172       205398     135464727
GSS173       157780     112228379
GSS174       87034      63855245
GSS175       83577      62786371
GSS176       103116     48366085
GSS177       68990      58637252
GSS178       8510       7648264
GSS179       68650      57968938
GSS18        191888     113693431
GSS180       69281      56696847
GSS181       69518      56234995
GSS182       71267      56043617
GSS183       68322      51682051
GSS184       75915      58209304
GSS185       86540      74277212
GSS186       81348      44404013
GSS187       92264      45106435
GSS188       65102      48523381
GSS189       77817      61671469
GSS19        108076     48418898
GSS190       70214      59194095
GSS191       68204      63290904
GSS192       62733      52925089
GSS193       94993      42344588
GSS194       19502      4535679
GSS195       112930     70870954
GSS196       830        565879
GSS197       23226      28867035
GSS198       109084     70678875
GSS199       84411      34587755
GSS2         182739     92537225
GSS20        181332     101434306
GSS200       35896      22276911
GSS201       103434     62565003
GSS202       102447     63849638
GSS203       104373     67711538
GSS204       81746      41058579
GSS205       83102      54651503
GSS206       95565      61249467
GSS207       107362     78589335
GSS208       106444     76728833
GSS209       106101     79982459
GSS21        166650     114501413
GSS210       104001     80014803
GSS211       75801      50678132
GSS212       105097     63619915
GSS213       109868     66415305
GSS214       105969     59182678
GSS215       68062      37223883
GSS216       69097      38525198
GSS217       38174      18339130
GSS218       85817      46213833
GSS219       97774      56293008
GSS22        169477     97589627
GSS220       94834      49464944
GSS221       96316      55977648
GSS222       41259      23116851
GSS223       114107     43462563
GSS224       116481     39262549
GSS225       108537     52758264
GSS226       108498     66975496
GSS227       100920     77744360
GSS228       57790      34653929
GSS229       96897      36918766
GSS23        186654     125969227
GSS230       96399      37676586
GSS231       97739      35452830
GSS232       95145      39751140
GSS233       33820      15967145
GSS234       103643     66079771
GSS235       94657      61262657
GSS236       95235      60429693
GSS237       94882      60936668
GSS238       75733      70088559
GSS239       80768      68567938
GSS24        192665     129463729
GSS240       36701      34808193
GSS241       82451      27787824
GSS242       82925      26902290
GSS243       83483      25713611
GSS244       18873      5507584
GSS245       16547      7508221
GSS246       94100      60580478
GSS247       95569      64262397
GSS248       94824      64682969
GSS249       105259     69398231
GSS25        177825     105741913
GSS250       92415      46209919
GSS251       91707      49888838
GSS252       79008      43119879
GSS253       90911      57070316
GSS254       89786      61908922
GSS255       88601      63777484
GSS256       89396      62541094
GSS257       9342       6742661
GSS258       88085      63867833
GSS259       90679      62789788
GSS26        184603     106728670
GSS260       94860      59835949
GSS261       74809      63957256
GSS262       84506      78714665
GSS263       82944      80898169
GSS264       69059      51310496
GSS265       114900     62956729
GSS266       108980     55519998
GSS267       107208     51972208
GSS268       99627      44671760
GSS269       109459     48915853
GSS27        170179     149665573
GSS270       98719      45881699
GSS271       80973      62819023
GSS272       72826      72790774
GSS273       64574      55877660
GSS274       60740      46994351
GSS275       37095      27996803
GSS276       60845      46734002
GSS277       61946      49327951
GSS278       84047      86740412
GSS279       82536      88549611
GSS28        188963     147690392
GSS280       77949      74213298
GSS281       84442      64951795
GSS282       60134      48386085
GSS283       60082      48548768
GSS284       79755      51505702
GSS285       81394      61015678
GSS286       46325      27866603
GSS287       94787      57200301
GSS288       93517      59081345
GSS289       93900      58510429
GSS29        150189     104351237
GSS290       94714      57307691
GSS291       83843      51265303
GSS292       103666     69242174
GSS293       104299     74321241
GSS294       109373     68331863
GSS295       106994     71135784
GSS296       38781      26571815
GSS297       111314     66044649
GSS298       97520      60954006
GSS299       106950     56669730
GSS3         175733     88087895
GSS30        191204     131441405
GSS300       93076      72615543
GSS301       82646      87962916
GSS302       78596      93791277
GSS303       53021      31246397
GSS31        20784      13893018
GSS32        195389     126949740
GSS33        217735     116814786
GSS34        219655     114197394
GSS35        220809     112620179
GSS36        214074     122634098
GSS37        196390     154722789
GSS38        192935     145197749
GSS39        193652     73173947
GSS4         167432     85323562
GSS40        186590     96412496
GSS41        187152     124028751
GSS42        173586     161481287
GSS43        12014      7739851
GSS44        183238     99937870
GSS45        172382     121124225
GSS46        183262     123437073
GSS47        188863     120899665
GSS48        75959      66218124
GSS49        170046     100948681
GSS5         51059      30411223
GSS50        166240     102102703
GSS51        166431     101323746
GSS52        181636     120323119
GSS53        183662     115768129
