Release Notes For GenBank Release 220

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2017

               NCBI-GenBank Flat File Release 220.0

                    Distribution Release Notes

 201663568 loci, 234997362623 bases, from 201663568 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 220.0
1.2 Cutoff Date
1.3 Important Changes in Release 220.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 220.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 220.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 220.0, incorporates data processed by the INSDC databases
as of Sunday June 18 2017 at approximately 5:45pm EDT. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 220.0

1.3.1 Release not fully synchronized with ASN.1 version

  Database replication was erroneously resumed in the middle of release
processing, which resulted in the inclusion of 19,381 records for the ASN.1
version of the release that are *not* present in the GenBank Release 220.0
flatfiles.

  Similarly, 6,767 proteins included in the protein FASTA files (generated
from the ASN.1) are not present as CDS features in the GenBank Release 220.0
flatfiles.

  All of the records involved are "post-close-of-data", and they were
distributed normally via the June 20 2017 GenBank Incremental Update
products. Thus, any customers who might load the GenBank 220.0 flatfiles into
their own database will see these additional records when they process the
post-220.0 updates.

  However, the replication mistake does mean that the ASN.1 version and the
flatfile version of GenBank 220.0 are not fully synchronized, which is a rare
enough event that we thought it worth mentioning. Lists of nucleotide and
protein accession numbers for the impacted records are available :

	rel220.asn1_only.nuc.acc.gz
	rel220.asn1_only.prot.acc.gz

1.3.2 Organizational changes

  The total number of sequence data files increased by 32 with this release:

  - the BCT division is now composed of 370 350 files (+20)
  - the CON division is now composed of 363 359 files (+4)
  - the ENV division is now composed of  99  97 files (+2)
  - the EST division is now composed of 482 483 files (-1)
  - the GSS division is now composed of 304 files (+1)
  - the INV division is now composed of 154 153 files (+1)
  - the PAT division is now composed of 291 290 files (+1)
  - the PLN division is now composed of 148 145 files (+3)
  - the VRL division is now composed of  49  48 files (+1)

  The decrease in the number of EST files is due to the removal of GI
  sequence identifiers on the VERSION line of the GenBank flatfile format.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 220.0. Consider gbgss175.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                            June 15 2017

                NCBI-GenBank Flat File Release 220.0

                           GSS Sequences (Part 1)