GSS54        181054     122904257
GSS55        187667     112726758
GSS56        187353     135091510
GSS57        177434     103601654
GSS58        194387     118884385
GSS59        180325     129962310
GSS6         161952     84629162
GSS60        15071      13660236
GSS61        171908     138349237
GSS62        162249     111940843
GSS63        162290     111957030
GSS64        158269     107222777
GSS65        156087     128714023
GSS66        170394     142686880
GSS67        176080     114826942
GSS68        202855     127206559
GSS69        193353     110431206
GSS7         165940     79650274
GSS70        244863     126157988
GSS71        161718     107776180
GSS72        157965     117712257
GSS73        162710     124586018
GSS74        162678     124640248
GSS75        173945     108792852
GSS76        191201     140030079
GSS77        18493      11851786
GSS78        196630     124922865
GSS79        169316     110442180
GSS8         165913     89042918
GSS80        199154     130497515
GSS81        210325     89534947
GSS82        190710     96069706
GSS83        133037     93053445
GSS84        145945     117208121
GSS85        139790     117027229
GSS86        142875     113979419
GSS87        144231     119969869
GSS88        141762     115676261
GSS89        109625     91424274
GSS9         138289     67345522
GSS90        149553     122345328
GSS91        147790     117796701
GSS92        144115     113153024
GSS93        142979     115532063
GSS94        144337     119766805
GSS95        148217     121722672
GSS96        147793     117900972
GSS97        146200     121152590
GSS98        146262     121035840
GSS99        146701     120156218
HTC1         25050      27033299
HTC10        71312      72126281
HTC11        70240      69500626
HTC12        40134      41771500
HTC13        67517      60542416
HTC14        69000      69659316
HTC15        52547      40473843
HTC2         16074      36212642
HTC3         16017      36610472
HTC4         16238      35518163
HTC5         15962      40336042
HTC6         16045      37398239
HTC7         53621      31263603
HTC8         31433      19847768
HTC9         60708      77605740
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1590       179393068
HTG121       1587       179603616
HTG122       1580       179595063
HTG123       1598       179568613
HTG124       1603       179517182
HTG125       1582       180855862
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1476       185679630
HTG129       1134       190249540
HTG13        875        191786413
HTG130       1103       184582645
HTG131       4          407375
HTG132       1557       186483382
HTG133       1855       177768696
HTG134       986        186174720
HTG135       1072       192049994
HTG136       1089       193222951
HTG137       602        109520336
HTG138       1031       189469892
HTG139       1055       192678789
HTG14        753        191921309
HTG140       1163       191852916
HTG141       1080       192395765
HTG142       1083       192975115
HTG143       589        103841272
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2128       191444643
HTG149       1095       192332347
HTG15        745        191963148
HTG150       1077       192069076
HTG151       1088       192446033
HTG152       1029       190403238
HTG153       1993       182267232
HTG154       1797       183710906
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93658      48192696
INV10        48896      92487810
INV100       66634      130026281
INV101       38635      162651925
INV102       37923      155535140
INV103       47450      148279075
INV104       31582      35878775
INV105       41258      162193552
INV106       8649       189035299
INV107       14549      181577331
INV108       5295       188760704
INV109       18509      176900436
INV11        35         174810098
INV110       34351      158679406
INV111       14344      172158272
INV112       23577      45955779
INV113       16795      180349455
INV114       21027      172501512
INV115       4891       191046501
INV116       26084      174037919
INV117       14547      181030545
INV118       44397      155376448
INV119       27112      171621394
INV12        15632      161930509
INV120       19370      174154051
INV121       49371      138775955
INV122       29055      84543185
INV123       96245      108547326
INV124       35892      166944993
INV125       23159      177277868
INV126       22654      170374262
INV127       4699       190767649
INV128       29376      152389625
INV129       55624      119361124
INV13        83323      64865289
INV130       566        40635863
INV131       7358       190633905
INV132       51895      153104512
INV133       5607       188059543
INV134       35090      162258474
INV135       3364       19014860
INV136       39813      159668855
INV137       62444      141571579
INV138       19462      30223725
INV139       104664     106635585
INV14        54258      46034173
INV140       74577      120116541
INV141       12112      167732182
INV142       18278      163726949
INV143       13818      94808827
INV144       29262      155753563
INV145       38610      149060814
INV146       51684      139700572
INV147       70877      126444377
INV148       97323      108082698
INV149       125942     86452766
INV15        84554      65983022
INV150       27973      144301443
INV151       14187      139201055
INV152       255        149572202
INV153       27098      127436382
INV16        80705      66716677
INV17        78538      66746225
INV18        50065      47111889
INV19        36852      121660608
INV2         59859      89864485
INV20        284        149846609
INV21        49901      102944883
INV22        77100      55625135
INV23        72038      61784089
INV24        428        277808
INV25        23152      127349623
INV26        6          133712559
INV27        56684      101642857
INV28        74037      50295649
INV29        70509      51206211
INV3         1369       188243844
INV30        76778      54990062
INV31        75551      57242722
INV32        76756      57105996
INV33        73324      54078914
INV34        55331      36631256
INV35        78729      56780990
INV36        74398      55076137
INV37        74465      60712946
INV38        77039      58620448
INV39        56716      37844994
INV4         879        127449747
INV40        77754      56000477
INV41        73578      52349713
INV42        74641      56060970
INV43        76879      57469905
INV44        38935      33650400
INV45        75587      48321238
INV46        73082      44541846
INV47        75242      45560534
INV48        76498      52865867
INV49        29671      22278747
INV5         26267      110066842
INV50        76276      54041161
INV51        74130      44267803
INV52        73471      43347376
INV53        73717      42560704
INV54        31147      18788700
INV55        69266      41140692
INV56        68913      41244029
INV57        68620      41243920
INV58        68655      40804318
INV59        69631      44988528
INV6         77733      71345710
INV60        69311      41891157
INV61        57022      34018234
INV62        65374      48843706
INV63        68792      49516050
INV64        74027      58193641
INV65        68335      49735991
INV66        72201      60793152
INV67        56226      84823632
INV68        47440      146955651
INV69        863        1696904
INV7         53257      95767051
INV70        81479      126211856
INV71        100429     109691945
INV72        116036     96137263
INV73        101319     70777781
INV74        35239      166647152
INV75        30755      171594048
INV76        27724      170864744
INV77        2640       190498229
INV78        6183       191107737
INV79        17837      180141483
INV8         43811      90545564
INV80        15378      184713635
INV81        6839       167378491
INV82        8875       189509571
INV83        15662      184182101
INV84        30722      171526293
INV85        65600      142208408
INV86        21638      22670137
INV87        50224      153584896
INV88        4095       191102716
INV89        11177      184659675
INV9         80246      71423759
INV90        29153      168751324
INV91        3317       189349389
INV92        6330       186171285
INV93        12367      180474553
INV94        39596      157268982
INV95        60755      142074593
INV96        67983      110944176
INV97        93063      112788673
INV98        14244      174036919
INV99        29357      160122987
MAM1         21062      154718152
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         13953      164815681
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         20454      32023302
MAM30        1706       2411269
MAM31        6836       6159435
MAM32        79403      74424957
MAM33        31122      118975141
MAM34        75932      62137984
MAM35        68733      72275494
MAM36        64013      77827625
MAM37        55060      85391981
MAM38        8390       183524786
MAM39        1121       1163187
MAM4         26809      24996320
MAM5         13731      20581346
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         222546     70101214
PAT10        124328     102489015
PAT100       178683     3394977
PAT101       178342     3388498
PAT102       178198     3385762
PAT103       178185     3385515
PAT104       132610     2848492
PAT105       342935     8573375
PAT106       188806     88519660
PAT107       111348     132068608
PAT108       3850       194703659
PAT109       131292     110979300
PAT11        98822      64203799
PAT110       158599     54826034
PAT111       224681     34110381
PAT112       250080     15844313
PAT113       180683     63516304
PAT114       51694      26210127
PAT115       114138     110461042
PAT116       137533     83209021
PAT117       164374     99022116
PAT118       158392     103578951
PAT119       137596     115028387
PAT12        141823     62679900
PAT120       42621      28098514
PAT121       193712     81686401
PAT122       150218     108404223
PAT123       356051     11379519
PAT124       257211     57607676
PAT125       138160     48226316
PAT126       322021     22795469
PAT127       155642     102753966
PAT128       132724     110696205
PAT129       128341     121313309
PAT13        103925     59409514
PAT130       21664      184390005
PAT131       144889     112900617
PAT132       171997     96405634
PAT133       44617      171215968
PAT134       9167       47581637
PAT135       33645      178334734
PAT136       153558     109675196
PAT137       178705     90913377
PAT138       136050     115324192
PAT139       120392     123343236
PAT14        102676     49411116
PAT140       8526       8991488
PAT141       155429     101473147
PAT142       184764     88815933
PAT143       182409     85292093
PAT144       174403     93928365
PAT145       28829      20461016
PAT146       147930     108545990
PAT147       160944     101973644
PAT148       185311     90980420
PAT149       231649     49265020
PAT15        120394     52414325
PAT150       203020     47532890
PAT151       277498     9808008
PAT152       220401     46464935
PAT153       107699     2905642
PAT154       270386     21672571
PAT155       186660     61147649
PAT156       109662     106102758
PAT157       47746      9596649