   87034 loci,    63855245 bases, from    87034 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "175" based on the number of files dumped from the other
system. Files gbgss175.seq.gz through gbgss304.seq.gz are affected. We hope
to resolve this discrepancy at some point, but the priority is certainly
much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 No changes impacting GenBank Release content are currently planned.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2887 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct38.seq - Bacterial sequence entries, part 38.
304. gbbct39.seq - Bacterial sequence entries, part 39.
305. gbbct4.seq - Bacterial sequence entries, part 4.
306. gbbct40.seq - Bacterial sequence entries, part 40.
307. gbbct41.seq - Bacterial sequence entries, part 41.
308. gbbct42.seq - Bacterial sequence entries, part 42.
309. gbbct43.seq - Bacterial sequence entries, part 43.
310. gbbct44.seq - Bacterial sequence entries, part 44.
311. gbbct45.seq - Bacterial sequence entries, part 45.
312. gbbct46.seq - Bacterial sequence entries, part 46.
313. gbbct47.seq - Bacterial sequence entries, part 47.
314. gbbct48.seq - Bacterial sequence entries, part 48.
315. gbbct49.seq - Bacterial sequence entries, part 49.
316. gbbct5.seq - Bacterial sequence entries, part 5.
317. gbbct50.seq - Bacterial sequence entries, part 50.
318. gbbct51.seq - Bacterial sequence entries, part 51.
319. gbbct52.seq - Bacterial sequence entries, part 52.
320. gbbct53.seq - Bacterial sequence entries, part 53.
321. gbbct54.seq - Bacterial sequence entries, part 54.
322. gbbct55.seq - Bacterial sequence entries, part 55.
323. gbbct56.seq - Bacterial sequence entries, part 56.
324. gbbct57.seq - Bacterial sequence entries, part 57.
325. gbbct58.seq - Bacterial sequence entries, part 58.
326. gbbct59.seq - Bacterial sequence entries, part 59.
327. gbbct6.seq - Bacterial sequence entries, part 6.
328. gbbct60.seq - Bacterial sequence entries, part 60.
329. gbbct61.seq - Bacterial sequence entries, part 61.
330. gbbct62.seq - Bacterial sequence entries, part 62.
331. gbbct63.seq - Bacterial sequence entries, part 63.
332. gbbct64.seq - Bacterial sequence entries, part 64.
333. gbbct65.seq - Bacterial sequence entries, part 65.
334. gbbct66.seq - Bacterial sequence entries, part 66.
335. gbbct67.seq - Bacterial sequence entries, part 67.
336. gbbct68.seq - Bacterial sequence entries, part 68.
337. gbbct69.seq - Bacterial sequence entries, part 69.
338. gbbct7.seq - Bacterial sequence entries, part 7.
339. gbbct70.seq - Bacterial sequence entries, part 70.
340. gbbct71.seq - Bacterial sequence entries, part 71.
341. gbbct72.seq - Bacterial sequence entries, part 72.
342. gbbct73.seq - Bacterial sequence entries, part 73.
343. gbbct74.seq - Bacterial sequence entries, part 74.
344. gbbct75.seq - Bacterial sequence entries, part 75.
345. gbbct76.seq - Bacterial sequence entries, part 76.
346. gbbct77.seq - Bacterial sequence entries, part 77.
347. gbbct78.seq - Bacterial sequence entries, part 78.
348. gbbct79.seq - Bacterial sequence entries, part 79.
349. gbbct8.seq - Bacterial sequence entries, part 8.
350. gbbct80.seq - Bacterial sequence entries, part 80.
351. gbbct81.seq - Bacterial sequence entries, part 81.
352. gbbct82.seq - Bacterial sequence entries, part 82.
353. gbbct83.seq - Bacterial sequence entries, part 83.
354. gbbct84.seq - Bacterial sequence entries, part 84.
355. gbbct85.seq - Bacterial sequence entries, part 85.
356. gbbct86.seq - Bacterial sequence entries, part 86.
357. gbbct87.seq - Bacterial sequence entries, part 87.
358. gbbct88.seq - Bacterial sequence entries, part 88.
359. gbbct89.seq - Bacterial sequence entries, part 89.
360. gbbct9.seq - Bacterial sequence entries, part 9.
361. gbbct90.seq - Bacterial sequence entries, part 90.
362. gbbct91.seq - Bacterial sequence entries, part 91.
363. gbbct92.seq - Bacterial sequence entries, part 92.
364. gbbct93.seq - Bacterial sequence entries, part 93.
365. gbbct94.seq - Bacterial sequence entries, part 94.
366. gbbct95.seq - Bacterial sequence entries, part 95.
367. gbbct96.seq - Bacterial sequence entries, part 96.
368. gbbct97.seq - Bacterial sequence entries, part 97.
369. gbbct98.seq - Bacterial sequence entries, part 98.
370. gbbct99.seq - Bacterial sequence entries, part 99.
371. gbchg.txt - Accession numbers of entries updated since the previous release.
372. gbcon1.seq - Constructed sequence entries, part 1.
373. gbcon10.seq - Constructed sequence entries, part 10.
374. gbcon100.seq - Constructed sequence entries, part 100.
375. gbcon101.seq - Constructed sequence entries, part 101.
376. gbcon102.seq - Constructed sequence entries, part 102.
377. gbcon103.seq - Constructed sequence entries, part 103.
378. gbcon104.seq - Constructed sequence entries, part 104.
379. gbcon105.seq - Constructed sequence entries, part 105.
380. gbcon106.seq - Constructed sequence entries, part 106.
381. gbcon107.seq - Constructed sequence entries, part 107.
382. gbcon108.seq - Constructed sequence entries, part 108.
383. gbcon109.seq - Constructed sequence entries, part 109.
384. gbcon11.seq - Constructed sequence entries, part 11.
385. gbcon110.seq - Constructed sequence entries, part 110.
386. gbcon111.seq - Constructed sequence entries, part 111.
387. gbcon112.seq - Constructed sequence entries, part 112.
388. gbcon113.seq - Constructed sequence entries, part 113.
389. gbcon114.seq - Constructed sequence entries, part 114.
390. gbcon115.seq - Constructed sequence entries, part 115.
391. gbcon116.seq - Constructed sequence entries, part 116.
392. gbcon117.seq - Constructed sequence entries, part 117.
393. gbcon118.seq - Constructed sequence entries, part 118.
394. gbcon119.seq - Constructed sequence entries, part 119.
395. gbcon12.seq - Constructed sequence entries, part 12.
396. gbcon120.seq - Constructed sequence entries, part 120.
397. gbcon121.seq - Constructed sequence entries, part 121.
398. gbcon122.seq - Constructed sequence entries, part 122.
399. gbcon123.seq - Constructed sequence entries, part 123.
400. gbcon124.seq - Constructed sequence entries, part 124.
401. gbcon125.seq - Constructed sequence entries, part 125.
402. gbcon126.seq - Constructed sequence entries, part 126.
403. gbcon127.seq - Constructed sequence entries, part 127.
404. gbcon128.seq - Constructed sequence entries, part 128.
405. gbcon129.seq - Constructed sequence entries, part 129.
406. gbcon13.seq - Constructed sequence entries, part 13.
407. gbcon130.seq - Constructed sequence entries, part 130.
408. gbcon131.seq - Constructed sequence entries, part 131.
409. gbcon132.seq - Constructed sequence entries, part 132.
410. gbcon133.seq - Constructed sequence entries, part 133.
411. gbcon134.seq - Constructed sequence entries, part 134.
412. gbcon135.seq - Constructed sequence entries, part 135.
413. gbcon136.seq - Constructed sequence entries, part 136.
414. gbcon137.seq - Constructed sequence entries, part 137.
415. gbcon138.seq - Constructed sequence entries, part 138.
416. gbcon139.seq - Constructed sequence entries, part 139.
417. gbcon14.seq - Constructed sequence entries, part 14.
418. gbcon140.seq - Constructed sequence entries, part 140.
419. gbcon141.seq - Constructed sequence entries, part 141.
420. gbcon142.seq - Constructed sequence entries, part 142.
421. gbcon143.seq - Constructed sequence entries, part 143.
422. gbcon144.seq - Constructed sequence entries, part 144.
423. gbcon145.seq - Constructed sequence entries, part 145.
424. gbcon146.seq - Constructed sequence entries, part 146.
425. gbcon147.seq - Constructed sequence entries, part 147.
426. gbcon148.seq - Constructed sequence entries, part 148.
427. gbcon149.seq - Constructed sequence entries, part 149.
428. gbcon15.seq - Constructed sequence entries, part 15.
429. gbcon150.seq - Constructed sequence entries, part 150.
430. gbcon151.seq - Constructed sequence entries, part 151.
431. gbcon152.seq - Constructed sequence entries, part 152.
432. gbcon153.seq - Constructed sequence entries, part 153.
433. gbcon154.seq - Constructed sequence entries, part 154.
434. gbcon155.seq - Constructed sequence entries, part 155.
435. gbcon156.seq - Constructed sequence entries, part 156.
436. gbcon157.seq - Constructed sequence entries, part 157.
437. gbcon158.seq - Constructed sequence entries, part 158.
438. gbcon159.seq - Constructed sequence entries, part 159.
439. gbcon16.seq - Constructed sequence entries, part 16.
440. gbcon160.seq - Constructed sequence entries, part 160.
441. gbcon161.seq - Constructed sequence entries, part 161.
442. gbcon162.seq - Constructed sequence entries, part 162.
443. gbcon163.seq - Constructed sequence entries, part 163.
444. gbcon164.seq - Constructed sequence entries, part 164.
445. gbcon165.seq - Constructed sequence entries, part 165.
446. gbcon166.seq - Constructed sequence entries, part 166.
447. gbcon167.seq - Constructed sequence entries, part 167.
448. gbcon168.seq - Constructed sequence entries, part 168.
449. gbcon169.seq - Constructed sequence entries, part 169.
450. gbcon17.seq - Constructed sequence entries, part 17.
451. gbcon170.seq - Constructed sequence entries, part 170.
452. gbcon171.seq - Constructed sequence entries, part 171.
453. gbcon172.seq - Constructed sequence entries, part 172.
454. gbcon173.seq - Constructed sequence entries, part 173.
455. gbcon174.seq - Constructed sequence entries, part 174.
456. gbcon175.seq - Constructed sequence entries, part 175.
457. gbcon176.seq - Constructed sequence entries, part 176.
458. gbcon177.seq - Constructed sequence entries, part 177.
459. gbcon178.seq - Constructed sequence entries, part 178.
460. gbcon179.seq - Constructed sequence entries, part 179.
461. gbcon18.seq - Constructed sequence entries, part 18.
462. gbcon180.seq - Constructed sequence entries, part 180.
463. gbcon181.seq - Constructed sequence entries, part 181.
464. gbcon182.seq - Constructed sequence entries, part 182.
465. gbcon183.seq - Constructed sequence entries, part 183.
466. gbcon184.seq - Constructed sequence entries, part 184.
467. gbcon185.seq - Constructed sequence entries, part 185.
468. gbcon186.seq - Constructed sequence entries, part 186.
469. gbcon187.seq - Constructed sequence entries, part 187.
470. gbcon188.seq - Constructed sequence entries, part 188.
471. gbcon189.seq - Constructed sequence entries, part 189.
472. gbcon19.seq - Constructed sequence entries, part 19.
473. gbcon190.seq - Constructed sequence entries, part 190.
474. gbcon191.seq - Constructed sequence entries, part 191.
475. gbcon192.seq - Constructed sequence entries, part 192.
476. gbcon193.seq - Constructed sequence entries, part 193.
477. gbcon194.seq - Constructed sequence entries, part 194.
478. gbcon195.seq - Constructed sequence entries, part 195.
479. gbcon196.seq - Constructed sequence entries, part 196.
480. gbcon197.seq - Constructed sequence entries, part 197.
481. gbcon198.seq - Constructed sequence entries, part 198.
482. gbcon199.seq - Constructed sequence entries, part 199.
483. gbcon2.seq - Constructed sequence entries, part 2.
484. gbcon20.seq - Constructed sequence entries, part 20.
485. gbcon200.seq - Constructed sequence entries, part 200.
486. gbcon201.seq - Constructed sequence entries, part 201.
487. gbcon202.seq - Constructed sequence entries, part 202.
488. gbcon203.seq - Constructed sequence entries, part 203.
489. gbcon204.seq - Constructed sequence entries, part 204.
490. gbcon205.seq - Constructed sequence entries, part 205.
491. gbcon206.seq - Constructed sequence entries, part 206.
492. gbcon207.seq - Constructed sequence entries, part 207.
493. gbcon208.seq - Constructed sequence entries, part 208.
494. gbcon209.seq - Constructed sequence entries, part 209.
495. gbcon21.seq - Constructed sequence entries, part 21.
496. gbcon210.seq - Constructed sequence entries, part 210.
497. gbcon211.seq - Constructed sequence entries, part 211.
498. gbcon212.seq - Constructed sequence entries, part 212.
499. gbcon213.seq - Constructed sequence entries, part 213.
500. gbcon214.seq - Constructed sequence entries, part 214.
501. gbcon215.seq - Constructed sequence entries, part 215.
502. gbcon216.seq - Constructed sequence entries, part 216.
503. gbcon217.seq - Constructed sequence entries, part 217.
504. gbcon218.seq - Constructed sequence entries, part 218.
505. gbcon219.seq - Constructed sequence entries, part 219.
506. gbcon22.seq - Constructed sequence entries, part 22.
507. gbcon220.seq - Constructed sequence entries, part 220.
508. gbcon221.seq - Constructed sequence entries, part 221.
509. gbcon222.seq - Constructed sequence entries, part 222.
510. gbcon223.seq - Constructed sequence entries, part 223.
511. gbcon224.seq - Constructed sequence entries, part 224.
512. gbcon225.seq - Constructed sequence entries, part 225.
513. gbcon226.seq - Constructed sequence entries, part 226.
514. gbcon227.seq - Constructed sequence entries, part 227.
515. gbcon228.seq - Constructed sequence entries, part 228.
516. gbcon229.seq - Constructed sequence entries, part 229.
517. gbcon23.seq - Constructed sequence entries, part 23.
518. gbcon230.seq - Constructed sequence entries, part 230.
519. gbcon231.seq - Constructed sequence entries, part 231.
520. gbcon232.seq - Constructed sequence entries, part 232.
521. gbcon233.seq - Constructed sequence entries, part 233.
522. gbcon234.seq - Constructed sequence entries, part 234.
523. gbcon235.seq - Constructed sequence entries, part 235.
524. gbcon236.seq - Constructed sequence entries, part 236.
525. gbcon237.seq - Constructed sequence entries, part 237.
526. gbcon238.seq - Constructed sequence entries, part 238.
527. gbcon239.seq - Constructed sequence entries, part 239.
528. gbcon24.seq - Constructed sequence entries, part 24.
529. gbcon240.seq - Constructed sequence entries, part 240.
530. gbcon241.seq - Constructed sequence entries, part 241.
531. gbcon242.seq - Constructed sequence entries, part 242.
532. gbcon243.seq - Constructed sequence entries, part 243.
533. gbcon244.seq - Constructed sequence entries, part 244.
534. gbcon245.seq - Constructed sequence entries, part 245.
535. gbcon246.seq - Constructed sequence entries, part 246.
536. gbcon247.seq - Constructed sequence entries, part 247.
537. gbcon248.seq - Constructed sequence entries, part 248.
538. gbcon249.seq - Constructed sequence entries, part 249.
539. gbcon25.seq - Constructed sequence entries, part 25.
540. gbcon250.seq - Constructed sequence entries, part 250.
541. gbcon251.seq - Constructed sequence entries, part 251.
542. gbcon252.seq - Constructed sequence entries, part 252.
543. gbcon253.seq - Constructed sequence entries, part 253.
544. gbcon254.seq - Constructed sequence entries, part 254.
545. gbcon255.seq - Constructed sequence entries, part 255.
546. gbcon256.seq - Constructed sequence entries, part 256.
547. gbcon257.seq - Constructed sequence entries, part 257.
548. gbcon258.seq - Constructed sequence entries, part 258.
549. gbcon259.seq - Constructed sequence entries, part 259.
550. gbcon26.seq - Constructed sequence entries, part 26.
551. gbcon260.seq - Constructed sequence entries, part 260.
552. gbcon261.seq - Constructed sequence entries, part 261.
553. gbcon262.seq - Constructed sequence entries, part 262.
554. gbcon263.seq - Constructed sequence entries, part 263.
555. gbcon264.seq - Constructed sequence entries, part 264.
556. gbcon265.seq - Constructed sequence entries, part 265.
557. gbcon266.seq - Constructed sequence entries, part 266.
558. gbcon267.seq - Constructed sequence entries, part 267.
559. gbcon268.seq - Constructed sequence entries, part 268.
560. gbcon269.seq - Constructed sequence entries, part 269.
561. gbcon27.seq - Constructed sequence entries, part 27.
562. gbcon270.seq - Constructed sequence entries, part 270.
563. gbcon271.seq - Constructed sequence entries, part 271.
564. gbcon272.seq - Constructed sequence entries, part 272.
565. gbcon273.seq - Constructed sequence entries, part 273.
566. gbcon274.seq - Constructed sequence entries, part 274.
567. gbcon275.seq - Constructed sequence entries, part 275.
568. gbcon276.seq - Constructed sequence entries, part 276.
569. gbcon277.seq - Constructed sequence entries, part 277.
570. gbcon278.seq - Constructed sequence entries, part 278.
571. gbcon279.seq - Constructed sequence entries, part 279.
572. gbcon28.seq - Constructed sequence entries, part 28.
573. gbcon280.seq - Constructed sequence entries, part 280.
574. gbcon281.seq - Constructed sequence entries, part 281.
575. gbcon282.seq - Constructed sequence entries, part 282.
576. gbcon283.seq - Constructed sequence entries, part 283.
577. gbcon284.seq - Constructed sequence entries, part 284.
578. gbcon285.seq - Constructed sequence entries, part 285.
579. gbcon286.seq - Constructed sequence entries, part 286.
580. gbcon287.seq - Constructed sequence entries, part 287.
581. gbcon288.seq - Constructed sequence entries, part 288.
582. gbcon289.seq - Constructed sequence entries, part 289.
583. gbcon29.seq - Constructed sequence entries, part 29.
584. gbcon290.seq - Constructed sequence entries, part 290.
585. gbcon291.seq - Constructed sequence entries, part 291.
586. gbcon292.seq - Constructed sequence entries, part 292.
587. gbcon293.seq - Constructed sequence entries, part 293.
588. gbcon294.seq - Constructed sequence entries, part 294.
589. gbcon295.seq - Constructed sequence entries, part 295.
590. gbcon296.seq - Constructed sequence entries, part 296.
591. gbcon297.seq - Constructed sequence entries, part 297.
592. gbcon298.seq - Constructed sequence entries, part 298.
593. gbcon299.seq - Constructed sequence entries, part 299.
594. gbcon3.seq - Constructed sequence entries, part 3.
595. gbcon30.seq - Constructed sequence entries, part 30.
596. gbcon300.seq - Constructed sequence entries, part 300.
597. gbcon301.seq - Constructed sequence entries, part 301.
598. gbcon302.seq - Constructed sequence entries, part 302.
599. gbcon303.seq - Constructed sequence entries, part 303.
600. gbcon304.seq - Constructed sequence entries, part 304.
601. gbcon305.seq - Constructed sequence entries, part 305.
602. gbcon306.seq - Constructed sequence entries, part 306.
603. gbcon307.seq - Constructed sequence entries, part 307.
604. gbcon308.seq - Constructed sequence entries, part 308.
605. gbcon309.seq - Constructed sequence entries, part 309.
606. gbcon31.seq - Constructed sequence entries, part 31.
607. gbcon310.seq - Constructed sequence entries, part 310.
608. gbcon311.seq - Constructed sequence entries, part 311.
609. gbcon312.seq - Constructed sequence entries, part 312.
610. gbcon313.seq - Constructed sequence entries, part 313.
611. gbcon314.seq - Constructed sequence entries, part 314.
612. gbcon315.seq - Constructed sequence entries, part 315.
613. gbcon316.seq - Constructed sequence entries, part 316.
614. gbcon317.seq - Constructed sequence entries, part 317.
615. gbcon318.seq - Constructed sequence entries, part 318.
616. gbcon319.seq - Constructed sequence entries, part 319.
617. gbcon32.seq - Constructed sequence entries, part 32.
618. gbcon320.seq - Constructed sequence entries, part 320.
619. gbcon321.seq - Constructed sequence entries, part 321.
620. gbcon322.seq - Constructed sequence entries, part 322.
621. gbcon323.seq - Constructed sequence entries, part 323.
622. gbcon324.seq - Constructed sequence entries, part 324.
623. gbcon325.seq - Constructed sequence entries, part 325.
624. gbcon326.seq - Constructed sequence entries, part 326.
625. gbcon327.seq - Constructed sequence entries, part 327.
626. gbcon328.seq - Constructed sequence entries, part 328.
627. gbcon329.seq - Constructed sequence entries, part 329.
628. gbcon33.seq - Constructed sequence entries, part 33.
629. gbcon330.seq - Constructed sequence entries, part 330.
630. gbcon331.seq - Constructed sequence entries, part 331.
631. gbcon332.seq - Constructed sequence entries, part 332.
632. gbcon333.seq - Constructed sequence entries, part 333.
633. gbcon334.seq - Constructed sequence entries, part 334.
634. gbcon335.seq - Constructed sequence entries, part 335.
635. gbcon336.seq - Constructed sequence entries, part 336.
636. gbcon337.seq - Constructed sequence entries, part 337.
637. gbcon338.seq - Constructed sequence entries, part 338.
638. gbcon339.seq - Constructed sequence entries, part 339.
639. gbcon34.seq - Constructed sequence entries, part 34.
640. gbcon340.seq - Constructed sequence entries, part 340.
641. gbcon341.seq - Constructed sequence entries, part 341.
642. gbcon342.seq - Constructed sequence entries, part 342.
643. gbcon343.seq - Constructed sequence entries, part 343.
644. gbcon344.seq - Constructed sequence entries, part 344.
645. gbcon345.seq - Constructed sequence entries, part 345.
646. gbcon346.seq - Constructed sequence entries, part 346.
647. gbcon347.seq - Constructed sequence entries, part 347.
648. gbcon348.seq - Constructed sequence entries, part 348.
649. gbcon349.seq - Constructed sequence entries, part 349.
650. gbcon35.seq - Constructed sequence entries, part 35.
651. gbcon350.seq - Constructed sequence entries, part 350.
652. gbcon351.seq - Constructed sequence entries, part 351.
653. gbcon352.seq - Constructed sequence entries, part 352.
654. gbcon353.seq - Constructed sequence entries, part 353.
655. gbcon354.seq - Constructed sequence entries, part 354.
656. gbcon355.seq - Constructed sequence entries, part 355.
657. gbcon356.seq - Constructed sequence entries, part 356.
658. gbcon357.seq - Constructed sequence entries, part 357.
659. gbcon358.seq - Constructed sequence entries, part 358.
660. gbcon359.seq - Constructed sequence entries, part 359.
661. gbcon36.seq - Constructed sequence entries, part 36.
662. gbcon360.seq - Constructed sequence entries, part 360.
663. gbcon361.seq - Constructed sequence entries, part 361.
664. gbcon362.seq - Constructed sequence entries, part 362.
665. gbcon363.seq - Constructed sequence entries, part 363.
666. gbcon37.seq - Constructed sequence entries, part 37.
667. gbcon38.seq - Constructed sequence entries, part 38.
668. gbcon39.seq - Constructed sequence entries, part 39.
669. gbcon4.seq - Constructed sequence entries, part 4.
670. gbcon40.seq - Constructed sequence entries, part 40.
671. gbcon41.seq - Constructed sequence entries, part 41.
672. gbcon42.seq - Constructed sequence entries, part 42.
673. gbcon43.seq - Constructed sequence entries, part 43.
674. gbcon44.seq - Constructed sequence entries, part 44.
675. gbcon45.seq - Constructed sequence entries, part 45.
676. gbcon46.seq - Constructed sequence entries, part 46.
677. gbcon47.seq - Constructed sequence entries, part 47.
678. gbcon48.seq - Constructed sequence entries, part 48.
679. gbcon49.seq - Constructed sequence entries, part 49.
680. gbcon5.seq - Constructed sequence entries, part 5.
681. gbcon50.seq - Constructed sequence entries, part 50.
682. gbcon51.seq - Constructed sequence entries, part 51.
683. gbcon52.seq - Constructed sequence entries, part 52.
684. gbcon53.seq - Constructed sequence entries, part 53.
685. gbcon54.seq - Constructed sequence entries, part 54.
686. gbcon55.seq - Constructed sequence entries, part 55.
687. gbcon56.seq - Constructed sequence entries, part 56.
688. gbcon57.seq - Constructed sequence entries, part 57.
689. gbcon58.seq - Constructed sequence entries, part 58.
690. gbcon59.seq - Constructed sequence entries, part 59.
691. gbcon6.seq - Constructed sequence entries, part 6.
692. gbcon60.seq - Constructed sequence entries, part 60.
693. gbcon61.seq - Constructed sequence entries, part 61.
694. gbcon62.seq - Constructed sequence entries, part 62.
695. gbcon63.seq - Constructed sequence entries, part 63.
696. gbcon64.seq - Constructed sequence entries, part 64.
697. gbcon65.seq - Constructed sequence entries, part 65.
698. gbcon66.seq - Constructed sequence entries, part 66.
699. gbcon67.seq - Constructed sequence entries, part 67.
700. gbcon68.seq - Constructed sequence entries, part 68.
701. gbcon69.seq - Constructed sequence entries, part 69.
702. gbcon7.seq - Constructed sequence entries, part 7.
703. gbcon70.seq - Constructed sequence entries, part 70.
704. gbcon71.seq - Constructed sequence entries, part 71.
705. gbcon72.seq - Constructed sequence entries, part 72.
706. gbcon73.seq - Constructed sequence entries, part 73.
707. gbcon74.seq - Constructed sequence entries, part 74.
708. gbcon75.seq - Constructed sequence entries, part 75.
709. gbcon76.seq - Constructed sequence entries, part 76.
710. gbcon77.seq - Constructed sequence entries, part 77.
711. gbcon78.seq - Constructed sequence entries, part 78.
712. gbcon79.seq - Constructed sequence entries, part 79.
713. gbcon8.seq - Constructed sequence entries, part 8.
714. gbcon80.seq - Constructed sequence entries, part 80.
715. gbcon81.seq - Constructed sequence entries, part 81.
716. gbcon82.seq - Constructed sequence entries, part 82.
717. gbcon83.seq - Constructed sequence entries, part 83.
718. gbcon84.seq - Constructed sequence entries, part 84.
719. gbcon85.seq - Constructed sequence entries, part 85.
720. gbcon86.seq - Constructed sequence entries, part 86.
721. gbcon87.seq - Constructed sequence entries, part 87.
722. gbcon88.seq - Constructed sequence entries, part 88.
723. gbcon89.seq - Constructed sequence entries, part 89.
724. gbcon9.seq - Constructed sequence entries, part 9.
725. gbcon90.seq - Constructed sequence entries, part 90.
726. gbcon91.seq - Constructed sequence entries, part 91.
727. gbcon92.seq - Constructed sequence entries, part 92.
728. gbcon93.seq - Constructed sequence entries, part 93.
729. gbcon94.seq - Constructed sequence entries, part 94.
730. gbcon95.seq - Constructed sequence entries, part 95.
731. gbcon96.seq - Constructed sequence entries, part 96.
732. gbcon97.seq - Constructed sequence entries, part 97.
733. gbcon98.seq - Constructed sequence entries, part 98.
734. gbcon99.seq - Constructed sequence entries, part 99.
735. gbdel.txt - Accession numbers of entries deleted since the previous release.
736. gbenv1.seq - Environmental sampling sequence entries, part 1.
737. gbenv10.seq - Environmental sampling sequence entries, part 10.
738. gbenv11.seq - Environmental sampling sequence entries, part 11.
739. gbenv12.seq - Environmental sampling sequence entries, part 12.
740. gbenv13.seq - Environmental sampling sequence entries, part 13.
741. gbenv14.seq - Environmental sampling sequence entries, part 14.
742. gbenv15.seq - Environmental sampling sequence entries, part 15.
743. gbenv16.seq - Environmental sampling sequence entries, part 16.
744. gbenv17.seq - Environmental sampling sequence entries, part 17.
745. gbenv18.seq - Environmental sampling sequence entries, part 18.
746. gbenv19.seq - Environmental sampling sequence entries, part 19.
747. gbenv2.seq - Environmental sampling sequence entries, part 2.
748. gbenv20.seq - Environmental sampling sequence entries, part 20.
749. gbenv21.seq - Environmental sampling sequence entries, part 21.
750. gbenv22.seq - Environmental sampling sequence entries, part 22.
751. gbenv23.seq - Environmental sampling sequence entries, part 23.
752. gbenv24.seq - Environmental sampling sequence entries, part 24.
753. gbenv25.seq - Environmental sampling sequence entries, part 25.
754. gbenv26.seq - Environmental sampling sequence entries, part 26.
755. gbenv27.seq - Environmental sampling sequence entries, part 27.
756. gbenv28.seq - Environmental sampling sequence entries, part 28.
757. gbenv29.seq - Environmental sampling sequence entries, part 29.
758. gbenv3.seq - Environmental sampling sequence entries, part 3.
759. gbenv30.seq - Environmental sampling sequence entries, part 30.
760. gbenv31.seq - Environmental sampling sequence entries, part 31.
761. gbenv32.seq - Environmental sampling sequence entries, part 32.
762. gbenv33.seq - Environmental sampling sequence entries, part 33.
763. gbenv34.seq - Environmental sampling sequence entries, part 34.
764. gbenv35.seq - Environmental sampling sequence entries, part 35.
765. gbenv36.seq - Environmental sampling sequence entries, part 36.
766. gbenv37.seq - Environmental sampling sequence entries, part 37.
767. gbenv38.seq - Environmental sampling sequence entries, part 38.
768. gbenv39.seq - Environmental sampling sequence entries, part 39.
769. gbenv4.seq - Environmental sampling sequence entries, part 4.
770. gbenv40.seq - Environmental sampling sequence entries, part 40.
771. gbenv41.seq - Environmental sampling sequence entries, part 41.
772. gbenv42.seq - Environmental sampling sequence entries, part 42.
773. gbenv43.seq - Environmental sampling sequence entries, part 43.
774. gbenv44.seq - Environmental sampling sequence entries, part 44.
775. gbenv45.seq - Environmental sampling sequence entries, part 45.
776. gbenv46.seq - Environmental sampling sequence entries, part 46.
777. gbenv47.seq - Environmental sampling sequence entries, part 47.
778. gbenv48.seq - Environmental sampling sequence entries, part 48.
779. gbenv49.seq - Environmental sampling sequence entries, part 49.
780. gbenv5.seq - Environmental sampling sequence entries, part 5.
781. gbenv50.seq - Environmental sampling sequence entries, part 50.
782. gbenv51.seq - Environmental sampling sequence entries, part 51.
783. gbenv52.seq - Environmental sampling sequence entries, part 52.
784. gbenv53.seq - Environmental sampling sequence entries, part 53.
785. gbenv54.seq - Environmental sampling sequence entries, part 54.
786. gbenv55.seq - Environmental sampling sequence entries, part 55.
787. gbenv56.seq - Environmental sampling sequence entries, part 56.
788. gbenv57.seq - Environmental sampling sequence entries, part 57.
789. gbenv58.seq - Environmental sampling sequence entries, part 58.
790. gbenv59.seq - Environmental sampling sequence entries, part 59.
791. gbenv6.seq - Environmental sampling sequence entries, part 6.
792. gbenv60.seq - Environmental sampling sequence entries, part 60.
793. gbenv61.seq - Environmental sampling sequence entries, part 61.
794. gbenv62.seq - Environmental sampling sequence entries, part 62.
795. gbenv63.seq - Environmental sampling sequence entries, part 63.
796. gbenv64.seq - Environmental sampling sequence entries, part 64.
797. gbenv65.seq - Environmental sampling sequence entries, part 65.
798. gbenv66.seq - Environmental sampling sequence entries, part 66.
799. gbenv67.seq - Environmental sampling sequence entries, part 67.
800. gbenv68.seq - Environmental sampling sequence entries, part 68.
801. gbenv69.seq - Environmental sampling sequence entries, part 69.
802. gbenv7.seq - Environmental sampling sequence entries, part 7.
803. gbenv70.seq - Environmental sampling sequence entries, part 70.
804. gbenv71.seq - Environmental sampling sequence entries, part 71.
805. gbenv72.seq - Environmental sampling sequence entries, part 72.
806. gbenv73.seq - Environmental sampling sequence entries, part 73.
807. gbenv74.seq - Environmental sampling sequence entries, part 74.
808. gbenv75.seq - Environmental sampling sequence entries, part 75.
809. gbenv76.seq - Environmental sampling sequence entries, part 76.
810. gbenv77.seq - Environmental sampling sequence entries, part 77.
811. gbenv78.seq - Environmental sampling sequence entries, part 78.
812. gbenv79.seq - Environmental sampling sequence entries, part 79.
813. gbenv8.seq - Environmental sampling sequence entries, part 8.
814. gbenv80.seq - Environmental sampling sequence entries, part 80.
815. gbenv81.seq - Environmental sampling sequence entries, part 81.
816. gbenv82.seq - Environmental sampling sequence entries, part 82.
817. gbenv83.seq - Environmental sampling sequence entries, part 83.
818. gbenv84.seq - Environmental sampling sequence entries, part 84.
819. gbenv85.seq - Environmental sampling sequence entries, part 85.
820. gbenv86.seq - Environmental sampling sequence entries, part 86.
821. gbenv87.seq - Environmental sampling sequence entries, part 87.
822. gbenv88.seq - Environmental sampling sequence entries, part 88.
823. gbenv89.seq - Environmental sampling sequence entries, part 89.
824. gbenv9.seq - Environmental sampling sequence entries, part 9.
825. gbenv90.seq - Environmental sampling sequence entries, part 90.
826. gbenv91.seq - Environmental sampling sequence entries, part 91.
827. gbenv92.seq - Environmental sampling sequence entries, part 92.
828. gbenv93.seq - Environmental sampling sequence entries, part 93.
829. gbenv94.seq - Environmental sampling sequence entries, part 94.
830. gbenv95.seq - Environmental sampling sequence entries, part 95.
831. gbenv96.seq - Environmental sampling sequence entries, part 96.
832. gbenv97.seq - Environmental sampling sequence entries, part 97.
833. gbenv98.seq - Environmental sampling sequence entries, part 98.
834. gbenv99.seq - Environmental sampling sequence entries, part 99.
835. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
836. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
837. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
838. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
839. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
840. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
841. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
842. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
843. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
844. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
845. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
846. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
847. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
848. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
849. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
850. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
851. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
852. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
853. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
854. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
855. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
856. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
857. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
858. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
859. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
860. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
861. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
862. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
863. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
864. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
865. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
866. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
867. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
868. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
869. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
870. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
871. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
872. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
873. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
874. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
875. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
876. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
877. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
878. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
879. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
880. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
881. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
882. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
883. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
884. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
885. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
886. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
887. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
888. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
889. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
890. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
891. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
892. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
893. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
894. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
895. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
896. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
897. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
898. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
899. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
900. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
901. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
902. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
903. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
904. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
905. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
906. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
907. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
908. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
909. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
910. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
911. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
912. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
913. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
914. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
915. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
916. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
917. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
918. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
919. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
920. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
921. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
922. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
923. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
924. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
925. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
926. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
927. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
928. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
929. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
930. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
931. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
932. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
933. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
934. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
935. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
936. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
937. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
938. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
939. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
940. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
941. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
942. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
943. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
944. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
945. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
946. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
947. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
948. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
949. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
950. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
951. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
952. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
953. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
954. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
955. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
956. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
957. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
958. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
959. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
960. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
961. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
962. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
963. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
964. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
965. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
966. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
967. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
968. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
969. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
970. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
971. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
972. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
973. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
974. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
975. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
976. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
977. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
978. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
979. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
980. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
981. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
982. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
983. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
984. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
985. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
986. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
987. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
988. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
989. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
990. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
991. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
992. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
993. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
994. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
995. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
996. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
997. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
998. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
999. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1000. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1001. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1002. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1003. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1004. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1005. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1006. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1007. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1008. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1009. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1010. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1011. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1012. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1013. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1014. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1015. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1016. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1017. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1018. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1019. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1020. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1021. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1022. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1023. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1024. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1025. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1026. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1027. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1028. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1029. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1030. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1031. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1032. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1033. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1034. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1035. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1036. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1037. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1038. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1039. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1040. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1041. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1042. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1043. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1044. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1045. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1046. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1047. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1048. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1049. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1050. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1051. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1052. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1053. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1054. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1055. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1056. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1057. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1058. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1059. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1060. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1061. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1062. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1063. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1064. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1065. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1066. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1067. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1068. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1069. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1070. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1071. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1072. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1073. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1074. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1075. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1076. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1077. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1078. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1079. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1080. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1081. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1082. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1083. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1084. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1085. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1086. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1087. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1088. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1089. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1090. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1091. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1092. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1093. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1094. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1095. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1096. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1097. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1098. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1099. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1100. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1101. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1102. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1103. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1104. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1105. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1106. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1107. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1108. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1109. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1110. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1111. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1112. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1113. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1114. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1115. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1116. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1117. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1118. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1119. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1120. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1121. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1122. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1123. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1124. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1125. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1126. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1127. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1128. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1129. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1130. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1131. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1132. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1133. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1134. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1135. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1136. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1137. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1138. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1139. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1140. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1141. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1142. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1143. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1144. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1145. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1146. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1147. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1148. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1149. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1150. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1151. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1152. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1153. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1154. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1155. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1156. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1157. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1158. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1159. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1160. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1161. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1162. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1163. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1164. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1165. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1166. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1167. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1168. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1169. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1170. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1171. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1172. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1173. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1174. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1175. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1176. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1177. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1178. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1179. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1180. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1181. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1182. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1183. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1184. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1185. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1186. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1187. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1188. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1189. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1190. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1191. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1192. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1193. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1194. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1195. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1196. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1197. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1198. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1199. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1200. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1201. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1202. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1203. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1204. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1205. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1206. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1207. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1208. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1209. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1210. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1211. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1212. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1213. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1214. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1215. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1216. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1217. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1218. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1219. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1220. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1221. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1222. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1223. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1224. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1225. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1226. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1227. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1228. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1229. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1230. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1231. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1232. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1233. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1234. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1235. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1236. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1237. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1238. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1239. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1240. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1241. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1242. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1243. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1244. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1245. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1246. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1247. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1248. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1249. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1250. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1251. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1252. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1253. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1254. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1255. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1256. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1257. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1258. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1259. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1260. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1261. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1262. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1263. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1264. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1265. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1266. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1267. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1268. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1269. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1270. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1271. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1272. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1273. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1274. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1275. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1276. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1277. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1278. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1279. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1280. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1281. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1282. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1283. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1284. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1285. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1286. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1287. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1288. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1289. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1290. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1291. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1292. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1293. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1294. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1295. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1296. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1297. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1298. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1299. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1300. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1301. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1302. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1303. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1304. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1305. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1306. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1307. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1308. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1309. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1310. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1311. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1312. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1313. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1314. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1315. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1316. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1317. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1318. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1319. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1320. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1321. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1322. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1323. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1324. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1325. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1326. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1327. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1328. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1329. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1330. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1331. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1332. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1333. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1334. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1335. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1336. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1337. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1338. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1339. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1340. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1341. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1342. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1343. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1344. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1345. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1346. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1347. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1348. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1349. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1350. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1351. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1352. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1353. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1354. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1355. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1356. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1357. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1358. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1359. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1360. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1361. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1362. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1363. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1364. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1365. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1366. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1367. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1368. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1369. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1370. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1371. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1372. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1373. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1374. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1375. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1376. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1377. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1378. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1379. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1380. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1381. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1382. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1383. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1384. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1385. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1386. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1387. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1388. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1389. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1390. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1391. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1392. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1393. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1394. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1395. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1396. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1397. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1398. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1399. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1400. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1401. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1402. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1403. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1404. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1405. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1406. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1407. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1408. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1409. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1410. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1411. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1412. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1413. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1414. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1415. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1416. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1417. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1418. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1419. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1420. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1421. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1422. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1423. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1424. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1425. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1426. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1427. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1428. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1429. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1430. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1431. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1432. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1433. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1434. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1435. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1436. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1437. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1438. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1439. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1440. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1441. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1442. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1443. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1444. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1445. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1446. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1447. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1448. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1449. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1450. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1451. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1452. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1453. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1454. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1455. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1456. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1457. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1458. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1459. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1460. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1461. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1462. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1463. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1464. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1465. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1466. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1467. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1468. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1469. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1470. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1471. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1472. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1473. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1474. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1475. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1476. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1477. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1478. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1479. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1480. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1481. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1482. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1483. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1484. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1485. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1486. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1487. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1488. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1489. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1490. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1491. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1492. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1493. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1494. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1495. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1496. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1497. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1498. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1499. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1500. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1501. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1502. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1503. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1504. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1505. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1506. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1507. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1508. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1509. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1510. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1511. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1512. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1513. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1514. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1515. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1516. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1517. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1518. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1519. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1520. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1521. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1522. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1523. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1524. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1525. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1526. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1527. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1528. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1529. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1530. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1531. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1532. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1533. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1534. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1535. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1536. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1537. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1538. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1539. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1540. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1541. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1542. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1543. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1544. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1545. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1546. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1547. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1548. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1549. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1550. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1551. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1552. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1553. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1554. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1555. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1556. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1557. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1558. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1559. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1560. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1561. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1562. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1563. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1564. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1565. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1566. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1567. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1568. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1569. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1570. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1571. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1572. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1573. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1574. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1575. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1576. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1577. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1578. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1579. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1580. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1581. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1582. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1583. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1584. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1585. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1586. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1587. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1588. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1589. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1590. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1591. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1592. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1593. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1594. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1595. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1596. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1597. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1598. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1599. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1600. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1601. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1602. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1603. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1604. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1605. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1606. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1607. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1608. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1609. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1610. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1611. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1612. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1613. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1614. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1615. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1616. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1617. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1618. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1619. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1620. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1621. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1622. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1623. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1624. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1625. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1626. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1627. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1628. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1629. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1630. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1631. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1632. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1633. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1634. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1635. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1636. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1637. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1638. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1639. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1640. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1641. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1642. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1643. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1644. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1645. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1646. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1647. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1648. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1649. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1650. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1651. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1652. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1653. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1654. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1655. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1656. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1657. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1658. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1659. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1660. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1661. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1662. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1663. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1664. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1665. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1666. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1667. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1668. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1669. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1670. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1671. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1672. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1673. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1674. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1675. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1676. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1677. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1678. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1679. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1680. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1681. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1682. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1683. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1684. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1685. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1686. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1687. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1688. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1689. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1690. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1691. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1692. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1693. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1694. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1695. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1696. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1697. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1698. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1699. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1700. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1701. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1702. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1703. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1704. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1705. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1706. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1707. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1708. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1709. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1710. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1711. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1712. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1713. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1714. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1715. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1716. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1717. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1718. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1719. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1720. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1721. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1722. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1723. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1724. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1725. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1726. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1727. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1728. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1729. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1730. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1731. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1732. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1733. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1734. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1735. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1736. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1737. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1738. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1739. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1740. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1741. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1742. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1743. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1744. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1745. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1746. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1747. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1748. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1749. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1750. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1751. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1752. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1753. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1754. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1755. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1756. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1757. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1758. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1759. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1760. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1761. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1762. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1763. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1764. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1765. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1766. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1767. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1768. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1769. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1770. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1771. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1772. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1773. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1774. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1775. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1776. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1777. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1778. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1779. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1780. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1781. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1782. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1783. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1784. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1785. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1786. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1787. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1788. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1789. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1790. gbinv1.seq - Invertebrate sequence entries, part 1.
1791. gbinv10.seq - Invertebrate sequence entries, part 10.
1792. gbinv100.seq - Invertebrate sequence entries, part 100.
1793. gbinv101.seq - Invertebrate sequence entries, part 101.
1794. gbinv102.seq - Invertebrate sequence entries, part 102.
1795. gbinv103.seq - Invertebrate sequence entries, part 103.
1796. gbinv104.seq - Invertebrate sequence entries, part 104.
1797. gbinv105.seq - Invertebrate sequence entries, part 105.
1798. gbinv106.seq - Invertebrate sequence entries, part 106.
1799. gbinv107.seq - Invertebrate sequence entries, part 107.
1800. gbinv108.seq - Invertebrate sequence entries, part 108.
1801. gbinv109.seq - Invertebrate sequence entries, part 109.
1802. gbinv11.seq - Invertebrate sequence entries, part 11.
1803. gbinv110.seq - Invertebrate sequence entries, part 110.
1804. gbinv111.seq - Invertebrate sequence entries, part 111.
1805. gbinv112.seq - Invertebrate sequence entries, part 112.
1806. gbinv113.seq - Invertebrate sequence entries, part 113.
1807. gbinv114.seq - Invertebrate sequence entries, part 114.
1808. gbinv115.seq - Invertebrate sequence entries, part 115.
1809. gbinv116.seq - Invertebrate sequence entries, part 116.
1810. gbinv117.seq - Invertebrate sequence entries, part 117.
1811. gbinv118.seq - Invertebrate sequence entries, part 118.
1812. gbinv119.seq - Invertebrate sequence entries, part 119.
1813. gbinv12.seq - Invertebrate sequence entries, part 12.
1814. gbinv120.seq - Invertebrate sequence entries, part 120.
1815. gbinv121.seq - Invertebrate sequence entries, part 121.
1816. gbinv122.seq - Invertebrate sequence entries, part 122.
1817. gbinv123.seq - Invertebrate sequence entries, part 123.
1818. gbinv124.seq - Invertebrate sequence entries, part 124.
1819. gbinv125.seq - Invertebrate sequence entries, part 125.
1820. gbinv126.seq - Invertebrate sequence entries, part 126.
1821. gbinv127.seq - Invertebrate sequence entries, part 127.
1822. gbinv128.seq - Invertebrate sequence entries, part 128.
1823. gbinv129.seq - Invertebrate sequence entries, part 129.
1824. gbinv13.seq - Invertebrate sequence entries, part 13.
1825. gbinv130.seq - Invertebrate sequence entries, part 130.
1826. gbinv131.seq - Invertebrate sequence entries, part 131.
1827. gbinv132.seq - Invertebrate sequence entries, part 132.
1828. gbinv133.seq - Invertebrate sequence entries, part 133.
1829. gbinv134.seq - Invertebrate sequence entries, part 134.
1830. gbinv135.seq - Invertebrate sequence entries, part 135.
1831. gbinv136.seq - Invertebrate sequence entries, part 136.
1832. gbinv137.seq - Invertebrate sequence entries, part 137.
1833. gbinv138.seq - Invertebrate sequence entries, part 138.
1834. gbinv139.seq - Invertebrate sequence entries, part 139.
1835. gbinv14.seq - Invertebrate sequence entries, part 14.
1836. gbinv140.seq - Invertebrate sequence entries, part 140.
1837. gbinv141.seq - Invertebrate sequence entries, part 141.
1838. gbinv142.seq - Invertebrate sequence entries, part 142.
1839. gbinv143.seq - Invertebrate sequence entries, part 143.
1840. gbinv144.seq - Invertebrate sequence entries, part 144.
1841. gbinv145.seq - Invertebrate sequence entries, part 145.
1842. gbinv146.seq - Invertebrate sequence entries, part 146.
1843. gbinv147.seq - Invertebrate sequence entries, part 147.
1844. gbinv148.seq - Invertebrate sequence entries, part 148.
1845. gbinv149.seq - Invertebrate sequence entries, part 149.
1846. gbinv15.seq - Invertebrate sequence entries, part 15.
1847. gbinv150.seq - Invertebrate sequence entries, part 150.
1848. gbinv151.seq - Invertebrate sequence entries, part 151.
1849. gbinv152.seq - Invertebrate sequence entries, part 152.
1850. gbinv153.seq - Invertebrate sequence entries, part 153.
1851. gbinv154.seq - Invertebrate sequence entries, part 154.
1852. gbinv16.seq - Invertebrate sequence entries, part 16.
1853. gbinv17.seq - Invertebrate sequence entries, part 17.
1854. gbinv18.seq - Invertebrate sequence entries, part 18.
1855. gbinv19.seq - Invertebrate sequence entries, part 19.
1856. gbinv2.seq - Invertebrate sequence entries, part 2.
1857. gbinv20.seq - Invertebrate sequence entries, part 20.
1858. gbinv21.seq - Invertebrate sequence entries, part 21.
1859. gbinv22.seq - Invertebrate sequence entries, part 22.
1860. gbinv23.seq - Invertebrate sequence entries, part 23.
1861. gbinv24.seq - Invertebrate sequence entries, part 24.
1862. gbinv25.seq - Invertebrate sequence entries, part 25.
1863. gbinv26.seq - Invertebrate sequence entries, part 26.
1864. gbinv27.seq - Invertebrate sequence entries, part 27.
1865. gbinv28.seq - Invertebrate sequence entries, part 28.
1866. gbinv29.seq - Invertebrate sequence entries, part 29.
1867. gbinv3.seq - Invertebrate sequence entries, part 3.
1868. gbinv30.seq - Invertebrate sequence entries, part 30.
1869. gbinv31.seq - Invertebrate sequence entries, part 31.
1870. gbinv32.seq - Invertebrate sequence entries, part 32.
1871. gbinv33.seq - Invertebrate sequence entries, part 33.
1872. gbinv34.seq - Invertebrate sequence entries, part 34.
1873. gbinv35.seq - Invertebrate sequence entries, part 35.
1874. gbinv36.seq - Invertebrate sequence entries, part 36.
1875. gbinv37.seq - Invertebrate sequence entries, part 37.
1876. gbinv38.seq - Invertebrate sequence entries, part 38.
1877. gbinv39.seq - Invertebrate sequence entries, part 39.
1878. gbinv4.seq - Invertebrate sequence entries, part 4.
1879. gbinv40.seq - Invertebrate sequence entries, part 40.
1880. gbinv41.seq - Invertebrate sequence entries, part 41.
1881. gbinv42.seq - Invertebrate sequence entries, part 42.
1882. gbinv43.seq - Invertebrate sequence entries, part 43.
1883. gbinv44.seq - Invertebrate sequence entries, part 44.
1884. gbinv45.seq - Invertebrate sequence entries, part 45.
1885. gbinv46.seq - Invertebrate sequence entries, part 46.
1886. gbinv47.seq - Invertebrate sequence entries, part 47.
1887. gbinv48.seq - Invertebrate sequence entries, part 48.
1888. gbinv49.seq - Invertebrate sequence entries, part 49.
1889. gbinv5.seq - Invertebrate sequence entries, part 5.
1890. gbinv50.seq - Invertebrate sequence entries, part 50.
1891. gbinv51.seq - Invertebrate sequence entries, part 51.
1892. gbinv52.seq - Invertebrate sequence entries, part 52.
1893. gbinv53.seq - Invertebrate sequence entries, part 53.
1894. gbinv54.seq - Invertebrate sequence entries, part 54.
1895. gbinv55.seq - Invertebrate sequence entries, part 55.
1896. gbinv56.seq - Invertebrate sequence entries, part 56.
1897. gbinv57.seq - Invertebrate sequence entries, part 57.
1898. gbinv58.seq - Invertebrate sequence entries, part 58.
1899. gbinv59.seq - Invertebrate sequence entries, part 59.
1900. gbinv6.seq - Invertebrate sequence entries, part 6.
1901. gbinv60.seq - Invertebrate sequence entries, part 60.
1902. gbinv61.seq - Invertebrate sequence entries, part 61.
1903. gbinv62.seq - Invertebrate sequence entries, part 62.
1904. gbinv63.seq - Invertebrate sequence entries, part 63.
1905. gbinv64.seq - Invertebrate sequence entries, part 64.
1906. gbinv65.seq - Invertebrate sequence entries, part 65.
1907. gbinv66.seq - Invertebrate sequence entries, part 66.
1908. gbinv67.seq - Invertebrate sequence entries, part 67.
1909. gbinv68.seq - Invertebrate sequence entries, part 68.
1910. gbinv69.seq - Invertebrate sequence entries, part 69.
1911. gbinv7.seq - Invertebrate sequence entries, part 7.
1912. gbinv70.seq - Invertebrate sequence entries, part 70.
1913. gbinv71.seq - Invertebrate sequence entries, part 71.
1914. gbinv72.seq - Invertebrate sequence entries, part 72.
1915. gbinv73.seq - Invertebrate sequence entries, part 73.
1916. gbinv74.seq - Invertebrate sequence entries, part 74.
1917. gbinv75.seq - Invertebrate sequence entries, part 75.
1918. gbinv76.seq - Invertebrate sequence entries, part 76.
1919. gbinv77.seq - Invertebrate sequence entries, part 77.
1920. gbinv78.seq - Invertebrate sequence entries, part 78.
1921. gbinv79.seq - Invertebrate sequence entries, part 79.
1922. gbinv8.seq - Invertebrate sequence entries, part 8.
1923. gbinv80.seq - Invertebrate sequence entries, part 80.
1924. gbinv81.seq - Invertebrate sequence entries, part 81.
1925. gbinv82.seq - Invertebrate sequence entries, part 82.
1926. gbinv83.seq - Invertebrate sequence entries, part 83.
1927. gbinv84.seq - Invertebrate sequence entries, part 84.
1928. gbinv85.seq - Invertebrate sequence entries, part 85.
1929. gbinv86.seq - Invertebrate sequence entries, part 86.
1930. gbinv87.seq - Invertebrate sequence entries, part 87.
1931. gbinv88.seq - Invertebrate sequence entries, part 88.
1932. gbinv89.seq - Invertebrate sequence entries, part 89.
1933. gbinv9.seq - Invertebrate sequence entries, part 9.
1934. gbinv90.seq - Invertebrate sequence entries, part 90.
1935. gbinv91.seq - Invertebrate sequence entries, part 91.
1936. gbinv92.seq - Invertebrate sequence entries, part 92.
1937. gbinv93.seq - Invertebrate sequence entries, part 93.
1938. gbinv94.seq - Invertebrate sequence entries, part 94.
1939. gbinv95.seq - Invertebrate sequence entries, part 95.
1940. gbinv96.seq - Invertebrate sequence entries, part 96.
1941. gbinv97.seq - Invertebrate sequence entries, part 97.
1942. gbinv98.seq - Invertebrate sequence entries, part 98.
1943. gbinv99.seq - Invertebrate sequence entries, part 99.
1944. gbmam1.seq - Other mammalian sequence entries, part 1.
1945. gbmam10.seq - Other mammalian sequence entries, part 10.
1946. gbmam11.seq - Other mammalian sequence entries, part 11.