PAT158       87159      87872668
PAT159       78136      95530847
PAT16        108574     62734669
PAT160       144044     78090090
PAT161       168235     70788797
PAT162       121013     93305897
PAT163       103747     84895124
PAT164       166138     46774575
PAT165       270022     5130418
PAT166       269978     5129582
PAT167       269978     5129582
PAT168       237888     4519872
PAT169       269396     5118524
PAT17        47626      17037088
PAT170       235450     25552370
PAT171       203697     47174880
PAT172       12100      424842
PAT173       165310     74498391
PAT174       91503      126582622
PAT175       171360     72073271
PAT176       214402     66356095
PAT177       42873      49259391
PAT178       235138     59544089
PAT179       123750     125093767
PAT18        146771     52594264
PAT180       217504     66591902
PAT181       198097     84199370
PAT182       2346       5855451
PAT183       190271     85554469
PAT184       158609     102172052
PAT185       157481     102983510
PAT186       99253      76900838
PAT187       156209     98316380
PAT188       91682      138752301
PAT189       160779     88041379
PAT19        153717     78039882
PAT190       136985     111168356
PAT191       42350      35878823
PAT192       168931     98953101
PAT193       142774     114661479
PAT194       131583     119360876
PAT195       97976      135115181
PAT196       155419     106223733
PAT197       188151     61193131
PAT198       33691      32835681
PAT199       93113      87245332
PAT2         194518     84672670
PAT20        104762     118103022
PAT200       91789      79969642
PAT201       83786      91658083
PAT202       108685     54204939
PAT203       101025     56652559
PAT204       150189     24631215
PAT205       93817      82459162
PAT206       26010      162900357
PAT207       113939     65759888
PAT208       81618      28134684
PAT209       3631       191518875
PAT21        133723     95370485
PAT210       84408      78157905
PAT211       145070     26290630
PAT212       76933      99953933
PAT213       95327      71448753
PAT214       129839     31394838
PAT215       4940       7291482
PAT216       106326     62280116
PAT217       140007     12601685
PAT218       150519     23976386
PAT219       74131      6340298
PAT22        84646      79523445
PAT220       58028      68766855
PAT221       41081      54488985
PAT222       60875      54847144
PAT223       37721      64051648
PAT224       41404      61065384
PAT225       40778      53269659
PAT226       79940      57624117
PAT227       111539     54516872
PAT228       37061      8158333
PAT229       103405     55692396
PAT23        123541     103398512
PAT230       99422      44580758
PAT231       84105      73951091
PAT232       98252      10041952
PAT233       123244     19683537
PAT234       86788      129976495
PAT235       158952     78754789
PAT236       213334     47020463
PAT237       169350     66529413
PAT238       59805      8708633
PAT239       161863     78377268
PAT24        119437     105663274
PAT240       119782     100490233
PAT241       86768      128899853
PAT242       37958      167204138
PAT243       35970      168659354
PAT244       75398      138092775
PAT245       252324     29172044
PAT246       137109     91855139
PAT247       148313     82349020
PAT248       141894     74983839
PAT249       16861      11366586
PAT25        145191     86610850
PAT250       141695     86763404
PAT251       144995     93151551
PAT252       257285     12186129
PAT253       152526     4584721
PAT254       240738     21500238
PAT255       248574     11702646
PAT256       258799     3881985
PAT257       76619      1149285
PAT258       258799     3881985
PAT259       253598     6415258
PAT26        175020     64347291
PAT260       181107     64057890
PAT261       108663     133104260
PAT262       212027     72771336
PAT263       93467      6222697
PAT264       96024      21414322
PAT265       36373      149540958
PAT266       17430      176266906
PAT267       156074     8162466
PAT268       33395      148991922
PAT269       31806      82266406
PAT27        71811      1795275
PAT270       5144       9240794
PAT271       37903      57481578
PAT272       37752      57968298
PAT273       37840      57577626
PAT274       37917      57289516
PAT275       60382      56854467
PAT276       129180     17677268
PAT277       114910     50076717
PAT278       124134     25061875
PAT279       89517      45410224
PAT28        102088     77372284
PAT280       138413     26721996
PAT281       151724     82170996
PAT282       257564     3863460
PAT283       202775     44606593
PAT284       87120      50593790
PAT285       213439     42144768
PAT286       141245     78850272
PAT287       132021     3962125
PAT288       131924     3958408
PAT289       131925     3957998
PAT29        93955      87562996
PAT290       87042      39254011
PAT3         171992     95904578
PAT30        119913     61673902
PAT31        96697      78995886
PAT32        128070     54907201
PAT33        92412      51183341
PAT34        117830     69179507
PAT35        119660     35930940
PAT36        121821     44323556
PAT37        94342      86760549
PAT38        147257     22244932
PAT39        149446     31043112
PAT4         153752     106058463
PAT40        114632     50136669
PAT41        33896      45999593
PAT42        95723      83167099
PAT43        100229     70745785
PAT44        136003     39561489
PAT45        143802     35449093
PAT46        123826     64350137
PAT47        104440     81121401
PAT48        93089      74613582
PAT49        113260     66580372
PAT5         57129      23913162
PAT50        65582      54917156
PAT51        135192     108000182
PAT52        167082     97033300
PAT53        116398     127556257
PAT54        196344     76722199
PAT55        80300      127990932
PAT56        27631      180872621
PAT57        185409     93066654
PAT58        274258     6856450
PAT59        129447     31627433
PAT6         170645     91912459
PAT60        161320     77719729
PAT61        92639      89107951
PAT62        106058     74951034
PAT63        122370     64033005
PAT64        68048      30422705
PAT65        70748      109764944
PAT66        87946      82759037
PAT67        92971      78935157
PAT68        93164      72444136
PAT69        93383      75087244
PAT7         154883     88272027
PAT70        115770     60532287
PAT71        102747     9942058
PAT72        175928     10547489
PAT73        171510     10872561
PAT74        171496     10866737
PAT75        99864      86225363
PAT76        99         196466297
PAT77        67         192869889
PAT78        103        195600591
PAT79        1132       196318332
PAT8         131115     96982407
PAT80        97604      5772661
PAT81        151009     9636510
PAT82        151022     9621259
PAT83        151024     9622125
PAT84        151021     9620837
PAT85        94629      88051226
PAT86        92261      94524506
PAT87        37556      34675173
PAT88        83459      93185861
PAT89        15567      180450135
PAT9         129292     101012169
PAT90        164893     19209778
PAT91        178944     3399936
PAT92        177543     3373317
PAT93        175669     3337711
PAT94        100926     1917594
PAT95        169273     12414184
PAT96        178699     3395281
PAT97        178691     3395129
PAT98        178677     3394863
PAT99        140678     2672882
PHG1         5822       104055215
PHG2         3018       106306663
PHG3         2300       106845550
PHG4         954        6180058
PLN1         59774      93442552
PLN10        47574      48058108
PLN100       23088      15630027
PLN101       77254      71111787
PLN102       69908      84146607
PLN103       76115      67759586
PLN104       71987      76758657
PLN105       79866      65163577
PLN106       8125       7760523
PLN107       77947      63273087
PLN108       75153      68262387
PLN109       81451      59173318
PLN11        71522      76906126
PLN110       81343      58382320
PLN111       24329      27101535
PLN112       73340      62796027
PLN113       72200      70402187
PLN114       64146      83456506
PLN115       57394      65044728
PLN116       91232      52598416
PLN117       74854      67412798
PLN118       71175      68489872
PLN119       41868      48981301
PLN12        39828      50763210
PLN120       70451      70786433
PLN121       62147      78235086
PLN122       61556      82283481
PLN123       37438      35587336
PLN124       69698      73108970
PLN125       64956      74288350
PLN126       64315      80269382
PLN127       36403      46977634
PLN128       59359      85414212
PLN129       57623      84066006
PLN13        38797      63009818
PLN130       65612      77032121
PLN131       37547      50051563
PLN132       49361      95133964
PLN133       63681      82234968
PLN134       10281      92152486
PLN135       9403       170953957
PLN136       81         188747955
PLN137       31330      134371407
PLN138       6          180795696
PLN139       16580      155635132
PLN14        25620      117585686
PLN140       1159       156273456
PLN141       201        188494320
PLN142       1892       143571062
PLN143       4          165102368
PLN144       30815      136237799
PLN145       12706      27547801
PLN15        21200      111005920
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        1473       11877350
PLN2         74449      77634224
PLN20        23259      121287391
PLN21        6071       150261554
PLN22        1195       166515226
PLN23        1478       165896561
PLN24        40         167664829
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21965      107652492
PLN3         36525      104711875
PLN30        66907      69635499
PLN31        29621      31682590
PLN32        76751      76010916
PLN33        36364      41248534
PLN34        57312      72147499
PLN35        28689      28923618
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        280        132296769
PLN4         1374       178665244
PLN40        99         128278470
PLN41        276        130066439
PLN42        162        128507084
PLN43        96         78235858
PLN44        155        127161655
PLN45        140        128498419
PLN46        171        128468478
PLN47        168        134239052
PLN48        201        152936626
PLN49        273        194235260
PLN5         1845       186016576
PLN50        65         46109956
PLN51        272        193886506
PLN52        227        194049434
PLN53        137        175158920
PLN54        5          182400284
PLN55        14         189437622
PLN56        111        163524389
PLN57        57         166849394
PLN58        56         183992434
PLN59        537        140474201
PLN6         1848       194272696
PLN60        2328       93715621
PLN61        7181       18795412
PLN62        14346      29953091
PLN63        18728      133869997
PLN64        77692      74487344
PLN65        96362      58608085
PLN66        34356      32441592
PLN67        80146      71421086
PLN68        77553      75757702
PLN69        79971      70159743
PLN7         1688       194277347
PLN70        81468      74648866
PLN71        60098      34134885
PLN72        98777      55109285
PLN73        82272      68238960
PLN74        44611      98672664
PLN75        5534       152854889
PLN76        11882      165587691