1947. gbmam12.seq - Other mammalian sequence entries, part 12.
1948. gbmam13.seq - Other mammalian sequence entries, part 13.
1949. gbmam14.seq - Other mammalian sequence entries, part 14.
1950. gbmam15.seq - Other mammalian sequence entries, part 15.
1951. gbmam16.seq - Other mammalian sequence entries, part 16.
1952. gbmam17.seq - Other mammalian sequence entries, part 17.
1953. gbmam18.seq - Other mammalian sequence entries, part 18.
1954. gbmam19.seq - Other mammalian sequence entries, part 19.
1955. gbmam2.seq - Other mammalian sequence entries, part 2.
1956. gbmam20.seq - Other mammalian sequence entries, part 20.
1957. gbmam21.seq - Other mammalian sequence entries, part 21.
1958. gbmam22.seq - Other mammalian sequence entries, part 22.
1959. gbmam23.seq - Other mammalian sequence entries, part 23.
1960. gbmam24.seq - Other mammalian sequence entries, part 24.
1961. gbmam25.seq - Other mammalian sequence entries, part 25.
1962. gbmam26.seq - Other mammalian sequence entries, part 26.
1963. gbmam27.seq - Other mammalian sequence entries, part 27.
1964. gbmam28.seq - Other mammalian sequence entries, part 28.
1965. gbmam29.seq - Other mammalian sequence entries, part 29.
1966. gbmam3.seq - Other mammalian sequence entries, part 3.
1967. gbmam30.seq - Other mammalian sequence entries, part 30.
1968. gbmam31.seq - Other mammalian sequence entries, part 31.
1969. gbmam32.seq - Other mammalian sequence entries, part 32.
1970. gbmam33.seq - Other mammalian sequence entries, part 33.
1971. gbmam34.seq - Other mammalian sequence entries, part 34.
1972. gbmam35.seq - Other mammalian sequence entries, part 35.
1973. gbmam36.seq - Other mammalian sequence entries, part 36.
1974. gbmam37.seq - Other mammalian sequence entries, part 37.
1975. gbmam38.seq - Other mammalian sequence entries, part 38.
1976. gbmam39.seq - Other mammalian sequence entries, part 39.
1977. gbmam4.seq - Other mammalian sequence entries, part 4.
1978. gbmam5.seq - Other mammalian sequence entries, part 5.
1979. gbmam6.seq - Other mammalian sequence entries, part 6.
1980. gbmam7.seq - Other mammalian sequence entries, part 7.
1981. gbmam8.seq - Other mammalian sequence entries, part 8.
1982. gbmam9.seq - Other mammalian sequence entries, part 9.
1983. gbnew.txt - Accession numbers of entries new since the previous release.
1984. gbpat1.seq - Patent sequence entries, part 1.
1985. gbpat10.seq - Patent sequence entries, part 10.
1986. gbpat100.seq - Patent sequence entries, part 100.
1987. gbpat101.seq - Patent sequence entries, part 101.
1988. gbpat102.seq - Patent sequence entries, part 102.
1989. gbpat103.seq - Patent sequence entries, part 103.
1990. gbpat104.seq - Patent sequence entries, part 104.
1991. gbpat105.seq - Patent sequence entries, part 105.
1992. gbpat106.seq - Patent sequence entries, part 106.
1993. gbpat107.seq - Patent sequence entries, part 107.
1994. gbpat108.seq - Patent sequence entries, part 108.
1995. gbpat109.seq - Patent sequence entries, part 109.
1996. gbpat11.seq - Patent sequence entries, part 11.
1997. gbpat110.seq - Patent sequence entries, part 110.
1998. gbpat111.seq - Patent sequence entries, part 111.
1999. gbpat112.seq - Patent sequence entries, part 112.
2000. gbpat113.seq - Patent sequence entries, part 113.
2001. gbpat114.seq - Patent sequence entries, part 114.
2002. gbpat115.seq - Patent sequence entries, part 115.
2003. gbpat116.seq - Patent sequence entries, part 116.
2004. gbpat117.seq - Patent sequence entries, part 117.
2005. gbpat118.seq - Patent sequence entries, part 118.
2006. gbpat119.seq - Patent sequence entries, part 119.
2007. gbpat12.seq - Patent sequence entries, part 12.
2008. gbpat120.seq - Patent sequence entries, part 120.
2009. gbpat121.seq - Patent sequence entries, part 121.
2010. gbpat122.seq - Patent sequence entries, part 122.
2011. gbpat123.seq - Patent sequence entries, part 123.
2012. gbpat124.seq - Patent sequence entries, part 124.
2013. gbpat125.seq - Patent sequence entries, part 125.
2014. gbpat126.seq - Patent sequence entries, part 126.
2015. gbpat127.seq - Patent sequence entries, part 127.
2016. gbpat128.seq - Patent sequence entries, part 128.
2017. gbpat129.seq - Patent sequence entries, part 129.
2018. gbpat13.seq - Patent sequence entries, part 13.
2019. gbpat130.seq - Patent sequence entries, part 130.
2020. gbpat131.seq - Patent sequence entries, part 131.
2021. gbpat132.seq - Patent sequence entries, part 132.
2022. gbpat133.seq - Patent sequence entries, part 133.
2023. gbpat134.seq - Patent sequence entries, part 134.
2024. gbpat135.seq - Patent sequence entries, part 135.
2025. gbpat136.seq - Patent sequence entries, part 136.
2026. gbpat137.seq - Patent sequence entries, part 137.
2027. gbpat138.seq - Patent sequence entries, part 138.
2028. gbpat139.seq - Patent sequence entries, part 139.
2029. gbpat14.seq - Patent sequence entries, part 14.
2030. gbpat140.seq - Patent sequence entries, part 140.
2031. gbpat141.seq - Patent sequence entries, part 141.
2032. gbpat142.seq - Patent sequence entries, part 142.
2033. gbpat143.seq - Patent sequence entries, part 143.
2034. gbpat144.seq - Patent sequence entries, part 144.
2035. gbpat145.seq - Patent sequence entries, part 145.
2036. gbpat146.seq - Patent sequence entries, part 146.
2037. gbpat147.seq - Patent sequence entries, part 147.
2038. gbpat148.seq - Patent sequence entries, part 148.
2039. gbpat149.seq - Patent sequence entries, part 149.
2040. gbpat15.seq - Patent sequence entries, part 15.
2041. gbpat150.seq - Patent sequence entries, part 150.
2042. gbpat151.seq - Patent sequence entries, part 151.
2043. gbpat152.seq - Patent sequence entries, part 152.
2044. gbpat153.seq - Patent sequence entries, part 153.
2045. gbpat154.seq - Patent sequence entries, part 154.
2046. gbpat155.seq - Patent sequence entries, part 155.
2047. gbpat156.seq - Patent sequence entries, part 156.
2048. gbpat157.seq - Patent sequence entries, part 157.
2049. gbpat158.seq - Patent sequence entries, part 158.
2050. gbpat159.seq - Patent sequence entries, part 159.
2051. gbpat16.seq - Patent sequence entries, part 16.
2052. gbpat160.seq - Patent sequence entries, part 160.
2053. gbpat161.seq - Patent sequence entries, part 161.
2054. gbpat162.seq - Patent sequence entries, part 162.
2055. gbpat163.seq - Patent sequence entries, part 163.
2056. gbpat164.seq - Patent sequence entries, part 164.
2057. gbpat165.seq - Patent sequence entries, part 165.
2058. gbpat166.seq - Patent sequence entries, part 166.
2059. gbpat167.seq - Patent sequence entries, part 167.
2060. gbpat168.seq - Patent sequence entries, part 168.
2061. gbpat169.seq - Patent sequence entries, part 169.
2062. gbpat17.seq - Patent sequence entries, part 17.
2063. gbpat170.seq - Patent sequence entries, part 170.
2064. gbpat171.seq - Patent sequence entries, part 171.
2065. gbpat172.seq - Patent sequence entries, part 172.
2066. gbpat173.seq - Patent sequence entries, part 173.
2067. gbpat174.seq - Patent sequence entries, part 174.
2068. gbpat175.seq - Patent sequence entries, part 175.
2069. gbpat176.seq - Patent sequence entries, part 176.
2070. gbpat177.seq - Patent sequence entries, part 177.
2071. gbpat178.seq - Patent sequence entries, part 178.
2072. gbpat179.seq - Patent sequence entries, part 179.
2073. gbpat18.seq - Patent sequence entries, part 18.
2074. gbpat180.seq - Patent sequence entries, part 180.
2075. gbpat181.seq - Patent sequence entries, part 181.
2076. gbpat182.seq - Patent sequence entries, part 182.
2077. gbpat183.seq - Patent sequence entries, part 183.
2078. gbpat184.seq - Patent sequence entries, part 184.
2079. gbpat185.seq - Patent sequence entries, part 185.
2080. gbpat186.seq - Patent sequence entries, part 186.
2081. gbpat187.seq - Patent sequence entries, part 187.
2082. gbpat188.seq - Patent sequence entries, part 188.
2083. gbpat189.seq - Patent sequence entries, part 189.
2084. gbpat19.seq - Patent sequence entries, part 19.
2085. gbpat190.seq - Patent sequence entries, part 190.
2086. gbpat191.seq - Patent sequence entries, part 191.
2087. gbpat192.seq - Patent sequence entries, part 192.
2088. gbpat193.seq - Patent sequence entries, part 193.
2089. gbpat194.seq - Patent sequence entries, part 194.
2090. gbpat195.seq - Patent sequence entries, part 195.
2091. gbpat196.seq - Patent sequence entries, part 196.
2092. gbpat197.seq - Patent sequence entries, part 197.
2093. gbpat198.seq - Patent sequence entries, part 198.
2094. gbpat199.seq - Patent sequence entries, part 199.
2095. gbpat2.seq - Patent sequence entries, part 2.
2096. gbpat20.seq - Patent sequence entries, part 20.
2097. gbpat200.seq - Patent sequence entries, part 200.
2098. gbpat201.seq - Patent sequence entries, part 201.
2099. gbpat202.seq - Patent sequence entries, part 202.
2100. gbpat203.seq - Patent sequence entries, part 203.
2101. gbpat204.seq - Patent sequence entries, part 204.
2102. gbpat205.seq - Patent sequence entries, part 205.
2103. gbpat206.seq - Patent sequence entries, part 206.
2104. gbpat207.seq - Patent sequence entries, part 207.
2105. gbpat208.seq - Patent sequence entries, part 208.
2106. gbpat209.seq - Patent sequence entries, part 209.
2107. gbpat21.seq - Patent sequence entries, part 21.
2108. gbpat210.seq - Patent sequence entries, part 210.
2109. gbpat211.seq - Patent sequence entries, part 211.
2110. gbpat212.seq - Patent sequence entries, part 212.
2111. gbpat213.seq - Patent sequence entries, part 213.
2112. gbpat214.seq - Patent sequence entries, part 214.
2113. gbpat215.seq - Patent sequence entries, part 215.
2114. gbpat216.seq - Patent sequence entries, part 216.
2115. gbpat217.seq - Patent sequence entries, part 217.
2116. gbpat218.seq - Patent sequence entries, part 218.
2117. gbpat219.seq - Patent sequence entries, part 219.
2118. gbpat22.seq - Patent sequence entries, part 22.
2119. gbpat220.seq - Patent sequence entries, part 220.
2120. gbpat221.seq - Patent sequence entries, part 221.
2121. gbpat222.seq - Patent sequence entries, part 222.
2122. gbpat223.seq - Patent sequence entries, part 223.
2123. gbpat224.seq - Patent sequence entries, part 224.
2124. gbpat225.seq - Patent sequence entries, part 225.
2125. gbpat226.seq - Patent sequence entries, part 226.
2126. gbpat227.seq - Patent sequence entries, part 227.
2127. gbpat228.seq - Patent sequence entries, part 228.
2128. gbpat229.seq - Patent sequence entries, part 229.
2129. gbpat23.seq - Patent sequence entries, part 23.
2130. gbpat230.seq - Patent sequence entries, part 230.
2131. gbpat231.seq - Patent sequence entries, part 231.
2132. gbpat232.seq - Patent sequence entries, part 232.
2133. gbpat233.seq - Patent sequence entries, part 233.
2134. gbpat234.seq - Patent sequence entries, part 234.
2135. gbpat235.seq - Patent sequence entries, part 235.
2136. gbpat236.seq - Patent sequence entries, part 236.
2137. gbpat237.seq - Patent sequence entries, part 237.
2138. gbpat238.seq - Patent sequence entries, part 238.
2139. gbpat239.seq - Patent sequence entries, part 239.
2140. gbpat24.seq - Patent sequence entries, part 24.
2141. gbpat240.seq - Patent sequence entries, part 240.
2142. gbpat241.seq - Patent sequence entries, part 241.
2143. gbpat242.seq - Patent sequence entries, part 242.
2144. gbpat243.seq - Patent sequence entries, part 243.
2145. gbpat244.seq - Patent sequence entries, part 244.
2146. gbpat245.seq - Patent sequence entries, part 245.
2147. gbpat246.seq - Patent sequence entries, part 246.
2148. gbpat247.seq - Patent sequence entries, part 247.
2149. gbpat248.seq - Patent sequence entries, part 248.
2150. gbpat249.seq - Patent sequence entries, part 249.
2151. gbpat25.seq - Patent sequence entries, part 25.
2152. gbpat250.seq - Patent sequence entries, part 250.
2153. gbpat251.seq - Patent sequence entries, part 251.
2154. gbpat252.seq - Patent sequence entries, part 252.
2155. gbpat253.seq - Patent sequence entries, part 253.
2156. gbpat254.seq - Patent sequence entries, part 254.
2157. gbpat255.seq - Patent sequence entries, part 255.
2158. gbpat256.seq - Patent sequence entries, part 256.
2159. gbpat257.seq - Patent sequence entries, part 257.
2160. gbpat258.seq - Patent sequence entries, part 258.
2161. gbpat259.seq - Patent sequence entries, part 259.
2162. gbpat26.seq - Patent sequence entries, part 26.
2163. gbpat260.seq - Patent sequence entries, part 260.
2164. gbpat261.seq - Patent sequence entries, part 261.
2165. gbpat262.seq - Patent sequence entries, part 262.
2166. gbpat263.seq - Patent sequence entries, part 263.
2167. gbpat264.seq - Patent sequence entries, part 264.
2168. gbpat265.seq - Patent sequence entries, part 265.
2169. gbpat266.seq - Patent sequence entries, part 266.
2170. gbpat267.seq - Patent sequence entries, part 267.
2171. gbpat268.seq - Patent sequence entries, part 268.
2172. gbpat269.seq - Patent sequence entries, part 269.
2173. gbpat27.seq - Patent sequence entries, part 27.
2174. gbpat270.seq - Patent sequence entries, part 270.
2175. gbpat271.seq - Patent sequence entries, part 271.
2176. gbpat272.seq - Patent sequence entries, part 272.
2177. gbpat273.seq - Patent sequence entries, part 273.
2178. gbpat274.seq - Patent sequence entries, part 274.
2179. gbpat275.seq - Patent sequence entries, part 275.
2180. gbpat276.seq - Patent sequence entries, part 276.
2181. gbpat277.seq - Patent sequence entries, part 277.
2182. gbpat278.seq - Patent sequence entries, part 278.
2183. gbpat279.seq - Patent sequence entries, part 279.
2184. gbpat28.seq - Patent sequence entries, part 28.
2185. gbpat280.seq - Patent sequence entries, part 280.
2186. gbpat281.seq - Patent sequence entries, part 281.
2187. gbpat282.seq - Patent sequence entries, part 282.
2188. gbpat283.seq - Patent sequence entries, part 283.
2189. gbpat284.seq - Patent sequence entries, part 284.
2190. gbpat285.seq - Patent sequence entries, part 285.
2191. gbpat286.seq - Patent sequence entries, part 286.
2192. gbpat287.seq - Patent sequence entries, part 287.
2193. gbpat288.seq - Patent sequence entries, part 288.
2194. gbpat289.seq - Patent sequence entries, part 289.
2195. gbpat29.seq - Patent sequence entries, part 29.
2196. gbpat290.seq - Patent sequence entries, part 290.
2197. gbpat291.seq - Patent sequence entries, part 291.
2198. gbpat3.seq - Patent sequence entries, part 3.
2199. gbpat30.seq - Patent sequence entries, part 30.
2200. gbpat31.seq - Patent sequence entries, part 31.
2201. gbpat32.seq - Patent sequence entries, part 32.
2202. gbpat33.seq - Patent sequence entries, part 33.
2203. gbpat34.seq - Patent sequence entries, part 34.
2204. gbpat35.seq - Patent sequence entries, part 35.
2205. gbpat36.seq - Patent sequence entries, part 36.
2206. gbpat37.seq - Patent sequence entries, part 37.
2207. gbpat38.seq - Patent sequence entries, part 38.
2208. gbpat39.seq - Patent sequence entries, part 39.
2209. gbpat4.seq - Patent sequence entries, part 4.
2210. gbpat40.seq - Patent sequence entries, part 40.
2211. gbpat41.seq - Patent sequence entries, part 41.
2212. gbpat42.seq - Patent sequence entries, part 42.
2213. gbpat43.seq - Patent sequence entries, part 43.
2214. gbpat44.seq - Patent sequence entries, part 44.
2215. gbpat45.seq - Patent sequence entries, part 45.
2216. gbpat46.seq - Patent sequence entries, part 46.
2217. gbpat47.seq - Patent sequence entries, part 47.
2218. gbpat48.seq - Patent sequence entries, part 48.
2219. gbpat49.seq - Patent sequence entries, part 49.
2220. gbpat5.seq - Patent sequence entries, part 5.
2221. gbpat50.seq - Patent sequence entries, part 50.
2222. gbpat51.seq - Patent sequence entries, part 51.
2223. gbpat52.seq - Patent sequence entries, part 52.
2224. gbpat53.seq - Patent sequence entries, part 53.
2225. gbpat54.seq - Patent sequence entries, part 54.
2226. gbpat55.seq - Patent sequence entries, part 55.
2227. gbpat56.seq - Patent sequence entries, part 56.
2228. gbpat57.seq - Patent sequence entries, part 57.
2229. gbpat58.seq - Patent sequence entries, part 58.
2230. gbpat59.seq - Patent sequence entries, part 59.
2231. gbpat6.seq - Patent sequence entries, part 6.
2232. gbpat60.seq - Patent sequence entries, part 60.
2233. gbpat61.seq - Patent sequence entries, part 61.
2234. gbpat62.seq - Patent sequence entries, part 62.
2235. gbpat63.seq - Patent sequence entries, part 63.
2236. gbpat64.seq - Patent sequence entries, part 64.
2237. gbpat65.seq - Patent sequence entries, part 65.
2238. gbpat66.seq - Patent sequence entries, part 66.
2239. gbpat67.seq - Patent sequence entries, part 67.
2240. gbpat68.seq - Patent sequence entries, part 68.
2241. gbpat69.seq - Patent sequence entries, part 69.
2242. gbpat7.seq - Patent sequence entries, part 7.
2243. gbpat70.seq - Patent sequence entries, part 70.
2244. gbpat71.seq - Patent sequence entries, part 71.
2245. gbpat72.seq - Patent sequence entries, part 72.
2246. gbpat73.seq - Patent sequence entries, part 73.
2247. gbpat74.seq - Patent sequence entries, part 74.
2248. gbpat75.seq - Patent sequence entries, part 75.
2249. gbpat76.seq - Patent sequence entries, part 76.
2250. gbpat77.seq - Patent sequence entries, part 77.
2251. gbpat78.seq - Patent sequence entries, part 78.
2252. gbpat79.seq - Patent sequence entries, part 79.
2253. gbpat8.seq - Patent sequence entries, part 8.
2254. gbpat80.seq - Patent sequence entries, part 80.
2255. gbpat81.seq - Patent sequence entries, part 81.
2256. gbpat82.seq - Patent sequence entries, part 82.
2257. gbpat83.seq - Patent sequence entries, part 83.
2258. gbpat84.seq - Patent sequence entries, part 84.
2259. gbpat85.seq - Patent sequence entries, part 85.
2260. gbpat86.seq - Patent sequence entries, part 86.
2261. gbpat87.seq - Patent sequence entries, part 87.
2262. gbpat88.seq - Patent sequence entries, part 88.
2263. gbpat89.seq - Patent sequence entries, part 89.
2264. gbpat9.seq - Patent sequence entries, part 9.
2265. gbpat90.seq - Patent sequence entries, part 90.
2266. gbpat91.seq - Patent sequence entries, part 91.
2267. gbpat92.seq - Patent sequence entries, part 92.
2268. gbpat93.seq - Patent sequence entries, part 93.
2269. gbpat94.seq - Patent sequence entries, part 94.
2270. gbpat95.seq - Patent sequence entries, part 95.
2271. gbpat96.seq - Patent sequence entries, part 96.
2272. gbpat97.seq - Patent sequence entries, part 97.
2273. gbpat98.seq - Patent sequence entries, part 98.
2274. gbpat99.seq - Patent sequence entries, part 99.
2275. gbphg1.seq - Phage sequence entries, part 1.
2276. gbphg2.seq - Phage sequence entries, part 2.
2277. gbphg3.seq - Phage sequence entries, part 3.
2278. gbphg4.seq - Phage sequence entries, part 4.
2279. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2280. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2281. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2282. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2283. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2284. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2285. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2286. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2287. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2288. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2289. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2290. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2291. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2292. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2293. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2294. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2295. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2296. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2297. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2298. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2299. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2300. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2301. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2302. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2303. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2304. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2305. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2306. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2307. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2308. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2309. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2310. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2311. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2312. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2313. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2314. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2315. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2316. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2317. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2318. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2319. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2320. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2321. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2322. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2323. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2324. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2325. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2326. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2327. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2328. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2329. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2330. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2331. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2332. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2333. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2334. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2335. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2336. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2337. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2338. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2339. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2340. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2341. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2342. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2343. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2344. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2345. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2346. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2347. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2348. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2349. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2350. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2351. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2352. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2353. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2354. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2355. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2356. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2357. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2358. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2359. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2360. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2361. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2362. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2363. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2364. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2365. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2366. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2367. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2368. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2369. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2370. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2371. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2372. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2373. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2374. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2375. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2376. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2377. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2378. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2379. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2380. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2381. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2382. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2383. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2384. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2385. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2386. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2387. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2388. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2389. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2390. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2391. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2392. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2393. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2394. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2395. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2396. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2397. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2398. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2399. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2400. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2401. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2402. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2403. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2404. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2405. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2406. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2407. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2408. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2409. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2410. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2411. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2412. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2413. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2414. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2415. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2416. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2417. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2418. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2419. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2420. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2421. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2422. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2423. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2424. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2425. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2426. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2427. gbpri1.seq - Primate sequence entries, part 1.
2428. gbpri10.seq - Primate sequence entries, part 10.
2429. gbpri11.seq - Primate sequence entries, part 11.
2430. gbpri12.seq - Primate sequence entries, part 12.
2431. gbpri13.seq - Primate sequence entries, part 13.
2432. gbpri14.seq - Primate sequence entries, part 14.
2433. gbpri15.seq - Primate sequence entries, part 15.
2434. gbpri16.seq - Primate sequence entries, part 16.
2435. gbpri17.seq - Primate sequence entries, part 17.
2436. gbpri18.seq - Primate sequence entries, part 18.
2437. gbpri19.seq - Primate sequence entries, part 19.
2438. gbpri2.seq - Primate sequence entries, part 2.
2439. gbpri20.seq - Primate sequence entries, part 20.
2440. gbpri21.seq - Primate sequence entries, part 21.
2441. gbpri22.seq - Primate sequence entries, part 22.
2442. gbpri23.seq - Primate sequence entries, part 23.
2443. gbpri24.seq - Primate sequence entries, part 24.
2444. gbpri25.seq - Primate sequence entries, part 25.
2445. gbpri26.seq - Primate sequence entries, part 26.
2446. gbpri27.seq - Primate sequence entries, part 27.
2447. gbpri28.seq - Primate sequence entries, part 28.
2448. gbpri29.seq - Primate sequence entries, part 29.
2449. gbpri3.seq - Primate sequence entries, part 3.
2450. gbpri30.seq - Primate sequence entries, part 30.
2451. gbpri31.seq - Primate sequence entries, part 31.
2452. gbpri32.seq - Primate sequence entries, part 32.
2453. gbpri33.seq - Primate sequence entries, part 33.
2454. gbpri34.seq - Primate sequence entries, part 34.
2455. gbpri35.seq - Primate sequence entries, part 35.
2456. gbpri36.seq - Primate sequence entries, part 36.
2457. gbpri37.seq - Primate sequence entries, part 37.
2458. gbpri38.seq - Primate sequence entries, part 38.
2459. gbpri39.seq - Primate sequence entries, part 39.
2460. gbpri4.seq - Primate sequence entries, part 4.
2461. gbpri40.seq - Primate sequence entries, part 40.
2462. gbpri41.seq - Primate sequence entries, part 41.
2463. gbpri42.seq - Primate sequence entries, part 42.
2464. gbpri43.seq - Primate sequence entries, part 43.
2465. gbpri44.seq - Primate sequence entries, part 44.
2466. gbpri45.seq - Primate sequence entries, part 45.
2467. gbpri46.seq - Primate sequence entries, part 46.
2468. gbpri47.seq - Primate sequence entries, part 47.
2469. gbpri48.seq - Primate sequence entries, part 48.
2470. gbpri49.seq - Primate sequence entries, part 49.
2471. gbpri5.seq - Primate sequence entries, part 5.
2472. gbpri50.seq - Primate sequence entries, part 50.
2473. gbpri51.seq - Primate sequence entries, part 51.
2474. gbpri52.seq - Primate sequence entries, part 52.
2475. gbpri53.seq - Primate sequence entries, part 53.
2476. gbpri54.seq - Primate sequence entries, part 54.
2477. gbpri55.seq - Primate sequence entries, part 55.
2478. gbpri56.seq - Primate sequence entries, part 56.
2479. gbpri6.seq - Primate sequence entries, part 6.
2480. gbpri7.seq - Primate sequence entries, part 7.
2481. gbpri8.seq - Primate sequence entries, part 8.
2482. gbpri9.seq - Primate sequence entries, part 9.
2483. gbrel.txt - Release notes (this document).
2484. gbrod1.seq - Rodent sequence entries, part 1.
2485. gbrod10.seq - Rodent sequence entries, part 10.
2486. gbrod11.seq - Rodent sequence entries, part 11.
2487. gbrod12.seq - Rodent sequence entries, part 12.
2488. gbrod13.seq - Rodent sequence entries, part 13.
2489. gbrod14.seq - Rodent sequence entries, part 14.
2490. gbrod15.seq - Rodent sequence entries, part 15.
2491. gbrod16.seq - Rodent sequence entries, part 16.
2492. gbrod17.seq - Rodent sequence entries, part 17.
2493. gbrod18.seq - Rodent sequence entries, part 18.
2494. gbrod19.seq - Rodent sequence entries, part 19.
2495. gbrod2.seq - Rodent sequence entries, part 2.
2496. gbrod20.seq - Rodent sequence entries, part 20.
2497. gbrod21.seq - Rodent sequence entries, part 21.
2498. gbrod22.seq - Rodent sequence entries, part 22.
2499. gbrod23.seq - Rodent sequence entries, part 23.
2500. gbrod24.seq - Rodent sequence entries, part 24.
2501. gbrod25.seq - Rodent sequence entries, part 25.
2502. gbrod26.seq - Rodent sequence entries, part 26.
2503. gbrod27.seq - Rodent sequence entries, part 27.
2504. gbrod28.seq - Rodent sequence entries, part 28.
2505. gbrod29.seq - Rodent sequence entries, part 29.
2506. gbrod3.seq - Rodent sequence entries, part 3.
2507. gbrod30.seq - Rodent sequence entries, part 30.
2508. gbrod4.seq - Rodent sequence entries, part 4.
2509. gbrod5.seq - Rodent sequence entries, part 5.
2510. gbrod6.seq - Rodent sequence entries, part 6.
2511. gbrod7.seq - Rodent sequence entries, part 7.
2512. gbrod8.seq - Rodent sequence entries, part 8.
2513. gbrod9.seq - Rodent sequence entries, part 9.