PLN77        29507      120346017
PLN78        53393      102417189
PLN79        17727      12655557
PLN8         1831       193322220
PLN80        80797      72351311
PLN81        17670      12944782
PLN82        49499      72634904
PLN83        25061      110565816
PLN84        13564      89766260
PLN85        1          774434471
PLN86        8305       28494018
PLN87        1858       148969943
PLN88        2          135217911
PLN89        2          155188403
PLN9         49121      106364046
PLN90        2          140023111
PLN91        2          154604167
PLN92        2          148753627
PLN93        3          173772618
PLN94        3          178836778
PLN95        3          176344173
PLN96        3          195539469
PLN97        12431      129466187
PLN98        81777      65440146
PLN99        92283      57795074
PRI1         23034      59762327
PRI10        1254       178692891
PRI11        865        105120773
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22385      144320815
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2081       192754914
PRI23        3298       189856874
PRI24        13725      33916759
PRI25        27934      79135867
PRI26        59714      83874064
PRI27        36311      82322681
PRI28        8758       172032991
PRI29        2264       191408780
PRI3         1439       174314309
PRI30        1666       190944985
PRI31        2075       192251373
PRI32        2195       191150383
PRI33        13091      162158571
PRI34        2067       170809233
PRI35        56436      88262262
PRI36        4477       9299641
PRI37        32154      63605650
PRI38        20538      119329276
PRI39        18691      150583407
PRI4         1276       185669146
PRI40        67703      85010904
PRI41        50233      89169807
PRI42        41721      84345041
PRI43        46898      96168244
PRI44        27242      100591863
PRI45        28500      108990473
PRI46        23073      105477066
PRI47        21188      48647314
PRI48        23091      123853411
PRI49        37823      110119807
PRI5         1337       184500937
PRI50        30624      96458314
PRI51        24863      49063630
PRI52        1          229594237
PRI53        1          190673448
PRI54        1          197221778
PRI55        18566      164298951
PRI56        41422      78576920
PRI6         1180       180111971
PRI7         1229       180255349
PRI8         1219       179122541
PRI9         1372       174797659
ROD1         37496      132663195
ROD10        989        181994394
ROD11        312        58991276
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15161      159100447
ROD2         908        176227506
ROD20        20982      153402221
ROD21        1216       193805576
ROD22        1007       158474097
ROD23        15265      168416026
ROD24        37538      68993966
ROD25        20030      114484910
ROD26        1532       193340301
ROD27        150892     18257065
ROD28        75118      78474781
ROD29        83861      52990576
ROD3         910        173109878
ROD30        57907      67808393
ROD4         900        173795989
ROD5         920        174584743
ROD6         965        177316696
ROD7         974        179597759
ROD8         968        181268865
ROD9         1001       181597689
STS1         85269      36754064
STS10        57907      44420409
STS11        48921      37511590
STS12        57924      43637361
STS13        64058      42737902
STS14        93169      34131972
STS15        104293     26506104
STS16        10772      2917144
STS17        103700     27504029
STS18        97622      33595743
STS19        96640      34557490
STS2         84267      49943832
STS20        71165      25112676
STS3         65815      25950959
STS4         77831      37070588
STS5         9073       5317619
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55705      37758824
SYN1         52645      71008900
SYN10        2580       6993837
SYN2         43539      80473651
SYN3         24001      124151820
SYN4         4594       176463949
SYN5         4588       176366960
SYN6         4592       176413827
SYN7         9979       163718376
SYN8         56768      73226797
SYN9         31983      94479413
TSA1         119083     37789268
TSA10        18300      20792149
TSA100       84109      38689281
TSA101       76680      52659255
TSA102       66774      66687697
TSA103       63892      75957536
TSA104       86991      55453747
TSA105       51740      27880810
TSA106       74245      86358066
TSA107       80229      75622518
TSA108       84801      72305810
TSA109       77881      83686531
TSA11        134170     34616677
TSA110       94375      51986778
TSA111       99157      69089270
TSA112       59230      97228833
TSA113       109175     49378845
TSA114       63354      68310026
TSA115       80830      88898180
TSA116       70542      71924922
TSA117       57860      119442120
TSA118       4989       6788692
TSA119       106689     67779914
TSA12        59768      19488440
TSA120       93410      83369889
TSA121       98615      76609458
TSA122       88033      68056906
TSA123       84939      58883325
TSA124       77602      62177070
TSA125       82436      76716699
TSA126       98416      60365739
TSA127       94492      42586611
TSA128       76549      54460047
TSA129       42471      39759966
TSA13        64542      58862448
TSA130       59626      61176103
TSA131       59047      61657426
TSA132       59168      62167042
TSA133       71956      78379950
TSA134       87818      51643326
TSA135       63336      64766777
TSA136       2563       1147163
TSA137       77745      34626570
TSA138       74689      66831444
TSA139       81079      78598444
TSA14        91996      62507406
TSA140       74692      64675647
TSA141       41882      34789042
TSA142       87600      70235611
TSA143       89003      68194525
TSA144       84656      77065314
TSA145       76791      81310397
TSA146       12038      10028761
TSA147       104187     53670971
TSA148       80878      61177338
TSA149       69693      78323809
TSA15        91751      63606178
TSA150       73196      67845845
TSA151       86992      75471245
TSA152       89428      70000229
TSA153       62319      102884821
TSA154       95611      74149955
TSA155       20791      14545229
TSA156       82974      63616708
TSA157       83472      63790182
TSA158       78941      73480275
TSA159       76936      75992422
TSA16        7940       4228955
TSA160       93259      58485302
TSA161       100927     67776776
TSA162       35505      24272476
TSA163       103445     64539230
TSA164       94920      75734700
TSA165       80355      64233867
TSA166       30552      47121787
TSA167       51839      98295419
TSA168       46917      107683976
TSA169       44952      111436512
TSA17        76022      85946159
TSA170       42000      117073120
TSA171       39479      121890914
TSA172       37678      125330444
TSA173       30670      109097872
TSA174       78905      65671407
TSA175       61768      78120260
TSA176       65837      57430512
TSA177       40178      19221061
TSA178       38344      27282958
TSA179       35786      38619991
TSA18        79282      72813963
TSA180       34449      33150587
TSA181       31670      56857624
TSA182       31446      57845848
TSA183       39266      23134620
TSA184       40382      18182813
TSA185       41061      15174943
TSA186       41459      13408377
TSA187       41699      12346210
TSA188       26552      7560175
TSA189       41889      11506042
TSA19        86989      44504472
TSA190       41935      11303163
TSA191       41981      11096976
TSA192       42054      10770114
TSA193       42099      10570948
TSA194       42146      10365212
TSA195       43310      10362437
TSA196       69628      80166526
TSA197       26910      63134534
TSA198       89435      47294686
TSA199       47226      118117513
TSA2         112869     41275558
TSA20        73713      88531920
TSA200       86178      55950179
TSA201       79779      68257786
TSA202       4129       6891513
TSA203       51810      113451337
TSA204       44478      125316911
TSA205       37710      136261228
TSA206       63745      93693139
TSA207       62733      93188032
TSA208       46272      60834700
TSA209       62975      91394238
TSA21        66317      50611440
TSA210       75292      70263885
TSA211       48709      114829937
TSA212       81093      60467913
TSA213       48570      115557813
TSA214       79701      62923086
TSA215       71271      77126499
TSA216       52295      59003911
TSA217       80946      60040947
TSA218       40977      127425221
TSA219       88564      47079213
TSA22        81010      82050811
TSA220       61990      92418969
TSA221       79672      61642103
TSA222       88127      48478546
TSA223       55713      72150571
TSA224       71032      77857062
TSA225       68846      81288967
TSA226       85630      49828768
TSA227       66592      82370296
TSA228       91286      39468744
TSA229       62647      88850855
TSA23        62985      84306912
TSA230       51927      26167229
TSA24        84310      72779683
TSA25        99575      53442538
TSA26        62250      19026473
TSA27        85797      70106183
TSA28        120080     38852195
TSA29        135076     34048893
TSA3         109734     40829934
TSA30        52645      68403499
TSA31        47703      62725162
TSA32        2553       4328254
TSA33        60999      81852793
TSA34        93057      67088413
TSA35        109462     50198029
TSA36        106063     49698912
TSA37        101827     53965176
TSA38        104090     48094179
TSA39        24792      15630613
TSA4         110501     47448210
TSA40        66196      59263779
TSA41        92196      67722853
TSA42        92655      62163067
TSA43        80015      85986735
TSA44        99477      49894572
TSA45        113589     34208477
TSA46        95196      67511573
TSA47        13750      8571985
TSA48        94376      35380174
TSA49        77496      35938873
TSA5         78287      23622128
TSA50        106331     43405855
TSA51        113836     45499687
TSA52        29689      20438208
TSA53        103698     51338286
TSA54        101105     54210094
TSA55        97800      59154259
TSA56        81481      86126685
TSA57        69638      30922650
TSA58        90384      71308401
TSA59        97533      54431384
TSA6         111597     58983147
TSA60        60134      105510191
TSA61        86906      65105824
TSA62        78642      70611672
TSA63        83071      72200117
TSA64        82788      72062655
TSA65        68928      90836785
TSA66        90777      66753345
TSA67        75897      84474971
TSA68        71901      73208779
TSA69        68807      60812418
TSA7         87422      57902459
TSA70        84884      78052017
TSA71        85104      77998629
TSA72        70286      97799787
TSA73        85576      69690202
TSA74        85010      51571050
TSA75        102429     68721771
TSA76        87413      59050295
TSA77        103675     57047705
TSA78        73595      72842551
TSA79        78548      44480601
TSA8         104453     72519280
TSA80        87348      79224218
TSA81        91720      69212644
TSA82        78369      53162346
TSA83        78406      56943880
TSA84        97316      60085378
TSA85        38910      36143127
TSA86        88948      76782378
TSA87        95034      55397472