2514. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2515. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2516. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2517. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2518. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2519. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2520. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2521. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2522. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2523. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2524. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2525. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2526. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2527. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2528. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2529. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2530. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2531. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2532. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2533. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2534. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2535. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2536. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2537. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2538. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2539. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2540. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2541. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2542. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2543. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2544. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2545. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2546. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2547. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2548. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2549. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2550. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2551. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2552. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2553. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2554. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2555. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2556. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2557. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2558. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2559. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2560. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2561. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2562. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2563. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2564. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2565. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2566. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2567. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2568. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2569. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2570. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2571. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2572. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2573. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2574. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2575. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2576. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2577. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2578. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2579. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2580. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2581. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2582. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2583. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2584. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2585. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2586. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2587. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2588. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2589. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2590. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2591. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2592. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2593. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2594. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2595. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2596. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2597. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2598. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2599. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2600. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2601. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2602. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2603. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2604. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2605. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2606. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2607. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2608. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2609. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2610. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2611. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2612. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2613. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2614. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2615. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2616. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2617. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2618. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2619. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2620. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2621. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2622. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2623. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2624. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2625. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2626. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2627. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2628. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2629. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2630. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2631. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2632. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2633. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2634. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2635. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2636. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2637. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2638. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2639. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2640. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2641. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2642. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2643. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2644. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2645. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2646. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2647. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2648. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2649. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2650. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2651. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2652. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2653. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2654. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2655. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2656. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2657. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2658. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2659. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2660. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2661. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2662. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2663. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2664. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2665. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2666. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2667. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2668. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2669. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2670. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2671. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2672. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2673. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2674. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2675. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2676. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2677. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2678. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2679. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2680. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2681. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2682. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2683. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2684. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2685. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2686. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2687. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2688. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2689. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2690. gbtsa230.seq - TSA (transcriptome shotgun assembly) sequence entries, part 230.
2691. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2692. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2693. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2694. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2695. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2696. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2697. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2698. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2699. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2700. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2701. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2702. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2703. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2704. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2705. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2706. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2707. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2708. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2709. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2710. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2711. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2712. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2713. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2714. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2715. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2716. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2717. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2718. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2719. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2720. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2721. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2722. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2723. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2724. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2725. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2726. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2727. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2728. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2729. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2730. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2731. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2732. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2733. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2734. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2735. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2736. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2737. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2738. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2739. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2740. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2741. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2742. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2743. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2744. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2745. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2746. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2747. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2748. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2749. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2750. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2751. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2752. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2753. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2754. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2755. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2756. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2757. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2758. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2759. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2760. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2761. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2762. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2763. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2764. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2765. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2766. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2767. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2768. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2769. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2770. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2771. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2772. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2773. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2774. gbuna1.seq - Unannotated sequence entries, part 1.
2775. gbvrl1.seq - Viral sequence entries, part 1.
2776. gbvrl10.seq - Viral sequence entries, part 10.
2777. gbvrl11.seq - Viral sequence entries, part 11.
2778. gbvrl12.seq - Viral sequence entries, part 12.
2779. gbvrl13.seq - Viral sequence entries, part 13.
2780. gbvrl14.seq - Viral sequence entries, part 14.
2781. gbvrl15.seq - Viral sequence entries, part 15.
2782. gbvrl16.seq - Viral sequence entries, part 16.
2783. gbvrl17.seq - Viral sequence entries, part 17.
2784. gbvrl18.seq - Viral sequence entries, part 18.
2785. gbvrl19.seq - Viral sequence entries, part 19.
2786. gbvrl2.seq - Viral sequence entries, part 2.
2787. gbvrl20.seq - Viral sequence entries, part 20.
2788. gbvrl21.seq - Viral sequence entries, part 21.
2789. gbvrl22.seq - Viral sequence entries, part 22.
2790. gbvrl23.seq - Viral sequence entries, part 23.
2791. gbvrl24.seq - Viral sequence entries, part 24.
2792. gbvrl25.seq - Viral sequence entries, part 25.
2793. gbvrl26.seq - Viral sequence entries, part 26.
2794. gbvrl27.seq - Viral sequence entries, part 27.
2795. gbvrl28.seq - Viral sequence entries, part 28.
2796. gbvrl29.seq - Viral sequence entries, part 29.
2797. gbvrl3.seq - Viral sequence entries, part 3.
2798. gbvrl30.seq - Viral sequence entries, part 30.
2799. gbvrl31.seq - Viral sequence entries, part 31.
2800. gbvrl32.seq - Viral sequence entries, part 32.
2801. gbvrl33.seq - Viral sequence entries, part 33.
2802. gbvrl34.seq - Viral sequence entries, part 34.
2803. gbvrl35.seq - Viral sequence entries, part 35.
2804. gbvrl36.seq - Viral sequence entries, part 36.
2805. gbvrl37.seq - Viral sequence entries, part 37.
2806. gbvrl38.seq - Viral sequence entries, part 38.
2807. gbvrl39.seq - Viral sequence entries, part 39.
2808. gbvrl4.seq - Viral sequence entries, part 4.
2809. gbvrl40.seq - Viral sequence entries, part 40.
2810. gbvrl41.seq - Viral sequence entries, part 41.
2811. gbvrl42.seq - Viral sequence entries, part 42.
2812. gbvrl43.seq - Viral sequence entries, part 43.
2813. gbvrl44.seq - Viral sequence entries, part 44.
2814. gbvrl45.seq - Viral sequence entries, part 45.
2815. gbvrl46.seq - Viral sequence entries, part 46.
2816. gbvrl47.seq - Viral sequence entries, part 47.
2817. gbvrl48.seq - Viral sequence entries, part 48.
2818. gbvrl49.seq - Viral sequence entries, part 49.
2819. gbvrl5.seq - Viral sequence entries, part 5.
2820. gbvrl6.seq - Viral sequence entries, part 6.
2821. gbvrl7.seq - Viral sequence entries, part 7.
2822. gbvrl8.seq - Viral sequence entries, part 8.
2823. gbvrl9.seq - Viral sequence entries, part 9.
2824. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2825. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2826. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2827. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2828. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2829. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2830. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2831. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2832. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2833. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2834. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2835. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2836. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2837. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2838. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2839. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2840. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2841. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2842. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2843. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2844. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2845. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2846. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2847. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2848. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2849. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2850. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2851. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2852. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2853. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2854. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2855. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2856. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2857. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2858. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2859. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2860. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2861. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2862. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2863. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2864. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2865. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2866. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2867. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2868. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2869. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2870. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2871. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2872. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2873. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2874. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2875. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2876. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2877. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2878. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2879. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2880. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2881. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2882. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2883. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2884. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2885. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2886. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2887. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 220.0 flatfiles require roughly 830 GB (sequence
files only) or 830 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 246693113     gbbct1.seq
 226339891     gbbct10.seq
 244826040     gbbct100.seq
 241012345     gbbct101.seq
 241358394     gbbct102.seq
 240018347     gbbct103.seq
 237108145     gbbct104.seq
 241190701     gbbct105.seq
 203783620     gbbct106.seq
 244951420     gbbct107.seq
 235498599     gbbct108.seq
 240783558     gbbct109.seq
 244995071     gbbct11.seq
 242814959     gbbct110.seq
 242411390     gbbct111.seq
 242434146     gbbct112.seq
 239090331     gbbct113.seq
 237594527     gbbct114.seq
 245342633     gbbct115.seq
 242483671     gbbct116.seq
 240647175     gbbct117.seq
  36035020     gbbct118.seq
 241009164     gbbct119.seq
 243500114     gbbct12.seq
 241974693     gbbct120.seq
 243500014     gbbct121.seq
 241387503     gbbct122.seq
 244812366     gbbct123.seq
 241859744     gbbct124.seq
 244788561     gbbct125.seq
 231696884     gbbct126.seq
 238709327     gbbct127.seq
 143350592     gbbct128.seq
 243058380     gbbct129.seq
 243941847     gbbct13.seq
 241430863     gbbct130.seq
 243021393     gbbct131.seq
 243591796     gbbct132.seq
 240850416     gbbct133.seq
 239444490     gbbct134.seq
 245389381     gbbct135.seq
  55581030     gbbct136.seq
 244041852     gbbct137.seq
 241424666     gbbct138.seq
 243791898     gbbct139.seq
 244935028     gbbct14.seq
 237902948     gbbct140.seq
 244652163     gbbct141.seq
 241891105     gbbct142.seq
 245324510     gbbct143.seq
  30889453     gbbct144.seq
 241267591     gbbct145.seq
 242274259     gbbct146.seq
 241254593     gbbct147.seq
 243283773     gbbct148.seq
 244745856     gbbct149.seq
 240253916     gbbct15.seq
 244912245     gbbct150.seq
 235821469     gbbct151.seq
  95908239     gbbct152.seq
 235947126     gbbct153.seq
 241659306     gbbct154.seq
 244596380     gbbct155.seq
 243579885     gbbct156.seq
 232929946     gbbct157.seq
 239933327     gbbct158.seq
 239914890     gbbct159.seq
 243306395     gbbct16.seq
 241359557     gbbct160.seq
  13752576     gbbct161.seq
 241763950     gbbct162.seq
 245556833     gbbct163.seq
 236678326     gbbct164.seq
 236759478     gbbct165.seq
 245282702     gbbct166.seq
 234896991     gbbct167.seq
 238204679     gbbct168.seq
 102437327     gbbct169.seq
 235569774     gbbct17.seq
 242963876     gbbct170.seq
 240826487     gbbct171.seq
 244503225     gbbct172.seq
 240458524     gbbct173.seq
 241567722     gbbct174.seq
 243381793     gbbct175.seq
 237440792     gbbct176.seq
 237888511     gbbct177.seq
 154882835     gbbct178.seq
 233085843     gbbct179.seq
 237922276     gbbct18.seq
 237937589     gbbct180.seq
 242426155     gbbct181.seq
 242364303     gbbct182.seq
 235904812     gbbct183.seq
 241195531     gbbct184.seq
 240932114     gbbct185.seq
 240209875     gbbct186.seq
 238105841     gbbct187.seq
 241859284     gbbct188.seq
 230830522     gbbct189.seq
 241292444     gbbct19.seq
 243345223     gbbct190.seq
 243708305     gbbct191.seq
 244061075     gbbct192.seq
  24078774     gbbct193.seq
 243950959     gbbct194.seq
 240029997     gbbct195.seq
 243596613     gbbct196.seq
 238220707     gbbct197.seq
 240467548     gbbct198.seq
 240963557     gbbct199.seq
 245288476     gbbct2.seq
 238510726     gbbct20.seq
 242686464     gbbct200.seq
 244811087     gbbct201.seq
 245063558     gbbct202.seq
 245355033     gbbct203.seq
 234470667     gbbct204.seq
 243091432     gbbct205.seq
 240285543     gbbct206.seq
  21002537     gbbct207.seq
 237214298     gbbct208.seq
 244446992     gbbct209.seq
 242561712     gbbct21.seq
 241747075     gbbct210.seq
 236084238     gbbct211.seq
 244808414     gbbct212.seq
 239724273     gbbct213.seq
 239225939     gbbct214.seq
  47377463     gbbct215.seq
 238321777     gbbct216.seq
 240982114     gbbct217.seq
 237920436     gbbct218.seq
 242909694     gbbct219.seq
 245512879     gbbct22.seq
 243843501     gbbct220.seq
 243951820     gbbct221.seq
 241060410     gbbct222.seq
 239717447     gbbct223.seq
 242209021     gbbct224.seq
 168036888     gbbct225.seq
 241589230     gbbct226.seq
 243260116     gbbct227.seq
 237047156     gbbct228.seq
 245349461     gbbct229.seq
    465112     gbbct23.seq
 237160583     gbbct230.seq
 238117733     gbbct231.seq
 243269036     gbbct232.seq
 242881034     gbbct233.seq
 242806357     gbbct234.seq
 231882053     gbbct235.seq
 187137045     gbbct236.seq
 235961418     gbbct237.seq
 241559410     gbbct238.seq
 245326569     gbbct239.seq
 238477157     gbbct24.seq
 241975533     gbbct240.seq
 242532693     gbbct241.seq
 242608254     gbbct242.seq
 241196475     gbbct243.seq
 240711025     gbbct244.seq
 239242518     gbbct245.seq
 244889418     gbbct246.seq
 242067081     gbbct247.seq
 242888597     gbbct248.seq
 176109987     gbbct249.seq
 242847950     gbbct25.seq
 236551600     gbbct250.seq
 243245991     gbbct251.seq
 240100899     gbbct252.seq
 244936749     gbbct253.seq
 240164712     gbbct254.seq
 235998613     gbbct255.seq
 236700046     gbbct256.seq
 241008243     gbbct257.seq
 245344975     gbbct258.seq
 242631006     gbbct259.seq
 240193409     gbbct26.seq
 243824015     gbbct260.seq
 245320850     gbbct261.seq
 243145671     gbbct262.seq
  24700210     gbbct263.seq
 241241074     gbbct264.seq
 239436677     gbbct265.seq
 244244883     gbbct266.seq
 241545394     gbbct267.seq
 242404952     gbbct268.seq
 241526816     gbbct269.seq
 241298663     gbbct27.seq
 241533479     gbbct270.seq
 242146790     gbbct271.seq
 236262040     gbbct272.seq
 237303342     gbbct273.seq
 238973451     gbbct274.seq
 234970798     gbbct275.seq
 239708792     gbbct276.seq
 239531766     gbbct277.seq
 245179126     gbbct278.seq
 243078337     gbbct279.seq
 239812633     gbbct28.seq
 241527118     gbbct280.seq
 242424915     gbbct281.seq
 236014007     gbbct282.seq
 241480100     gbbct283.seq
 236713711     gbbct284.seq
 155923002     gbbct285.seq
 244219335     gbbct286.seq
 238748498     gbbct287.seq
 242060653     gbbct288.seq
 241590468     gbbct289.seq
 240518745     gbbct29.seq
 234565326     gbbct290.seq
 245362041     gbbct291.seq
 245324000     gbbct292.seq
 240812552     gbbct293.seq
 224366529     gbbct294.seq
 238468684     gbbct295.seq
 243414584     gbbct296.seq
 242296579     gbbct297.seq
 242459980     gbbct298.seq
 240666131     gbbct299.seq
 242090616     gbbct3.seq
 238521742     gbbct30.seq
 239994384     gbbct300.seq
 243622653     gbbct301.seq
 243570623     gbbct302.seq
  76983185     gbbct303.seq
 235556368     gbbct304.seq
 240221085     gbbct305.seq
 241324158     gbbct306.seq
 236785189     gbbct307.seq
 236893088     gbbct308.seq
 243645608     gbbct309.seq
 235255560     gbbct31.seq
 173798087     gbbct310.seq
 233406141     gbbct311.seq
  72259084     gbbct312.seq
   6831134     gbbct313.seq
  14103772     gbbct314.seq
  22748420     gbbct315.seq
  44381424     gbbct316.seq
  86365939     gbbct317.seq
 168074911     gbbct318.seq
 246522333     gbbct319.seq
 214069574     gbbct32.seq
 246581014     gbbct320.seq
 244666172     gbbct321.seq
 242729643     gbbct322.seq
 236419049     gbbct323.seq
 231697285     gbbct324.seq
 242661739     gbbct325.seq
 240928588     gbbct326.seq
 245481684     gbbct327.seq
 246084245     gbbct328.seq
  72879118     gbbct329.seq
 238466083     gbbct33.seq
 242140327     gbbct330.seq
 240838643     gbbct331.seq
 245130736     gbbct332.seq
 243493701     gbbct333.seq
 236177750     gbbct334.seq
 245797773     gbbct335.seq
 246804531     gbbct336.seq
 246775524     gbbct337.seq
  17464500     gbbct338.seq
 247248989     gbbct339.seq
 241226623     gbbct34.seq
 247070308     gbbct340.seq
 246750299     gbbct341.seq
  46033508     gbbct342.seq
 246596422     gbbct343.seq
 246465135     gbbct344.seq
  66796790     gbbct345.seq
 246581319     gbbct346.seq
 182970878     gbbct347.seq
 246541901     gbbct348.seq
 246649415     gbbct349.seq
 244099087     gbbct35.seq
  26888007     gbbct350.seq
 246313532     gbbct351.seq
 247793247     gbbct352.seq
 242685231     gbbct353.seq
 245902723     gbbct354.seq
 241163604     gbbct355.seq
 223121219     gbbct356.seq
 244826079     gbbct357.seq
 243809610     gbbct358.seq
 236353296     gbbct359.seq
 243481659     gbbct36.seq
 234099302     gbbct360.seq
 245707508     gbbct361.seq
 237679338     gbbct362.seq
 244361370     gbbct363.seq
 243532733     gbbct364.seq
 243279100     gbbct365.seq
 240332611     gbbct366.seq
 238581166     gbbct367.seq
 243378149     gbbct368.seq
 197271040     gbbct369.seq
 244681275     gbbct37.seq
 120909626     gbbct370.seq
 239919309     gbbct38.seq
 242840692     gbbct39.seq
 245045591     gbbct4.seq
 245488249     gbbct40.seq
 245337365     gbbct41.seq
 236556585     gbbct42.seq
 240090846     gbbct43.seq
 245077518     gbbct44.seq
 162408471     gbbct45.seq
 242787985     gbbct46.seq
 242493574     gbbct47.seq
 243797214     gbbct48.seq
 242244303     gbbct49.seq
 245981959     gbbct5.seq
 237720264     gbbct50.seq
 242315653     gbbct51.seq
 244624140     gbbct52.seq
 244508696     gbbct53.seq
 235493144     gbbct54.seq
 244399841     gbbct55.seq
 244495483     gbbct56.seq
 240653976     gbbct57.seq
  48491100     gbbct58.seq
 240165716     gbbct59.seq
  55002611     gbbct6.seq
 241070973     gbbct60.seq
 234868442     gbbct61.seq
 243319068     gbbct62.seq
 235596172     gbbct63.seq
 242893951     gbbct64.seq
 245494162     gbbct65.seq
 242971298     gbbct66.seq
 243140416     gbbct67.seq
 244001741     gbbct68.seq
 243778204     gbbct69.seq
 235545214     gbbct7.seq
 243119982     gbbct70.seq
 244907903     gbbct71.seq
  62969048     gbbct72.seq
 244230375     gbbct73.seq
 243884454     gbbct74.seq
 245361256     gbbct75.seq
 242089926     gbbct76.seq
 235903264     gbbct77.seq
 239126793     gbbct78.seq
 245196106     gbbct79.seq
 159233364     gbbct8.seq
 239945130     gbbct80.seq
 242162951     gbbct81.seq
 243095519     gbbct82.seq
 240202813     gbbct83.seq
 237375517     gbbct84.seq
 238746356     gbbct85.seq
  92149913     gbbct86.seq
 245122922     gbbct87.seq
 241152337     gbbct88.seq
 240887935     gbbct89.seq
 245264181     gbbct9.seq
 242537359     gbbct90.seq
 244603711     gbbct91.seq
 242081055     gbbct92.seq
 243899082     gbbct93.seq
 237478881     gbbct94.seq
 242260265     gbbct95.seq
 243675938     gbbct96.seq
  25829273     gbbct97.seq
 244190624     gbbct98.seq
 235211178     gbbct99.seq
   1232054     gbchg.txt
 243482295     gbcon1.seq
 248352988     gbcon10.seq
 245127600     gbcon100.seq
 245659825     gbcon101.seq
  72154848     gbcon102.seq
 245734548     gbcon103.seq
 245473840     gbcon104.seq
 245205520     gbcon105.seq
 246063494     gbcon106.seq
 245561449     gbcon107.seq
  31855944     gbcon108.seq
 245197080     gbcon109.seq
 245523610     gbcon11.seq
 245251679     gbcon110.seq
 246071166     gbcon111.seq
 245919009     gbcon112.seq
 204932657     gbcon113.seq
 245448256     gbcon114.seq
 244738279     gbcon115.seq
 244676272     gbcon116.seq
 244553080     gbcon117.seq
 244621646     gbcon118.seq
 140546008     gbcon119.seq
 245558570     gbcon12.seq
 244574412     gbcon120.seq
 244655234     gbcon121.seq
 244670621     gbcon122.seq
 244435276     gbcon123.seq
 244726178     gbcon124.seq
 163052632     gbcon125.seq
 244498414     gbcon126.seq
 244448673     gbcon127.seq
 244064775     gbcon128.seq
 239770050     gbcon129.seq
 229693646     gbcon13.seq
 173591655     gbcon130.seq
 249550004     gbcon131.seq
 245069410     gbcon132.seq
  50482501     gbcon133.seq
 245480105     gbcon134.seq
 248649402     gbcon135.seq
 209440095     gbcon136.seq
 199346006     gbcon137.seq
 243338925     gbcon138.seq
 239942070     gbcon139.seq
 241914881     gbcon14.seq
 241197341     gbcon140.seq
 247010449     gbcon141.seq
 249134789     gbcon142.seq
 155319177     gbcon143.seq
 248344398     gbcon144.seq
 248665894     gbcon145.seq
 247179448     gbcon146.seq
 244013501     gbcon147.seq
 249922466     gbcon148.seq
 246259418     gbcon149.seq
 240854385     gbcon15.seq
 245713254     gbcon150.seq
  93461245     gbcon151.seq
 247095165     gbcon152.seq
 247087199     gbcon153.seq
 248307563     gbcon154.seq
 246060089     gbcon155.seq
 248824923     gbcon156.seq
 247345712     gbcon157.seq
 241416842     gbcon158.seq
 247641185     gbcon159.seq
 230693458     gbcon16.seq
  76908660     gbcon160.seq
 246098035     gbcon161.seq
 246786676     gbcon162.seq
 245623260     gbcon163.seq
 246904914     gbcon164.seq
 145188430     gbcon165.seq
 247884609     gbcon166.seq
 246829478     gbcon167.seq
 244869090     gbcon168.seq
 247125328     gbcon169.seq
 239671746     gbcon17.seq
 248388899     gbcon170.seq
 247265084     gbcon171.seq
 248516139     gbcon172.seq
 182058022     gbcon173.seq
 249004510     gbcon174.seq
 248418044     gbcon175.seq
 249123537     gbcon176.seq
 249187777     gbcon177.seq
 201306432     gbcon178.seq
 247163153     gbcon179.seq
 245381075     gbcon18.seq
 245901200     gbcon180.seq
 242440250     gbcon181.seq
 242097075     gbcon182.seq
 246030324     gbcon183.seq
 246225553     gbcon184.seq
 247226776     gbcon185.seq
 249446872     gbcon186.seq
 248758924     gbcon187.seq
 100030025     gbcon188.seq
 247228567     gbcon189.seq
 243549982     gbcon19.seq
 248527762     gbcon190.seq
 246295705     gbcon191.seq
 247385250     gbcon192.seq
 247928395     gbcon193.seq
 248309727     gbcon194.seq
  29448158     gbcon195.seq
 247271812     gbcon196.seq
 248119274     gbcon197.seq
 245655250     gbcon198.seq
 246621136     gbcon199.seq
 245287832     gbcon2.seq
 244827172     gbcon20.seq
 234657883     gbcon200.seq
 247943693     gbcon201.seq
 248252762     gbcon202.seq
 245908619     gbcon203.seq
 246976702     gbcon204.seq
 246603100     gbcon205.seq
 248480480     gbcon206.seq
 248734692     gbcon207.seq
 204525232     gbcon208.seq
 248536659     gbcon209.seq
 239365109     gbcon21.seq
 248524941     gbcon210.seq
 248533313     gbcon211.seq
 248427170     gbcon212.seq
 204294589     gbcon213.seq
 248343426     gbcon214.seq
 248277404     gbcon215.seq
 248442179     gbcon216.seq
 248463213     gbcon217.seq
 162860809     gbcon218.seq
 248345102     gbcon219.seq
 242190774     gbcon22.seq
 248813880     gbcon220.seq
 247373713     gbcon221.seq
 248004736     gbcon222.seq
 248042893     gbcon223.seq
 245036332     gbcon224.seq
 245832724     gbcon225.seq
 247789447     gbcon226.seq
 247840737     gbcon227.seq
 247689150     gbcon228.seq
 248045474     gbcon229.seq
 246233779     gbcon23.seq
 248285828     gbcon230.seq
 182648370     gbcon231.seq
 248586969     gbcon232.seq
 248835282     gbcon233.seq
 249475883     gbcon234.seq
 248953302     gbcon235.seq
 220618733     gbcon236.seq
 248457927     gbcon237.seq
 247842887     gbcon238.seq
 248877822     gbcon239.seq
  33609348     gbcon24.seq
 248217566     gbcon240.seq
 107071514     gbcon241.seq
 245512173     gbcon242.seq
 249198826     gbcon243.seq
 247117841     gbcon244.seq
 243640460     gbcon245.seq
 247539909     gbcon246.seq
 184097785     gbcon247.seq
 248286359     gbcon248.seq
 245104179     gbcon249.seq
 247215576     gbcon25.seq
 245598118     gbcon250.seq
 247291200     gbcon251.seq
 247784571     gbcon252.seq
 246288334     gbcon253.seq
 242902780     gbcon254.seq
 249329712     gbcon255.seq
  21513584     gbcon256.seq
 248942577     gbcon257.seq
 248255979     gbcon258.seq
 247459719     gbcon259.seq
 248782070     gbcon26.seq
 247555034     gbcon260.seq
 247083481     gbcon261.seq
 125431570     gbcon262.seq
 247449532     gbcon263.seq
 247021804     gbcon264.seq
 247147525     gbcon265.seq
 248782359     gbcon266.seq
 247581416     gbcon267.seq
 249238540     gbcon268.seq
 182648816     gbcon269.seq
 247587942     gbcon27.seq
 248970094     gbcon270.seq
 248566801     gbcon271.seq
 247534137     gbcon272.seq
 247853711     gbcon273.seq
 247001583     gbcon274.seq
 247254870     gbcon275.seq
 246793888     gbcon276.seq
  24386588     gbcon277.seq
 247159716     gbcon278.seq
 248502640     gbcon279.seq
 248929154     gbcon28.seq
 246721503     gbcon280.seq
 246785108     gbcon281.seq
 247991581     gbcon282.seq
 117758078     gbcon283.seq
 247418417     gbcon284.seq
 248396830     gbcon285.seq
 248623476     gbcon286.seq
 247277989     gbcon287.seq
 249297863     gbcon288.seq
 113071379     gbcon289.seq
 248616748     gbcon29.seq
 249136803     gbcon290.seq
 248637550     gbcon291.seq
 248811810     gbcon292.seq
 247564177     gbcon293.seq
 248719175     gbcon294.seq
 116660512     gbcon295.seq
 248727273     gbcon296.seq
 249111152     gbcon297.seq
 247199995     gbcon298.seq
 248855149     gbcon299.seq
 245118016     gbcon3.seq
 248504595     gbcon30.seq
 247898849     gbcon300.seq
 249106083     gbcon301.seq
 138371066     gbcon302.seq
 242917322     gbcon303.seq
 242027214     gbcon304.seq
 241679148     gbcon305.seq
 245093560     gbcon306.seq
 247929376     gbcon307.seq
 249195190     gbcon308.seq
 249283825     gbcon309.seq
  91334887     gbcon31.seq
 247807181     gbcon310.seq
     50264     gbcon311.seq
 247999282     gbcon312.seq
 247104149     gbcon313.seq
 247478858     gbcon314.seq
 246042987     gbcon315.seq
 247009956     gbcon316.seq
 246623405     gbcon317.seq
  71839128     gbcon318.seq
 248769665     gbcon319.seq
 248325310     gbcon32.seq
 248520117     gbcon320.seq
 248968617     gbcon321.seq
 248527315     gbcon322.seq
 247867770     gbcon323.seq
 244821165     gbcon324.seq
 245304773     gbcon325.seq
 247243007     gbcon326.seq
  65155315     gbcon327.seq
 248295427     gbcon328.seq
 248319862     gbcon329.seq
 248272381     gbcon33.seq
 248438668     gbcon330.seq
 245007644     gbcon331.seq
 242367492     gbcon332.seq
  61367942     gbcon333.seq
 242981137     gbcon334.seq
 248744506     gbcon335.seq
 248852949     gbcon336.seq
 248037337     gbcon337.seq
 115753304     gbcon338.seq
 246736351     gbcon339.seq
 245157503     gbcon34.seq
 248544910     gbcon340.seq
 247642560     gbcon341.seq
 243877498     gbcon342.seq
 248558311     gbcon343.seq
 247243006     gbcon344.seq
 247193325     gbcon345.seq
 247122442     gbcon346.seq
 248798960     gbcon347.seq
 106981827     gbcon348.seq
 248604923     gbcon349.seq
 247832082     gbcon35.seq
 248960003     gbcon350.seq
 248587704     gbcon351.seq
 248896451     gbcon352.seq
  42587236     gbcon353.seq
 249015165     gbcon354.seq
 249015968     gbcon355.seq
 246892468     gbcon356.seq
 246104228     gbcon357.seq
 247784820     gbcon358.seq
 247873775     gbcon359.seq
 244274929     gbcon36.seq
 246781683     gbcon360.seq
 246696027     gbcon361.seq
 245566164     gbcon362.seq
  23687922     gbcon363.seq
 244656920     gbcon37.seq
 248018242     gbcon38.seq
  38248009     gbcon39.seq
 244018631     gbcon4.seq
 247325269     gbcon40.seq
 248016257     gbcon41.seq
 129883267     gbcon42.seq
 126402123     gbcon43.seq
 247645058     gbcon44.seq
 244344328     gbcon45.seq
 246299610     gbcon46.seq
 248996679     gbcon47.seq
 125138711     gbcon48.seq
 249004598     gbcon49.seq
 247854767     gbcon5.seq
 249005060     gbcon50.seq
 249001951     gbcon51.seq
 249004984     gbcon52.seq
 243744541     gbcon53.seq
 208038535     gbcon54.seq
 244963332     gbcon55.seq
 245018060     gbcon56.seq
 244932384     gbcon57.seq
 244983449     gbcon58.seq
 244951127     gbcon59.seq
 248873008     gbcon6.seq
 244992927     gbcon60.seq
  72075020     gbcon61.seq
 244968625     gbcon62.seq
 244992955     gbcon63.seq
 244995119     gbcon64.seq
 244966215     gbcon65.seq
 244967157     gbcon66.seq
  52119117     gbcon67.seq
 245114339     gbcon68.seq
 245008606     gbcon69.seq
 200990719     gbcon7.seq
 244971894     gbcon70.seq
 244975476     gbcon71.seq
 245003744     gbcon72.seq
  45534365     gbcon73.seq
 244956120     gbcon74.seq
 244985706     gbcon75.seq
 245065519     gbcon76.seq
 245058789     gbcon77.seq
 245007339     gbcon78.seq
 160295691     gbcon79.seq
 248149247     gbcon8.seq
 245842573     gbcon80.seq
 246436492     gbcon81.seq
 246168337     gbcon82.seq
 246333848     gbcon83.seq
 191796136     gbcon84.seq
 246291627     gbcon85.seq
 246645081     gbcon86.seq
 246223486     gbcon87.seq
 246268624     gbcon88.seq
 246254741     gbcon89.seq
 244886614     gbcon9.seq
   7088771     gbcon90.seq
 246258910     gbcon91.seq
 246546856     gbcon92.seq
 245226657     gbcon93.seq
 245635933     gbcon94.seq
 245556656     gbcon95.seq
 106467293     gbcon96.seq
 245064167     gbcon97.seq
 245238793     gbcon98.seq
 245212034     gbcon99.seq
    958331     gbdel.txt
 247843598     gbenv1.seq
 248257386     gbenv10.seq
 248266446     gbenv11.seq
 248569160     gbenv12.seq
  60377817     gbenv13.seq
 248515092     gbenv14.seq
 248194308     gbenv15.seq
 248532911     gbenv16.seq
 248456090     gbenv17.seq
 248308055     gbenv18.seq
 247780109     gbenv19.seq
 248088553     gbenv2.seq
 247870177     gbenv20.seq
 249165047     gbenv21.seq
   8291807     gbenv22.seq
 249102768     gbenv23.seq
 248319884     gbenv24.seq
 248152176     gbenv25.seq
 248280504     gbenv26.seq
 181156795     gbenv27.seq
 248146353     gbenv28.seq
 248055595     gbenv29.seq
 248062596     gbenv3.seq
 248195348     gbenv30.seq
 248033145     gbenv31.seq
 248009659     gbenv32.seq
 248011747     gbenv33.seq
  78600003     gbenv34.seq
 249124120     gbenv35.seq
 248643553     gbenv36.seq
 248445034     gbenv37.seq
 248527642     gbenv38.seq
 186916051     gbenv39.seq
 247250753     gbenv4.seq
 248366891     gbenv40.seq
 248165241     gbenv41.seq
 248094680     gbenv42.seq
 249090100     gbenv43.seq
 248874622     gbenv44.seq
 249129484     gbenv45.seq
  54501822     gbenv46.seq
 248990845     gbenv47.seq
 247899210     gbenv48.seq
 248370984     gbenv49.seq
 241890602     gbenv5.seq
 248258728     gbenv50.seq
 197923186     gbenv51.seq
 247588958     gbenv52.seq
 249393513     gbenv53.seq
 249409298     gbenv54.seq
 249078666     gbenv55.seq
 248350576     gbenv56.seq
  89199354     gbenv57.seq
 248708668     gbenv58.seq
 248643758     gbenv59.seq
 247934635     gbenv6.seq
 248716469     gbenv60.seq
 248150113     gbenv61.seq
 248376371     gbenv62.seq
 220493017     gbenv63.seq
 248321375     gbenv64.seq
 248557343     gbenv65.seq
 248440120     gbenv66.seq
 247572358     gbenv67.seq
 248464624     gbenv68.seq
  93226360     gbenv69.seq
 248351721     gbenv7.seq
 248683037     gbenv70.seq
 247784755     gbenv71.seq
 247953496     gbenv72.seq
 246990199     gbenv73.seq
 248352982     gbenv74.seq
 153672833     gbenv75.seq
 247624199     gbenv76.seq
 247970824     gbenv77.seq
 248309911     gbenv78.seq
 248163922     gbenv79.seq
 186455664     gbenv8.seq
 248057513     gbenv80.seq
  98718794     gbenv81.seq
 248448224     gbenv82.seq
 248369436     gbenv83.seq
 247957475     gbenv84.seq
 248039940     gbenv85.seq
 196365990     gbenv86.seq
 248006558     gbenv87.seq
 247834938     gbenv88.seq
 247765165     gbenv89.seq
 248095477     gbenv9.seq
 248083193     gbenv90.seq
 101302736     gbenv91.seq
 247515045     gbenv92.seq
 247293045     gbenv93.seq
 247622786     gbenv94.seq
 247855618     gbenv95.seq
 248552685     gbenv96.seq
 247980562     gbenv97.seq
 247540057     gbenv98.seq
  83622446     gbenv99.seq
 524291709     gbest1.seq
 524290277     gbest10.seq
 524289519     gbest100.seq
 524290928     gbest101.seq
 524290452     gbest102.seq
 524291269     gbest103.seq
 324612513     gbest104.seq
 524290182     gbest105.seq
 524290859     gbest106.seq
 524290670     gbest107.seq
 381846367     gbest108.seq
 385036642     gbest109.seq
 524289785     gbest11.seq
 379178955     gbest110.seq
 379762555     gbest111.seq
 376681647     gbest112.seq
 380970518     gbest113.seq
 385571277     gbest114.seq
 383979816     gbest115.seq
 383046098     gbest116.seq
 379514962     gbest117.seq
 402947158     gbest118.seq
 488301143     gbest119.seq
 524289932     gbest12.seq
 524290377     gbest120.seq
 524288866     gbest121.seq
 524292187     gbest122.seq
 524292072     gbest123.seq
 447677219     gbest124.seq
 524289155     gbest125.seq
 524289576     gbest126.seq
 524288947     gbest127.seq
 524289620     gbest128.seq
 524290592     gbest129.seq
 117721487     gbest13.seq
 524292978     gbest130.seq
 524289018     gbest131.seq
 524290972     gbest132.seq
 524289632     gbest133.seq
 524289466     gbest134.seq
 524289156     gbest135.seq
 524291218     gbest136.seq
 263332951     gbest137.seq
 524289559     gbest138.seq
 524289451     gbest139.seq
 524290111     gbest14.seq
 524289614     gbest140.seq
 524289116     gbest141.seq
 524292054     gbest142.seq
 524290915     gbest143.seq
 524289905     gbest144.seq
 524289411     gbest145.seq
 524291394     gbest146.seq
 524290154     gbest147.seq
 524290975     gbest148.seq
 524292274     gbest149.seq
 524290300     gbest15.seq
 524289245     gbest150.seq
 453947600     gbest151.seq
 524290037     gbest152.seq
 524291562     gbest153.seq
 524290377     gbest154.seq
 524290692     gbest155.seq
 524289108     gbest156.seq
 524289583     gbest157.seq
 524290283     gbest158.seq
 524296120     gbest159.seq
 524290173     gbest16.seq
 524289060     gbest160.seq
 524288977     gbest161.seq
 524289816     gbest162.seq
 524290415     gbest163.seq
 211709099     gbest164.seq
 524288882     gbest165.seq
 524290782     gbest166.seq
 524289913     gbest167.seq
 524292094     gbest168.seq
 524291157     gbest169.seq
 524290137     gbest17.seq
 524289164     gbest170.seq
 524290429     gbest171.seq
 524291990     gbest172.seq
 524291735     gbest173.seq
 524288781     gbest174.seq
 524290434     gbest175.seq
 524291990     gbest176.seq
 524289762     gbest177.seq
  65573564     gbest178.seq
 524290703     gbest179.seq
 524290570     gbest18.seq
 524290849     gbest180.seq
 524289166     gbest181.seq
 524289609     gbest182.seq
 524289672     gbest183.seq
 524289921     gbest184.seq
 524291149     gbest185.seq
 524288761     gbest186.seq
 524288894     gbest187.seq
 524290377     gbest188.seq
 524289811     gbest189.seq
 524289029     gbest19.seq
 524290830     gbest190.seq
 431558618     gbest191.seq
 524289597     gbest192.seq
 524291674     gbest193.seq
 524292530     gbest194.seq
 524290675     gbest195.seq
 524295320     gbest196.seq
 524291306     gbest197.seq
 524291545     gbest198.seq
 524289628     gbest199.seq
 524289986     gbest2.seq
 524290173     gbest20.seq
 524291321     gbest200.seq
 524288736     gbest201.seq
 524290668     gbest202.seq
 524289134     gbest203.seq
 524289436     gbest204.seq
  13987262     gbest205.seq
 524289211     gbest206.seq
 524289653     gbest207.seq
 524290915     gbest208.seq
 524289675     gbest209.seq
 524290005     gbest21.seq
 524291229     gbest210.seq
 524290700     gbest211.seq
 524291174     gbest212.seq
 524293104     gbest213.seq
 524290288     gbest214.seq
 524290109     gbest215.seq
 444562633     gbest216.seq
 524290389     gbest217.seq
 524289226     gbest218.seq
 524291079     gbest219.seq
 483861137     gbest22.seq
 524291749     gbest220.seq
 524291565     gbest221.seq
 524297328     gbest222.seq
 524291733     gbest223.seq
 524289798     gbest224.seq
 524290117     gbest225.seq
 524290043     gbest226.seq
 524290638     gbest227.seq
 524291794     gbest228.seq
 431825005     gbest229.seq
 491300859     gbest23.seq
 524292589     gbest230.seq
 524291123     gbest231.seq
 524290595     gbest232.seq
 524292438     gbest233.seq
 524289611     gbest234.seq
 524290671     gbest235.seq
 524289321     gbest236.seq
 524291883     gbest237.seq
 524290758     gbest238.seq
 524291786     gbest239.seq
 501207905     gbest24.seq
 524292616     gbest240.seq
 524291735     gbest241.seq
 524289606     gbest242.seq
 524289873     gbest243.seq
 222121567     gbest244.seq
 524291598     gbest245.seq
 524292355     gbest246.seq
 524288781     gbest247.seq
 524290256     gbest248.seq
 524289126     gbest249.seq
 308061824     gbest25.seq
 524289064     gbest250.seq
 524288922     gbest251.seq
 512209571     gbest252.seq
 524289480     gbest253.seq
 524292053     gbest254.seq
 524290288     gbest255.seq
 313661545     gbest256.seq
 524291287     gbest257.seq
 524289692     gbest258.seq
 524291387     gbest259.seq
 524289024     gbest26.seq
 524289246     gbest260.seq
 524289802     gbest261.seq
 524289993     gbest262.seq
 524289003     gbest263.seq
 524290793     gbest264.seq
 524289348     gbest265.seq
 524288976     gbest266.seq
 190455687     gbest267.seq
 524288976     gbest268.seq
 524289033     gbest269.seq
 524291216     gbest27.seq
 524289244     gbest270.seq
 524292399     gbest271.seq
 524290312     gbest272.seq
 524291309     gbest273.seq
 524288852     gbest274.seq
 524292357     gbest275.seq
 524291321     gbest276.seq
 524289879     gbest277.seq
 524289056     gbest278.seq
 342232612     gbest279.seq
 524292866     gbest28.seq
 524291403     gbest280.seq
 524289813     gbest281.seq
 524291282     gbest282.seq
 524290305     gbest283.seq
 524289704     gbest284.seq
 524288897     gbest285.seq
 524289270     gbest286.seq
 524291181     gbest287.seq
 524291449     gbest288.seq
 524290270     gbest289.seq
 524291040     gbest29.seq
 524289630     gbest290.seq
 260063130     gbest291.seq
 524293457     gbest292.seq
 524289414     gbest293.seq
 524291483     gbest294.seq
 524291162     gbest295.seq
 524290396     gbest296.seq
 524289050     gbest297.seq
 524290677     gbest298.seq
 524288831     gbest299.seq
 488711690     gbest3.seq
 524289390     gbest30.seq
 524290784     gbest300.seq
 524290007     gbest301.seq
 466911719     gbest302.seq
 299077842     gbest303.seq
 472922408     gbest304.seq
 470052480     gbest305.seq
 524290478     gbest306.seq
 524291137     gbest307.seq
 524291082     gbest308.seq
 524292570     gbest309.seq
 524290909     gbest31.seq
 524291840     gbest310.seq
 524292640     gbest311.seq
 524289587     gbest312.seq
 524291852     gbest313.seq
 524290509     gbest314.seq
 524289187     gbest315.seq
 354553010     gbest316.seq
 524290269     gbest317.seq
 524291097     gbest318.seq
 524290175     gbest319.seq
 524290819     gbest32.seq
 524291407     gbest320.seq
 524289695     gbest321.seq
 524288786     gbest322.seq
 524290408     gbest323.seq
 524291940     gbest324.seq
 524288759     gbest325.seq
 524291619     gbest326.seq
 524291109     gbest327.seq
 513990601     gbest328.seq
 514468410     gbest329.seq
 524290259     gbest33.seq
 202509203     gbest330.seq
 524288748     gbest331.seq
 524290597     gbest332.seq
 524292392     gbest333.seq
 524290362     gbest334.seq
 524288977     gbest335.seq
 524291376     gbest336.seq
 493814119     gbest337.seq
 524289153     gbest338.seq
 524289806     gbest339.seq
 503510490     gbest34.seq
 524292447     gbest340.seq
 524290198     gbest341.seq
 524288758     gbest342.seq
 524292529     gbest343.seq
 307333249     gbest344.seq
 524288954     gbest345.seq
 524290020     gbest346.seq
 524289554     gbest347.seq
 524291066     gbest348.seq
 524288736     gbest349.seq
 485111820     gbest35.seq
 524289946     gbest350.seq
 509073558     gbest351.seq
 524289781     gbest352.seq
 524290400     gbest353.seq
 524290129     gbest354.seq
 524289022     gbest355.seq
 524288885     gbest356.seq
 524289305     gbest357.seq
 524288938     gbest358.seq
 115336652     gbest359.seq
 486899315     gbest36.seq
 524289289     gbest360.seq
 524289795     gbest361.seq
 524289403     gbest362.seq
 524290615     gbest363.seq
 524290209     gbest364.seq
 524290322     gbest365.seq
 524290222     gbest366.seq
 524288748     gbest367.seq
 524288809     gbest368.seq
 524290777     gbest369.seq
 485900427     gbest37.seq
 524290634     gbest370.seq
  35401171     gbest371.seq
 524289164     gbest372.seq
 524289451     gbest373.seq
 524291816     gbest374.seq
 524289829     gbest375.seq
 524289880     gbest376.seq
 524290797     gbest377.seq
 484764145     gbest378.seq
 524292637     gbest379.seq
 480383842     gbest38.seq
 524290336     gbest380.seq
 524291534     gbest381.seq
 524289606     gbest382.seq
 243257693     gbest383.seq
 524289638     gbest384.seq
 524289705     gbest385.seq
 524289597     gbest386.seq
 524290882     gbest387.seq
 524289362     gbest388.seq
 524290204     gbest389.seq
 485066885     gbest39.seq
 524289421     gbest390.seq
 524290903     gbest391.seq
 524290107     gbest392.seq
 524289507     gbest393.seq
 132091690     gbest394.seq
 524289745     gbest395.seq
 524291123     gbest396.seq
 524291025     gbest397.seq
 524291602     gbest398.seq
 524290825     gbest399.seq
 524290877     gbest4.seq
 118055716     gbest40.seq
 524290011     gbest400.seq
 524292344     gbest401.seq
 524289586     gbest402.seq
 524291811     gbest403.seq
 524288753     gbest404.seq
 524290688     gbest405.seq
 524290729     gbest406.seq
 370264901     gbest407.seq
 524289046     gbest408.seq
 524289000     gbest409.seq
 524291523     gbest41.seq
 524291003     gbest410.seq
 524290382     gbest411.seq
 524289195     gbest412.seq
 524290143     gbest413.seq
 524290918     gbest414.seq
 524288820     gbest415.seq
 524291714     gbest416.seq
 524291220     gbest417.seq
 524291114     gbest418.seq
 524289276     gbest419.seq
 522434125     gbest42.seq
 494339269     gbest420.seq
 524289877     gbest421.seq
 524292061     gbest422.seq
 524289480     gbest423.seq
 524292719     gbest424.seq
 524290987     gbest425.seq
 524291020     gbest426.seq
 524290401     gbest427.seq
 524291432     gbest428.seq
 524289131     gbest429.seq
 524288847     gbest43.seq
 524289146     gbest430.seq
 524291632     gbest431.seq
 524289523     gbest432.seq
 524289022     gbest433.seq
 524290671     gbest434.seq
 161547492     gbest435.seq
 524290237     gbest436.seq
 524290869     gbest437.seq
 524294050     gbest438.seq
 524290837     gbest439.seq
 524290099     gbest44.seq
 524289174     gbest440.seq
 524289289     gbest441.seq
 524290855     gbest442.seq
 524289317     gbest443.seq
 524291336     gbest444.seq
 524290047     gbest445.seq
 524292068     gbest446.seq
 524291348     gbest447.seq
  65050477     gbest448.seq
 524290921     gbest449.seq
 524290632     gbest45.seq
 524289947     gbest450.seq
 524289796     gbest451.seq
 524291018     gbest452.seq
 524288910     gbest453.seq
 524290468     gbest454.seq
 524289655     gbest455.seq
 524290437     gbest456.seq
 524289718     gbest457.seq
 524290644     gbest458.seq
 524291324     gbest459.seq
 524290092     gbest46.seq
  28039718     gbest460.seq
 524291314     gbest461.seq
 524288756     gbest462.seq
 524290650     gbest463.seq
 524289038     gbest464.seq
 524291298     gbest465.seq
 524289406     gbest466.seq
 524289399     gbest467.seq
 524288824     gbest468.seq
 524290308     gbest469.seq
 524290075     gbest47.seq
 524289436     gbest470.seq
 524289238     gbest471.seq
 363812108     gbest472.seq
 524291076     gbest473.seq
 524291579     gbest474.seq
 524291091     gbest475.seq
 524291201     gbest476.seq
 524289403     gbest477.seq
 524289290     gbest478.seq
 524291104     gbest479.seq
 524289327     gbest48.seq
 524290797     gbest480.seq
 524290535     gbest481.seq
  94774256     gbest482.seq
 524291828     gbest49.seq
 524290096     gbest5.seq
 524290760     gbest50.seq
 524291736     gbest51.seq
 524290186     gbest52.seq
 524290480     gbest53.seq
 210327507     gbest54.seq
 524289021     gbest55.seq
 524290246     gbest56.seq
 524291094     gbest57.seq
 524289936     gbest58.seq
 524291483     gbest59.seq
 524288934     gbest6.seq
 524290882     gbest60.seq
 524291197     gbest61.seq
 524290083     gbest62.seq
 524291699     gbest63.seq
 524290133     gbest64.seq
 524291045     gbest65.seq
 524291704     gbest66.seq
 418585559     gbest67.seq
 524293248     gbest68.seq
 524289575     gbest69.seq
 524289105     gbest7.seq
 524288900     gbest70.seq
 524289986     gbest71.seq
 524290260     gbest72.seq
 524288880     gbest73.seq
 524291436     gbest74.seq
 524288778     gbest75.seq
 524291148     gbest76.seq
 524292323     gbest77.seq
 524290920     gbest78.seq
 524289474     gbest79.seq
 524289238     gbest8.seq
 138626590     gbest80.seq
 524288901     gbest81.seq
 524291003     gbest82.seq
 524289021     gbest83.seq
 524289482     gbest84.seq
 524290754     gbest85.seq
 524290225     gbest86.seq
 524288748     gbest87.seq
 524291653     gbest88.seq
 524290412     gbest89.seq
 524289764     gbest9.seq
 524291552     gbest90.seq
 524289077     gbest91.seq
 420565761     gbest92.seq
 524291360     gbest93.seq
 524291021     gbest94.seq
 524291175     gbest95.seq
 524290051     gbest96.seq
 524291444     gbest97.seq
 524290568     gbest98.seq
 524289612     gbest99.seq
 524289548     gbgss1.seq
 524289774     gbgss10.seq
 524290287     gbgss100.seq
 524290771     gbgss101.seq
 524291791     gbgss102.seq
 524290101     gbgss103.seq
 385465867     gbgss104.seq
 524291879     gbgss105.seq
 524289376     gbgss106.seq
 524289871     gbgss107.seq
 524290242     gbgss108.seq
 524288816     gbgss109.seq
 524290990     gbgss11.seq
 524289936     gbgss110.seq
 524290516     gbgss111.seq
 524288853     gbgss112.seq
 524291249     gbgss113.seq
 524290527     gbgss114.seq
 524290774     gbgss115.seq
  20661469     gbgss116.seq
 524290572     gbgss117.seq
 524288891     gbgss118.seq
 524289027     gbgss119.seq
 524290376     gbgss12.seq
 524290356     gbgss120.seq
 524291116     gbgss121.seq
 524289117     gbgss122.seq
 524289120     gbgss123.seq
 524290796     gbgss124.seq
 524290276     gbgss125.seq
 524288958     gbgss126.seq
 524291912     gbgss127.seq
 524289421     gbgss128.seq
 168442206     gbgss129.seq
 524289800     gbgss13.seq
 524290211     gbgss130.seq
 524291326     gbgss131.seq
 524291290     gbgss132.seq
 524291077     gbgss133.seq
 524289322     gbgss134.seq
 524290361     gbgss135.seq
 524290299     gbgss136.seq
 524289985     gbgss137.seq
 524289349     gbgss138.seq
 496327803     gbgss139.seq
 524291246     gbgss14.seq
 494766060     gbgss140.seq
 160416303     gbgss141.seq
 524289637     gbgss142.seq
 524289281     gbgss143.seq
 524291150     gbgss144.seq
 524290512     gbgss145.seq
 524290954     gbgss146.seq
 524289338     gbgss147.seq
 524291525     gbgss148.seq
 524291086     gbgss149.seq
 524290940     gbgss15.seq
 524288822     gbgss150.seq
 524291381     gbgss151.seq
 294115814     gbgss152.seq
 524291696     gbgss153.seq
 524291252     gbgss154.seq
 524291031     gbgss155.seq
 524292508     gbgss156.seq
 524291112     gbgss157.seq
 524289720     gbgss158.seq
 524288730     gbgss159.seq
 524290142     gbgss16.seq
 524290230     gbgss160.seq
 524290309     gbgss161.seq
 524288911     gbgss162.seq
 524288879     gbgss163.seq
 524289053     gbgss164.seq
 100771541     gbgss165.seq
 524290236     gbgss166.seq
 524290617     gbgss167.seq
 524290402     gbgss168.seq
 524290835     gbgss169.seq
 524289331     gbgss17.seq
 524289872     gbgss170.seq
 524289461     gbgss171.seq
 524289261     gbgss172.seq
 524290360     gbgss173.seq
 290939262     gbgss174.seq
 248883249     gbgss175.seq
 248912021     gbgss176.seq
 248658744     gbgss177.seq
 249100815     gbgss178.seq
  31461371     gbgss179.seq
 524291157     gbgss18.seq
 249107064     gbgss180.seq
 249096537     gbgss181.seq
 249095770     gbgss182.seq
 249055895     gbgss183.seq
 223175840     gbgss184.seq
 248935605     gbgss185.seq
 248867864     gbgss186.seq
 248938271     gbgss187.seq
 248799219     gbgss188.seq
 193065001     gbgss189.seq
 272143299     gbgss19.seq
 249063412     gbgss190.seq
 249156170     gbgss191.seq
 249179792     gbgss192.seq
 249191704     gbgss193.seq
 248762289     gbgss194.seq
  70806387     gbgss195.seq
 248436329     gbgss196.seq
   2100461     gbgss197.seq
  80022020     gbgss198.seq
 248581172     gbgss199.seq
 524289207     gbgss2.seq
 524290531     gbgss20.seq
 248900832     gbgss200.seq
  87008754     gbgss201.seq
 248654420     gbgss202.seq
 248666314     gbgss203.seq
 248642086     gbgss204.seq
 201078896     gbgss205.seq
 248918906     gbgss206.seq
 248757070     gbgss207.seq
 248603829     gbgss208.seq
 244913372     gbgss209.seq
 524289309     gbgss21.seq
 248618523     gbgss210.seq
 248644924     gbgss211.seq
 248938283     gbgss212.seq
 243274459     gbgss213.seq
 248461184     gbgss214.seq
 248513057     gbgss215.seq
 249046926     gbgss216.seq
 249029360     gbgss217.seq
 126057159     gbgss218.seq
 248881809     gbgss219.seq
 524289880     gbgss22.seq
 248688250     gbgss220.seq
 248758898     gbgss221.seq
 248655791     gbgss222.seq
  91650785     gbgss223.seq
 248402364     gbgss224.seq
 248367912     gbgss225.seq
 248479482     gbgss226.seq
 248479689     gbgss227.seq
 248585932     gbgss228.seq
 145393060     gbgss229.seq
 524292413     gbgss23.seq
 248641288     gbgss230.seq
 248649538     gbgss231.seq
 248629475     gbgss232.seq
 248665759     gbgss233.seq
  84639050     gbgss234.seq
 248547784     gbgss235.seq
 248674373     gbgss236.seq
 248666634     gbgss237.seq
 248670827     gbgss238.seq
 248937162     gbgss239.seq
 524291052     gbgss24.seq
 248868569     gbgss240.seq
 107127255     gbgss241.seq
 248844719     gbgss242.seq
 248836578     gbgss243.seq
 248830164     gbgss244.seq
  55933471     gbgss245.seq
  53076689     gbgss246.seq
 248680104     gbgss247.seq
 248659613     gbgss248.seq
 248672021     gbgss249.seq
 524291864     gbgss25.seq
 248525049     gbgss250.seq
 248704922     gbgss251.seq
 248715043     gbgss252.seq
 219887517     gbgss253.seq
 248724550     gbgss254.seq
 248742121     gbgss255.seq
 248757350     gbgss256.seq
 248746842     gbgss257.seq
  26340705     gbgss258.seq
 248764805     gbgss259.seq
 524291414     gbgss26.seq
 248729658     gbgss260.seq
 248668496     gbgss261.seq
 248951636     gbgss262.seq
 248815702     gbgss263.seq
 248836293     gbgss264.seq
 189186111     gbgss265.seq
 248389699     gbgss266.seq
 248474244     gbgss267.seq
 248498578     gbgss268.seq
 226335896     gbgss269.seq
 524289097     gbgss27.seq
 248466150     gbgss270.seq
 248612321     gbgss271.seq
 248819733     gbgss272.seq
 248978294     gbgss273.seq
 249094812     gbgss274.seq
 249148339     gbgss275.seq
 151268526     gbgss276.seq
 249147512     gbgss277.seq
 249131291     gbgss278.seq
 248821087     gbgss279.seq
 524292348     gbgss28.seq
 248842990     gbgss280.seq
 231268569     gbgss281.seq
 248815183     gbgss282.seq
 249155815     gbgss283.seq
 249156659     gbgss284.seq
 248868547     gbgss285.seq
 248825245     gbgss286.seq
 121352082     gbgss287.seq
 248672544     gbgss288.seq
 248689514     gbgss289.seq
 524289733     gbgss29.seq
 248685000     gbgss290.seq
 248673033     gbgss291.seq
 220808522     gbgss292.seq
 248548505     gbgss293.seq
 248539863     gbgss294.seq
 248468200     gbgss295.seq
 248500185     gbgss296.seq
  91068247     gbgss297.seq
 248440009     gbgss298.seq
 248496447     gbgss299.seq
 524289224     gbgss3.seq
 524289327     gbgss30.seq
 248501722     gbgss300.seq
 248697173     gbgss301.seq
 248840513     gbgss302.seq
 248899493     gbgss303.seq
 141428035     gbgss304.seq
  33624586     gbgss31.seq
 524290309     gbgss32.seq
 524288796     gbgss33.seq
 524290539     gbgss34.seq
 524289510     gbgss35.seq
 524290347     gbgss36.seq
 524290016     gbgss37.seq
 524290991     gbgss38.seq
 489386711     gbgss39.seq
 524289495     gbgss4.seq
 524292936     gbgss40.seq
 524289658     gbgss41.seq
 524289053     gbgss42.seq
  19128095     gbgss43.seq
 524291495     gbgss44.seq
 524290248     gbgss45.seq
 524291200     gbgss46.seq
 524288917     gbgss47.seq
 216278345     gbgss48.seq
 524291261     gbgss49.seq
 151331340     gbgss5.seq
 524289547     gbgss50.seq
 524290300     gbgss51.seq
 524288815     gbgss52.seq
 524289068     gbgss53.seq
 524288850     gbgss54.seq
 524288866     gbgss55.seq
 524291148     gbgss56.seq
 524290258     gbgss57.seq
 524289895     gbgss58.seq
 524289928     gbgss59.seq
 524291287     gbgss6.seq
  20723333     gbgss60.seq
 524291673     gbgss61.seq
 524289183     gbgss62.seq
 524291682     gbgss63.seq
 452337880     gbgss64.seq
 524290375     gbgss65.seq
 524291631     gbgss66.seq
 524289288     gbgss67.seq
 524291486     gbgss68.seq
 524291682     gbgss69.seq
 524288950     gbgss7.seq
 524290801     gbgss70.seq
 524292410     gbgss71.seq
 524290333     gbgss72.seq
 524290102     gbgss73.seq
 524289694     gbgss74.seq
 524288946     gbgss75.seq
 524290183     gbgss76.seq
  22139765     gbgss77.seq
 524290829     gbgss78.seq
 524289664     gbgss79.seq
 524288897     gbgss8.seq
 524290202     gbgss80.seq
 524290360     gbgss81.seq
 524290336     gbgss82.seq