TSA88        110915     44811175
TSA89        97306      57970666
TSA9         109481     60972019
TSA90        65140      97031134
TSA91        15357      14810180
TSA92        101299     55496095
TSA93        91074      53959118
TSA94        93807      43529343
TSA95        85789      74023763
TSA96        73184      72092039
TSA97        39924      46723806
TSA98        77159      80203977
TSA99        77312      55431136
UNA1         334        209439
VRL1         64901      70774516
VRL10        43229      72883414
VRL11        48226      72184674
VRL12        62150      72320266
VRL13        67487      66601216
VRL14        60556      72443158
VRL15        15911      23573285
VRL16        62734      70800579
VRL17        57076      72681867
VRL18        63486      63551829
VRL19        57001      73290366
VRL2         66372      66519030
VRL20        52511      66775156
VRL21        54646      72267902
VRL22        58258      71167428
VRL23        56003      73206994
VRL24        55132      73781577
VRL25        28891      46615983
VRL26        52085      74747787
VRL27        38036      81431394
VRL28        47412      75044638
VRL29        48124      73965545
VRL3         70111      63545892
VRL30        48928      76516756
VRL31        13772      25468592
VRL32        49437      77635755
VRL33        42546      86823151
VRL34        41611      82901354
VRL35        48386      79640950
VRL36        37848      86386213
VRL37        4765       14730199
VRL38        37755      90541866
VRL39        44522      81759134
VRL4         68045      65180335
VRL40        46126      77734768
VRL41        42251      85033621
VRL42        43007      71421028
VRL43        42960      83578908
VRL44        38404      83599168
VRL45        43280      80430140
VRL46        37256      86774284
VRL47        52135      86977536
VRL48        4931       2711118
VRL5         68671      68745423
VRL6         19752      24871479
VRL7         47936      77148735
VRL8         46495      71634496
VRL9         43814      71160830
VRT1         67760      78118759
VRT10        1319       193297450
VRT11        8963       180814244
VRT12        3138       102269796
VRT13        13369      172251922
VRT14        5825       185117490
VRT15        3795       188803260
VRT16        49450      115678005
VRT17        79236      69220469
VRT18        77243      66382475
VRT19        20260      15013091
VRT2         2025       192894322
VRT20        71597      76198581
VRT21        44682      123261133
VRT22        77125      63349718
VRT23        79213      62104269
VRT24        81634      58052073
VRT25        35897      24783169
VRT26        102766     66105738
VRT27        81127      56356428
VRT28        85591      58024403
VRT29        62931      47238673
VRT3         47970      121078075
VRT30        90667      54055096
VRT31        76030      57809029
VRT32        8980       7582705
VRT33        74774      58271447
VRT34        56291      45439301
VRT35        80831      56886870
VRT36        75140      59278429
VRT37        78402      59320631
VRT38        55757      21869506
VRT39        109802     52936301
VRT4         24855      148454385
VRT40        77047      66083120
VRT41        46111      24837393
VRT42        89069      53780384
VRT43        84415      57588927
VRT44        46541      116256862
VRT45        44         188937391
VRT46        103        192313346
VRT47        130        193761317
VRT48        296        192673693
VRT49        591        194013929
VRT5         39288      103228526
VRT50        1882       192089736
VRT51        33970      161806577
VRT52        58738      17524994
VRT53        177067     28429798
VRT54        53955      90444098
VRT55        3242       189215331
VRT56        9          178794778
VRT57        10         196480447
VRT58        11         184541365
VRT59        28         196498040
VRT6         72853      66444987
VRT60        389        196385145
VRT61        1315       195608731
VRT62        2566       194640733
VRT63        3378       193090756
VRT64        20996      78208086
VRT7         31812      63615698
VRT8         30161      115606414
VRT9         1265       193453095

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 219.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

24231652 18893466733   Homo sapiens
9883173  10229286664   Mus musculus
2197781   6528984315   Rattus norvegicus
2229235   5429379063   Bos taurus
4197803   5227077026   Zea mays
3298802   5071347463   Sus scrofa
1346798   3235834212   Hordeum vulgare subsp. vulgare
1729033   3190913255   Danio rerio
72        2590574434   Ovis canadensis canadensis
1812814   1942831630   Triticum aestivum
205365    1836489899   Cyprinus carpio
745968    1746394903   Solanum lycopersicum
1378262   1642328218   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
118884    1571576668   Escherichia coli
258052    1436154077   Strongylocentrotus purpuratus
463156    1336999150   Macaca mulatta
490331    1264434795   Spirometra erinaceieuropaei
1588051   1250005232   Xenopus tropicalis
2583213   1212145307   Arabidopsis thaliana

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          April 15 2017

                NCBI-GenBank Flat File Release 219.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Clark, K. et al, Nucleic Acids Res. 44(D1), D67-72 (2016)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Yiming Bao, Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Michael Kornbluh, Jim Ostell, Vasuki Palanigobu,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Kamen Todorov, Eugene Yaschenko,
	Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center