 524289561     gbgss83.seq
 524292354     gbgss84.seq
 524291709     gbgss85.seq
 524288835     gbgss86.seq
 524290531     gbgss87.seq
 524290735     gbgss88.seq
 359893210     gbgss89.seq
 524291546     gbgss9.seq
 524290017     gbgss90.seq
 524292275     gbgss91.seq
 524291767     gbgss92.seq
 524289082     gbgss93.seq
 524288734     gbgss94.seq
 524291679     gbgss95.seq
 524289031     gbgss96.seq
 524291692     gbgss97.seq
 524291792     gbgss98.seq
 524291482     gbgss99.seq
 249241620     gbhtc1.seq
 248251780     gbhtc10.seq
 248598610     gbhtc11.seq
 144784741     gbhtc12.seq
 249117751     gbhtc13.seq
 248566565     gbhtc14.seq
 152960387     gbhtc15.seq
 249519676     gbhtc2.seq
 249520696     gbhtc3.seq
 249533552     gbhtc4.seq
 249445918     gbhtc5.seq
 249375990     gbhtc6.seq
 249116160     gbhtc7.seq
  84998539     gbhtc8.seq
 248989225     gbhtc9.seq
 249919153     gbhtg1.seq
 249935836     gbhtg10.seq
 249898576     gbhtg100.seq
 249852524     gbhtg101.seq
 249535042     gbhtg102.seq
 249889459     gbhtg103.seq
   3688160     gbhtg104.seq
 249800075     gbhtg105.seq
 249873423     gbhtg106.seq
 249831755     gbhtg107.seq
 249889564     gbhtg108.seq
 249966252     gbhtg109.seq
    799293     gbhtg11.seq
 249770747     gbhtg110.seq
 167846999     gbhtg111.seq
 249851942     gbhtg112.seq
 249939795     gbhtg113.seq
 249870722     gbhtg114.seq
 249909675     gbhtg115.seq
 249769671     gbhtg116.seq
 249967908     gbhtg117.seq
 249944117     gbhtg118.seq
 219057303     gbhtg119.seq
 249868150     gbhtg12.seq
 249829964     gbhtg120.seq
 249879699     gbhtg121.seq
 249966184     gbhtg122.seq
 249884839     gbhtg123.seq
 249896355     gbhtg124.seq
 249950772     gbhtg125.seq
 249847034     gbhtg126.seq
 249920794     gbhtg127.seq
 249935738     gbhtg128.seq
 249906927     gbhtg129.seq
 249954412     gbhtg13.seq
 249736324     gbhtg130.seq
    526879     gbhtg131.seq
 249657899     gbhtg132.seq
 248470536     gbhtg133.seq
 246160992     gbhtg134.seq
 249667321     gbhtg135.seq
 249935302     gbhtg136.seq
 141385226     gbhtg137.seq
 249654318     gbhtg138.seq
 249823531     gbhtg139.seq
 249572144     gbhtg14.seq
 249804865     gbhtg140.seq
 249896134     gbhtg141.seq
 249813210     gbhtg142.seq
 134507510     gbhtg143.seq
 249941270     gbhtg144.seq
 249798909     gbhtg145.seq
 249818887     gbhtg146.seq
 249889499     gbhtg147.seq
 249937870     gbhtg148.seq
 249924666     gbhtg149.seq
 249759969     gbhtg15.seq
 249833422     gbhtg150.seq
 249902220     gbhtg151.seq
 249955631     gbhtg152.seq
 249138703     gbhtg153.seq
 241177239     gbhtg154.seq
 249725738     gbhtg16.seq
 249153261     gbhtg17.seq
 249967707     gbhtg18.seq
 249644077     gbhtg19.seq
 249965224     gbhtg2.seq
 249968559     gbhtg20.seq
 237128242     gbhtg21.seq
 249744362     gbhtg22.seq
 249850450     gbhtg23.seq
 249969276     gbhtg24.seq
 249905147     gbhtg25.seq
 249744537     gbhtg26.seq
 249873073     gbhtg27.seq
 249943900     gbhtg28.seq
 249822796     gbhtg29.seq
 249964185     gbhtg3.seq
 249975125     gbhtg30.seq
 225308603     gbhtg31.seq
 249809694     gbhtg32.seq
 249901546     gbhtg33.seq
 249911478     gbhtg34.seq
 249900907     gbhtg35.seq
 249840804     gbhtg36.seq
 249797332     gbhtg37.seq
 249749931     gbhtg38.seq
 249608861     gbhtg39.seq
 249939536     gbhtg4.seq
 249820205     gbhtg40.seq
 224341810     gbhtg41.seq
 249856186     gbhtg42.seq
 249766073     gbhtg43.seq
 249956077     gbhtg44.seq
 249761282     gbhtg45.seq
 249952973     gbhtg46.seq
 249693087     gbhtg47.seq
 249849728     gbhtg48.seq
 249877767     gbhtg49.seq
 249892890     gbhtg5.seq
 249886034     gbhtg50.seq
 234806350     gbhtg51.seq
 249721503     gbhtg52.seq
 249957951     gbhtg53.seq
 249770763     gbhtg54.seq
 249706591     gbhtg55.seq
 249946653     gbhtg56.seq
  18794743     gbhtg57.seq
 249847082     gbhtg58.seq
 249814632     gbhtg59.seq
 249976728     gbhtg6.seq
 249983755     gbhtg60.seq
 249909487     gbhtg61.seq
 225117385     gbhtg62.seq
 249870223     gbhtg63.seq
 249893600     gbhtg64.seq
 249785570     gbhtg65.seq
 249748161     gbhtg66.seq
 249813247     gbhtg67.seq
  16218631     gbhtg68.seq
 249969751     gbhtg69.seq
 249792485     gbhtg7.seq
 249868129     gbhtg70.seq
 249949360     gbhtg71.seq
 249753364     gbhtg72.seq
 223400888     gbhtg73.seq
 249933093     gbhtg74.seq
 249872582     gbhtg75.seq
 249837217     gbhtg76.seq
 249937956     gbhtg77.seq
 235159885     gbhtg78.seq
 249866049     gbhtg79.seq
 249809049     gbhtg8.seq
 249964523     gbhtg80.seq
 249852745     gbhtg81.seq
 249879093     gbhtg82.seq
 202287872     gbhtg83.seq
 249856467     gbhtg84.seq
 249933696     gbhtg85.seq
 249853639     gbhtg86.seq
 249872937     gbhtg87.seq
 206007602     gbhtg88.seq
 249876374     gbhtg89.seq
 249937148     gbhtg9.seq
 249862442     gbhtg90.seq
 249766212     gbhtg91.seq
 249878098     gbhtg92.seq
 194400971     gbhtg93.seq
 249961002     gbhtg94.seq
 249970885     gbhtg95.seq
 249861638     gbhtg96.seq
 249785608     gbhtg97.seq
 161649781     gbhtg98.seq
 249859736     gbhtg99.seq
 247384352     gbinv1.seq
 246426334     gbinv10.seq
 249066703     gbinv100.seq
 249455566     gbinv101.seq
 249466633     gbinv102.seq
 249333532     gbinv103.seq
  79829301     gbinv104.seq
 249377473     gbinv105.seq
 249875763     gbinv106.seq
 249788266     gbinv107.seq
 249902000     gbinv108.seq
 249740854     gbinv109.seq
 247942729     gbinv11.seq
 249502584     gbinv110.seq
 249795782     gbinv111.seq
  88799608     gbinv112.seq
 249738245     gbinv113.seq
 249605315     gbinv114.seq
 249910922     gbinv115.seq
 249633619     gbinv116.seq
 249790574     gbinv117.seq
 249345024     gbinv118.seq
 249604179     gbinv119.seq
 249093910     gbinv12.seq
 249724781     gbinv120.seq
 249303223     gbinv121.seq
 151008199     gbinv122.seq
 248652115     gbinv123.seq
 249493176     gbinv124.seq
 249674112     gbinv125.seq
 249476315     gbinv126.seq
 249915749     gbinv127.seq
 249586639     gbinv128.seq
 243045836     gbinv129.seq
 246659370     gbinv13.seq
  52917687     gbinv130.seq
 249870848     gbinv131.seq
 249219731     gbinv132.seq
 249909822     gbinv133.seq
 249447822     gbinv134.seq
  28299519     gbinv135.seq
 249442749     gbinv136.seq
 249123508     gbinv137.seq
  59646188     gbinv138.seq
 248533283     gbinv139.seq
 182597805     gbinv14.seq
 248684169     gbinv140.seq
 249825507     gbinv141.seq
 249739033     gbinv142.seq
 147926547     gbinv143.seq
 249585935     gbinv144.seq
 249458505     gbinv145.seq
 249275721     gbinv146.seq
 249007364     gbinv147.seq
 248635921     gbinv148.seq
 248236320     gbinv149.seq
 246530465     gbinv15.seq
 248648783     gbinv150.seq
 247895161     gbinv151.seq
 248061120     gbinv152.seq
 248281680     gbinv153.seq
  34680983     gbinv154.seq
 246537024     gbinv16.seq
 246362359     gbinv17.seq
 163972851     gbinv18.seq
 247320073     gbinv19.seq
 247077893     gbinv2.seq
 246958228     gbinv20.seq
 247257392     gbinv21.seq
 245900851     gbinv22.seq
 246319975     gbinv23.seq
   1719615     gbinv24.seq
 228607619     gbinv25.seq
 175319053     gbinv26.seq
 247354835     gbinv27.seq
 246135294     gbinv28.seq
 224685880     gbinv29.seq
 249725503     gbinv3.seq
 246207729     gbinv30.seq
 246313093     gbinv31.seq
 246099434     gbinv32.seq
 246110600     gbinv33.seq
 180450934     gbinv34.seq
 246726069     gbinv35.seq
 246125208     gbinv36.seq
 246434325     gbinv37.seq
 246287165     gbinv38.seq
 186481547     gbinv39.seq
 204828903     gbinv4.seq
 246273666     gbinv40.seq
 246225075     gbinv41.seq
 246324503     gbinv42.seq
 246365226     gbinv43.seq
 124197741     gbinv44.seq
 245774451     gbinv45.seq
 245799529     gbinv46.seq
 245615987     gbinv47.seq
 246124130     gbinv48.seq
 102718501     gbinv49.seq
 248134144     gbinv5.seq
 246278227     gbinv50.seq
 245791182     gbinv51.seq
 245713224     gbinv52.seq
 245596455     gbinv53.seq
 111012604     gbinv54.seq
 245775373     gbinv55.seq
 245830328     gbinv56.seq
 245869392     gbinv57.seq
 245832610     gbinv58.seq
 245926837     gbinv59.seq
 247046113     gbinv6.seq
 245849887     gbinv60.seq
 200158412     gbinv61.seq
 246521363     gbinv62.seq
 246610770     gbinv63.seq
 246182370     gbinv64.seq
 246228090     gbinv65.seq
 246448462     gbinv66.seq
 246568386     gbinv67.seq
 247153184     gbinv68.seq
 201702502     gbinv69.seq
 247986256     gbinv7.seq
 248859084     gbinv70.seq
 248594183     gbinv71.seq
 248375587     gbinv72.seq
 200162106     gbinv73.seq
 249433116     gbinv74.seq
 249541367     gbinv75.seq
 247414776     gbinv76.seq
 249735371     gbinv77.seq
 249834859     gbinv78.seq
 249622160     gbinv79.seq
 232036326     gbinv8.seq
 249682025     gbinv80.seq
 220938359     gbinv81.seq
 249873697     gbinv82.seq
 249774169     gbinv83.seq
 249565387     gbinv84.seq
 249079309     gbinv85.seq
  51444196     gbinv86.seq
 249293006     gbinv87.seq
 249904433     gbinv88.seq
 249840048     gbinv89.seq
 246815755     gbinv9.seq
 249582643     gbinv90.seq
 249936667     gbinv91.seq
 249889090     gbinv92.seq
 249821847     gbinv93.seq
 249444246     gbinv94.seq
 249148498     gbinv95.seq
 223890431     gbinv96.seq
 248674114     gbinv97.seq
 249792318     gbinv98.seq
 249585380     gbinv99.seq
 249008835     gbmam1.seq
 338653931     gbmam10.seq
 315434407     gbmam11.seq
 162425847     gbmam12.seq
 150157334     gbmam13.seq
 159032538     gbmam14.seq
 136269230     gbmam15.seq
 122412955     gbmam16.seq
 248159396     gbmam17.seq
 202955071     gbmam18.seq
 208310866     gbmam19.seq
 249519187     gbmam2.seq
 209752346     gbmam20.seq
 197940543     gbmam21.seq
 230561841     gbmam22.seq
 220222444     gbmam23.seq
 123191120     gbmam24.seq
 191446162     gbmam25.seq
   9943649     gbmam26.seq
  43990057     gbmam27.seq
  91323211     gbmam28.seq
  88811754     gbmam29.seq
  85632302     gbmam3.seq
   6365657     gbmam30.seq
  20918368     gbmam31.seq
 247230867     gbmam32.seq
 202306696     gbmam33.seq
 246782628     gbmam34.seq
 246746518     gbmam35.seq
 247083247     gbmam36.seq
 246981386     gbmam37.seq
 249646900     gbmam38.seq
  12299872     gbmam39.seq
  82815753     gbmam4.seq
  71293630     gbmam5.seq
  22570876     gbmam6.seq
   1268710     gbmam7.seq
   2477871     gbmam8.seq
 375834657     gbmam9.seq
  15230972     gbnew.txt
 247017240     gbpat1.seq
 248211281     gbpat10.seq
 247497490     gbpat100.seq
 247502208     gbpat101.seq
 247504293     gbpat102.seq
 247505203     gbpat103.seq
 147255929     gbpat104.seq
 245198790     gbpat105.seq
 247355645     gbpat106.seq
 248369348     gbpat107.seq
 249770979     gbpat108.seq
 248160768     gbpat109.seq
 178363716     gbpat11.seq
 190629335     gbpat110.seq
 246842211     gbpat111.seq
 246498579     gbpat112.seq
 247411332     gbpat113.seq
  79630309     gbpat114.seq
 248112686     gbpat115.seq
 247361334     gbpat116.seq
 247468174     gbpat117.seq
 247782641     gbpat118.seq
 248073239     gbpat119.seq
 247641189     gbpat12.seq
  66592255     gbpat120.seq
 247286955     gbpat121.seq
 247897132     gbpat122.seq
 245014887     gbpat123.seq
 246398856     gbpat124.seq
 158318500     gbpat125.seq
 245491398     gbpat126.seq
 247821183     gbpat127.seq
 232922383     gbpat128.seq
 248194762     gbpat129.seq
 248649175     gbpat13.seq
 249667639     gbpat130.seq
 247971299     gbpat131.seq
 247591442     gbpat132.seq
 249369707     gbpat133.seq
  66704646     gbpat134.seq
 249521285     gbpat135.seq
 247850032     gbpat136.seq
 247498251     gbpat137.seq
 248095431     gbpat138.seq
 248314034     gbpat139.seq
 248664676     gbpat14.seq
  18315777     gbpat140.seq
 247823649     gbpat141.seq
 247412132     gbpat142.seq
 247446077     gbpat143.seq
 247557988     gbpat144.seq
  46542320     gbpat145.seq
 247929134     gbpat146.seq
 247745597     gbpat147.seq
 247404609     gbpat148.seq
 231335480     gbpat149.seq
 248432494     gbpat15.seq
 247157441     gbpat150.seq
 246114552     gbpat151.seq
 246911474     gbpat152.seq
  85307000     gbpat153.seq
 246214518     gbpat154.seq
 247272842     gbpat155.seq
 248429282     gbpat156.seq
  63172334     gbpat157.seq
 246194901     gbpat158.seq
 246131415     gbpat159.seq
 248588010     gbpat16.seq
 247071398     gbpat160.seq
 247606113     gbpat161.seq
 247798541     gbpat162.seq
 246461091     gbpat163.seq
 220992936     gbpat164.seq
 246219941     gbpat165.seq
 246220201     gbpat166.seq
 246220201     gbpat167.seq
 217209465     gbpat168.seq
 246228209     gbpat169.seq
  74949389     gbpat17.seq
 246552731     gbpat170.seq
 246991895     gbpat171.seq
  12279311     gbpat172.seq
 247632194     gbpat173.seq
 248710659     gbpat174.seq
 247548971     gbpat175.seq
 246949719     gbpat176.seq
  91100990     gbpat177.seq
 246707500     gbpat178.seq
 248266605     gbpat179.seq
 248092004     gbpat18.seq
 246953577     gbpat180.seq
 247226822     gbpat181.seq
   9082408     gbpat182.seq
 247336062     gbpat183.seq
 247778657     gbpat184.seq
 247794882     gbpat185.seq
 173562922     gbpat186.seq
 247813296     gbpat187.seq
 248712274     gbpat188.seq
 247749230     gbpat189.seq
 248001238     gbpat19.seq
 247990500     gbpat190.seq
  76132418     gbpat191.seq
 247466193     gbpat192.seq
 247845812     gbpat193.seq
 248026134     gbpat194.seq
 248526488     gbpat195.seq
 247668945     gbpat196.seq
 247222057     gbpat197.seq
  92410186     gbpat198.seq
 248695784     gbpat199.seq
 247469465     gbpat2.seq
 248637574     gbpat20.seq
 248713409     gbpat200.seq
 248826003     gbpat201.seq
 248473382     gbpat202.seq
 213276749     gbpat203.seq
 247894551     gbpat204.seq
 247893502     gbpat205.seq
 249631351     gbpat206.seq
 248405044     gbpat207.seq
 180061265     gbpat208.seq
 249498057     gbpat209.seq
 248136173     gbpat21.seq
 247321213     gbpat210.seq
 247968893     gbpat211.seq
 248922546     gbpat212.seq
 248577497     gbpat213.seq
 248181191     gbpat214.seq
  17960780     gbpat215.seq
 248510414     gbpat216.seq
 248037739     gbpat217.seq
 247892398     gbpat218.seq
 119207545     gbpat219.seq
 184966334     gbpat22.seq
 249185257     gbpat220.seq
 249422385     gbpat221.seq
 249147762     gbpat222.seq
 249471536     gbpat223.seq
 249420591     gbpat224.seq
 249429246     gbpat225.seq
 248879727     gbpat226.seq
 248350666     gbpat227.seq
  71242384     gbpat228.seq
 248448511     gbpat229.seq
 248216298     gbpat23.seq
 248508374     gbpat230.seq
 248738640     gbpat231.seq
 248523798     gbpat232.seq
 224625918     gbpat233.seq
 248789691     gbpat234.seq
 247697293     gbpat235.seq
 246989950     gbpat236.seq
 247602081     gbpat237.seq
  66123036     gbpat238.seq
 247730923     gbpat239.seq
 248072236     gbpat24.seq
 248303812     gbpat240.seq
 248768736     gbpat241.seq
 249465062     gbpat242.seq
 249493452     gbpat243.seq
 243522759     gbpat244.seq
 246448031     gbpat245.seq
 248066249     gbpat246.seq
 247873183     gbpat247.seq
 248006391     gbpat248.seq
  35398740     gbpat249.seq
 247796980     gbpat25.seq
 248014988     gbpat250.seq
 247961946     gbpat251.seq
 246397620     gbpat252.seq
 142737240     gbpat253.seq
 246334670     gbpat254.seq
 246519590     gbpat255.seq
 246376913     gbpat256.seq
  72941553     gbpat257.seq
 246376913     gbpat258.seq
 246449149     gbpat259.seq
 247540507     gbpat26.seq
 247450431     gbpat260.seq
 248368967     gbpat261.seq
 246819152     gbpat262.seq
 213887720     gbpat263.seq
 248559388     gbpat264.seq
 249378355     gbpat265.seq
 249737969     gbpat266.seq
 247658953     gbpat267.seq
 249498554     gbpat268.seq
 249520932     gbpat269.seq
  70625664     gbpat27.seq
  35605530     gbpat270.seq
 249430639     gbpat271.seq
 249430535     gbpat272.seq
 249429860     gbpat273.seq
 249430666     gbpat274.seq
 249094247     gbpat275.seq
 248062494     gbpat276.seq
 248275281     gbpat277.seq
 248162029     gbpat278.seq
 207222972     gbpat279.seq
 248662821     gbpat28.seq
 247923920     gbpat280.seq
 247721387     gbpat281.seq
 246136359     gbpat282.seq
 239102856     gbpat283.seq
 170645582     gbpat284.seq
 246782239     gbpat285.seq
 247874146     gbpat286.seq
 248018194     gbpat287.seq
 248019699     gbpat288.seq
 248021017     gbpat289.seq
 248776499     gbpat29.seq
 248485546     gbpat290.seq
 133350333     gbpat291.seq
 247763468     gbpat3.seq
 248389107     gbpat30.seq
 248642356     gbpat31.seq
 248205460     gbpat32.seq
 179057721     gbpat33.seq
 248349595     gbpat34.seq
 248324620     gbpat35.seq
 248293967     gbpat36.seq
 248677915     gbpat37.seq
 247937817     gbpat38.seq
 247906705     gbpat39.seq
 248000039     gbpat4.seq
 248391919     gbpat40.seq
 103268211     gbpat41.seq
 248659017     gbpat42.seq
 248548252     gbpat43.seq
 248095609     gbpat44.seq
 247985326     gbpat45.seq
 248263495     gbpat46.seq
 248424884     gbpat47.seq
 248695750     gbpat48.seq
 248414255     gbpat49.seq
  70920468     gbpat5.seq
 171226075     gbpat50.seq
 248116708     gbpat51.seq
 247660367     gbpat52.seq
 248370468     gbpat53.seq
 247250775     gbpat54.seq
 221808583     gbpat55.seq
 249612223     gbpat56.seq
 247404121     gbpat57.seq
 246159905     gbpat58.seq
 162822961     gbpat59.seq
 247671075     gbpat6.seq
 247604295     gbpat60.seq
 246399264     gbpat61.seq
 247724390     gbpat62.seq
 248285940     gbpat63.seq
 135056735     gbpat64.seq
 249006752     gbpat65.seq
 248766879     gbpat66.seq
 248695400     gbpat67.seq
 248693781     gbpat68.seq
 248692782     gbpat69.seq
 247627188     gbpat7.seq
 248379397     gbpat70.seq
 143461480     gbpat71.seq
 247537124     gbpat72.seq
 247598759     gbpat73.seq
 247597893     gbpat74.seq
 242999475     gbpat75.seq
 248967471     gbpat76.seq
 244457728     gbpat77.seq
 247876506     gbpat78.seq
 249983646     gbpat79.seq
 248151984     gbpat8.seq
 159269605     gbpat80.seq
 247885995     gbpat81.seq
 247885349     gbpat82.seq
 247885134     gbpat83.seq
 247885350     gbpat84.seq
 248674617     gbpat85.seq
 248708388     gbpat86.seq
  98814486     gbpat87.seq
 247989061     gbpat88.seq
 249781167     gbpat89.seq
 248146466     gbpat9.seq
 247691088     gbpat90.seq
 247494164     gbpat91.seq
 247514108     gbpat92.seq
 247539655     gbpat93.seq
 142906608     gbpat94.seq
 247630120     gbpat95.seq
 247497602     gbpat96.seq
 247498265     gbpat97.seq
 247498779     gbpat98.seq
 194852822     gbpat99.seq
 243214323     gbphg1.seq
 243155601     gbphg2.seq
 243013392     gbphg3.seq
  36919505     gbphg4.seq
 247686666     gbpln1.seq
 157413424     gbpln10.seq
 246742886     gbpln100.seq
 247457158     gbpln101.seq
  62554764     gbpln102.seq
 247383285     gbpln103.seq
 247386390     gbpln104.seq
 247274938     gbpln105.seq
 247208399     gbpln106.seq
 246897594     gbpln107.seq
  26941578     gbpln108.seq
 247122837     gbpln109.seq
 247837141     gbpln11.seq
 247123039     gbpln110.seq
 247752576     gbpln111.seq
 247535224     gbpln112.seq
  92291394     gbpln113.seq
 246859656     gbpln114.seq
 247123117     gbpln115.seq
 247606539     gbpln116.seq
 217857498     gbpln117.seq
 247332807     gbpln118.seq
 247286354     gbpln119.seq
 248739184     gbpln12.seq
 247140419     gbpln120.seq
 167123582     gbpln121.seq
 247241110     gbpln122.seq
 247186513     gbpln123.seq
 247452700     gbpln124.seq
 128465139     gbpln125.seq
 247242051     gbpln126.seq
 247210102     gbpln127.seq
 247245419     gbpln128.seq
 162291529     gbpln129.seq
 248465507     gbpln13.seq
 247484953     gbpln130.seq
 247091851     gbpln131.seq
 247192380     gbpln132.seq
 239190367     gbpln133.seq
 247040665     gbpln134.seq
 247223494     gbpln135.seq
 247410321     gbpln136.seq
 185299684     gbpln137.seq
 242809426     gbpln138.seq
 240376439     gbpln139.seq
 248024124     gbpln14.seq
 230979910     gbpln140.seq
 230146888     gbpln141.seq
 247568230     gbpln142.seq
 210701963     gbpln143.seq
 239938118     gbpln144.seq
 203519754     gbpln145.seq
 209308151     gbpln146.seq
 247388089     gbpln147.seq
 239617849     gbpln148.seq
 230143449     gbpln15.seq
 249415481     gbpln16.seq
 249451261     gbpln17.seq
 249433616     gbpln18.seq
  20472574     gbpln19.seq
 247385725     gbpln2.seq
 241033686     gbpln20.seq
 248622106     gbpln21.seq
 247443179     gbpln22.seq
 248668911     gbpln23.seq
 242962894     gbpln24.seq
 231415728     gbpln25.seq
 232511788     gbpln26.seq
 235239775     gbpln27.seq
 199014935     gbpln28.seq
 195870409     gbpln29.seq
 248310468     gbpln3.seq
 247524028     gbpln30.seq
  97776422     gbpln31.seq
 247646990     gbpln32.seq
 135459328     gbpln33.seq
 203989245     gbpln34.seq
  84436504     gbpln35.seq
 191631679     gbpln36.seq
 224133729     gbpln37.seq
 240516999     gbpln38.seq
 246573372     gbpln39.seq
 249371186     gbpln4.seq
 247093472     gbpln40.seq
 246934695     gbpln41.seq
 246176331     gbpln42.seq
 149898057     gbpln43.seq
 246174910     gbpln44.seq
 246820617     gbpln45.seq
 246630479     gbpln46.seq
 246281348     gbpln47.seq
 248600327     gbpln48.seq
 248901786     gbpln49.seq
 249605961     gbpln5.seq
  59099032     gbpln50.seq
 248360112     gbpln51.seq
 248117798     gbpln52.seq
 225114796     gbpln53.seq
 237545028     gbpln54.seq
 246931399     gbpln55.seq
 245832376     gbpln56.seq
 227422787     gbpln57.seq
 239291086     gbpln58.seq
 221448675     gbpln59.seq
 249844414     gbpln6.seq
 247119429     gbpln60.seq
 247963921     gbpln61.seq
 164620834     gbpln62.seq
  39990531     gbpln63.seq
  74855907     gbpln64.seq
 248260929     gbpln65.seq
 247540232     gbpln66.seq
 247558408     gbpln67.seq
 112706827     gbpln68.seq
 247347598     gbpln69.seq
 249842227     gbpln7.seq
 247425407     gbpln70.seq
 247320583     gbpln71.seq
 247142641     gbpln72.seq
 148766503     gbpln73.seq
 247032500     gbpln74.seq
 247190070     gbpln75.seq
 247855580     gbpln76.seq
 248129853     gbpln77.seq
 245840726     gbpln78.seq
 247805426     gbpln79.seq
 249973147     gbpln8.seq
 247987808     gbpln80.seq
  49325896     gbpln81.seq
 247548106     gbpln82.seq
  49807266     gbpln83.seq
 210377282     gbpln84.seq
 246753856     gbpln85.seq
 185599133     gbpln86.seq
 997331397     gbpln87.seq
  56469894     gbpln88.seq
 215009997     gbpln89.seq
 247958565     gbpln9.seq
 171793646     gbpln90.seq
 197391132     gbpln91.seq
 177950616     gbpln92.seq
 196456251     gbpln93.seq
 189037038     gbpln94.seq
 220764605     gbpln95.seq
 227204478     gbpln96.seq
 224027155     gbpln97.seq
 248372204     gbpln98.seq
 188704535     gbpln99.seq
 147974647     gbpri1.seq
 249839430     gbpri10.seq
 144942993     gbpri11.seq
 249939563     gbpri12.seq
 249866159     gbpri13.seq
 249871553     gbpri14.seq
 249924551     gbpri15.seq
 249848961     gbpri16.seq
 249852803     gbpri17.seq
 249743104     gbpri18.seq
 249906445     gbpri19.seq
 249009794     gbpri2.seq
 249934697     gbpri20.seq
 249933107     gbpri21.seq
 248770291     gbpri22.seq
 249727093     gbpri23.seq
  79516678     gbpri24.seq
 162646542     gbpri25.seq
 248314579     gbpri26.seq
 246417632     gbpri27.seq
 249551254     gbpri28.seq
 249758243     gbpri29.seq
 249713688     gbpri3.seq
 249971322     gbpri30.seq
 249959294     gbpri31.seq
 249852261     gbpri32.seq
 249326442     gbpri33.seq
 249346620     gbpri34.seq
 247529389     gbpri35.seq
  22843767     gbpri36.seq
 248549878     gbpri37.seq
 249085714     gbpri38.seq
 248363844     gbpri39.seq
 249843004     gbpri4.seq
 247315041     gbpri40.seq
 246976147     gbpri41.seq
 200183919     gbpri42.seq
 246990757     gbpri43.seq
 246176543     gbpri44.seq
 246736098     gbpri45.seq
 246361975     gbpri46.seq
 132768409     gbpri47.seq
 247089754     gbpri48.seq
 247415071     gbpri49.seq
 249963646     gbpri5.seq
 246113758     gbpri50.seq
 158896175     gbpri51.seq
 314294173     gbpri52.seq
 258775295     gbpri53.seq
 268666434     gbpri54.seq
 249234359     gbpri55.seq
 189012641     gbpri56.seq
 249914959     gbpri6.seq
 249925070     gbpri7.seq
 249894359     gbpri8.seq
 249747777     gbpri9.seq
    454060     gbrel.txt
 248733731     gbrod1.seq
 249796614     gbrod10.seq
  81897661     gbrod11.seq
 249854715     gbrod12.seq
 249768672     gbrod13.seq
 249976201     gbrod14.seq
 249636398     gbrod15.seq
 249938262     gbrod16.seq
 249869336     gbrod17.seq
 249923998     gbrod18.seq
 249190750     gbrod19.seq
 249949011     gbrod2.seq
 249060252     gbrod20.seq
 249823194     gbrod21.seq
 204866397     gbrod22.seq
 249324077     gbrod23.seq
 248186444     gbrod24.seq
 248909837     gbrod25.seq
 249963041     gbrod26.seq
 247556299     gbrod27.seq
 247515448     gbrod28.seq
 246792875     gbrod29.seq
 249842893     gbrod3.seq
 221125457     gbrod30.seq
 249877341     gbrod4.seq
 249819708     gbrod5.seq
 249979633     gbrod6.seq
 249869235     gbrod7.seq
 249773862     gbrod8.seq
 249962405     gbrod9.seq
 248896459     gbsts1.seq
 249245114     gbsts10.seq
 210330813     gbsts11.seq
 249243512     gbsts12.seq
 249145190     gbsts13.seq
 248693581     gbsts14.seq
 248539330     gbsts15.seq
  25904704     gbsts16.seq
 248561611     gbsts17.seq
 248767757     gbsts18.seq
 248691435     gbsts19.seq
 248903892     gbsts2.seq
 186816066     gbsts20.seq
 249144145     gbsts3.seq
 248985061     gbsts4.seq
  41898342     gbsts5.seq
 249292044     gbsts6.seq
 249293668     gbsts7.seq
 249291084     gbsts8.seq
 249273135     gbsts9.seq
 247371834     gbsyn1.seq
 121738532     gbsyn10.seq
 248393885     gbsyn2.seq
 248375317     gbsyn3.seq
 249912144     gbsyn4.seq
 249884187     gbsyn5.seq
 249912020     gbsyn6.seq
 249438079     gbsyn7.seq
 246496131     gbsyn8.seq
 246500508     gbsyn9.seq
 248284949     gbtsa1.seq
  56100825     gbtsa10.seq
 248821918     gbtsa100.seq
 248925489     gbtsa101.seq
 248855887     gbtsa102.seq
 249071348     gbtsa103.seq
 248780578     gbtsa104.seq
 107169693     gbtsa105.seq
 248960313     gbtsa106.seq
 248876134     gbtsa107.seq
 248812979     gbtsa108.seq
 248907374     gbtsa109.seq
 248118331     gbtsa11.seq
 248678347     gbtsa110.seq
 248603221     gbtsa111.seq
 227617267     gbtsa112.seq
 248469998     gbtsa113.seq
 248309279     gbtsa114.seq
 248867332     gbtsa115.seq
 248667681     gbtsa116.seq
 249187287     gbtsa117.seq
  16440605     gbtsa118.seq
 248504757     gbtsa119.seq
 249112261     gbtsa12.seq
 248692139     gbtsa120.seq
 248617797     gbtsa121.seq
 219584651     gbtsa122.seq
 248507076     gbtsa123.seq
 248900982     gbtsa124.seq
 248841862     gbtsa125.seq
 248621386     gbtsa126.seq
 248676832     gbtsa127.seq
 248926165     gbtsa128.seq
 172435609     gbtsa129.seq
 249088522     gbtsa13.seq
 249149397     gbtsa130.seq
 249113332     gbtsa131.seq
 249153945     gbtsa132.seq
 248990614     gbtsa133.seq
 248769689     gbtsa134.seq
 249113088     gbtsa135.seq
   8218945     gbtsa136.seq
 248910597     gbtsa137.seq
 248951358     gbtsa138.seq
 248864231     gbtsa139.seq
 248710913     gbtsa14.seq
 248951689     gbtsa140.seq
 135674302     gbtsa141.seq
 248771731     gbtsa142.seq
 248753472     gbtsa143.seq
 248812357     gbtsa144.seq
 248922644     gbtsa145.seq
  35710035     gbtsa146.seq
 248540415     gbtsa147.seq
 248864138     gbtsa148.seq
 248258660     gbtsa149.seq
 248706246     gbtsa15.seq
 248974326     gbtsa150.seq
 248774857     gbtsa151.seq
 248746969     gbtsa152.seq
 249125860     gbtsa153.seq
 248658754     gbtsa154.seq
  55717090     gbtsa155.seq
 248834873     gbtsa156.seq
 248829412     gbtsa157.seq
 248894060     gbtsa158.seq
 248920889     gbtsa159.seq
  23104453     gbtsa16.seq
 248412700     gbtsa160.seq
 248542190     gbtsa161.seq
  87978556     gbtsa162.seq
 248551339     gbtsa163.seq
 248669299     gbtsa164.seq
 248872623     gbtsa165.seq
 133206499     gbtsa166.seq
 249274305     gbtsa167.seq
 249340226     gbtsa168.seq
 249367479     gbtsa169.seq
 248934752     gbtsa17.seq
 249407565     gbtsa170.seq
 249446310     gbtsa171.seq
 249471855     gbtsa172.seq
 212034903     gbtsa173.seq
 248893499     gbtsa174.seq
 249133257     gbtsa175.seq
 249077438     gbtsa176.seq
 249431370     gbtsa177.seq
 249458100     gbtsa178.seq
 249498434     gbtsa179.seq
 248888824     gbtsa18.seq
 235072891     gbtsa180.seq
 249553244     gbtsa181.seq
 249557077     gbtsa182.seq
 249445893     gbtsa183.seq
 249428914     gbtsa184.seq
 249422445     gbtsa185.seq
 249414384     gbtsa186.seq
 249412321     gbtsa187.seq
 158431645     gbtsa188.seq
 249411698     gbtsa189.seq
 248775134     gbtsa19.seq
 249412052     gbtsa190.seq
 249407734     gbtsa191.seq
 249406266     gbtsa192.seq
 249406877     gbtsa193.seq
 249407855     gbtsa194.seq
 249392769     gbtsa195.seq
 249024501     gbtsa196.seq
 137011173     gbtsa197.seq
 248743426     gbtsa198.seq
 249337734     gbtsa199.seq
 248411530     gbtsa2.seq
 248964839     gbtsa20.seq
 248741137     gbtsa200.seq
 248801493     gbtsa201.seq
  17136348     gbtsa202.seq
 249216751     gbtsa203.seq
 249332757     gbtsa204.seq
 249426259     gbtsa205.seq
 249053925     gbtsa206.seq
 249118448     gbtsa207.seq
 173732613     gbtsa208.seq
 249117218     gbtsa209.seq
 183717243     gbtsa21.seq
 248905623     gbtsa210.seq
 249269024     gbtsa211.seq
 248782024     gbtsa212.seq
 249267569     gbtsa213.seq
 248801182     gbtsa214.seq
 248930609     gbtsa215.seq
 185462644     gbtsa216.seq
 248781134     gbtsa217.seq
 249385074     gbtsa218.seq
 248671549     gbtsa219.seq
 248864589     gbtsa22.seq
 249069941     gbtsa220.seq
 248804081     gbtsa221.seq
 248677740     gbtsa222.seq
 207868833     gbtsa223.seq
 248932710     gbtsa224.seq
 248965016     gbtsa225.seq
 248713462     gbtsa226.seq
 248999170     gbtsa227.seq
 248629027     gbtsa228.seq
 249053163     gbtsa229.seq
 249114852     gbtsa23.seq
 146248418     gbtsa230.seq
 248782549     gbtsa24.seq
 248595164     gbtsa25.seq
 148746769     gbtsa26.seq
 248797831     gbtsa27.seq
 248315577     gbtsa28.seq
 248095793     gbtsa29.seq
 248462600     gbtsa3.seq
 249256933     gbtsa30.seq
 249331980     gbtsa31.seq
  14556953     gbtsa32.seq
 249145253     gbtsa33.seq
 248693440     gbtsa34.seq
 248467118     gbtsa35.seq
 248513596     gbtsa36.seq
 248567641     gbtsa37.seq
 248541378     gbtsa38.seq
  75464800     gbtsa39.seq
 248304473     gbtsa4.seq
 248619472     gbtsa40.seq
 248701854     gbtsa41.seq
 248702087     gbtsa42.seq
 248879046     gbtsa43.seq
 248596113     gbtsa44.seq
 248409718     gbtsa45.seq
 248651101     gbtsa46.seq
  35395408     gbtsa47.seq
 248675555     gbtsa48.seq
 248915022     gbtsa49.seq
 153310345     gbtsa5.seq
 248510284     gbtsa50.seq
 248406241     gbtsa51.seq
  76804196     gbtsa52.seq
 248546008     gbtsa53.seq
 248582941     gbtsa54.seq
 248492564     gbtsa55.seq
 248859487     gbtsa56.seq
 158735878     gbtsa57.seq
 248731560     gbtsa58.seq
 248634008     gbtsa59.seq
 248435858     gbtsa6.seq
 249148549     gbtsa60.seq
 248780559     gbtsa61.seq
 248897155     gbtsa62.seq
 248836579     gbtsa63.seq
 248839811     gbtsa64.seq
 245139739     gbtsa65.seq
 248687064     gbtsa66.seq
 248937251     gbtsa67.seq
 248992344     gbtsa68.seq
 249035823     gbtsa69.seq
 248776230     gbtsa7.seq
 248810093     gbtsa70.seq
 248589417     gbtsa71.seq
 233414182     gbtsa72.seq
 247943338     gbtsa73.seq
 248809702     gbtsa74.seq
 248564751     gbtsa75.seq
 248675315     gbtsa76.seq
 248545887     gbtsa77.seq
 248967861     gbtsa78.seq
 183333033     gbtsa79.seq
 248537580     gbtsa8.seq
 248776425     gbtsa80.seq
 248715364     gbtsa81.seq
 248900238     gbtsa82.seq
 248901171     gbtsa83.seq
 248530740     gbtsa84.seq
 110996291     gbtsa85.seq
 248752531     gbtsa86.seq
 248668144     gbtsa87.seq
 248445924     gbtsa88.seq
 248637684     gbtsa89.seq
 248462676     gbtsa9.seq
 249087330     gbtsa90.seq
  45737596     gbtsa91.seq
 248581898     gbtsa92.seq
 248723880     gbtsa93.seq
 248686642     gbtsa94.seq
 248799446     gbtsa95.seq
 248972320     gbtsa96.seq
 150540143     gbtsa97.seq
 248920025     gbtsa98.seq
 248917877     gbtsa99.seq
    795117     gbuna1.seq
 245623814     gbvrl1.seq
 246576233     gbvrl10.seq
 246566790     gbvrl11.seq
 245570838     gbvrl12.seq
 245581771     gbvrl13.seq
 245893572     gbvrl14.seq
 124282470     gbvrl15.seq
 245905003     gbvrl16.seq
 246044256     gbvrl17.seq
 245825213     gbvrl18.seq
 245929756     gbvrl19.seq
 245906502     gbvrl2.seq
 225724610     gbvrl20.seq
 246015150     gbvrl21.seq
 245876933     gbvrl22.seq
 246033321     gbvrl23.seq
 245837366     gbvrl24.seq
 142787319     gbvrl25.seq
 245838224     gbvrl26.seq
 245538201     gbvrl27.seq
 246271693     gbvrl28.seq
 245897767     gbvrl29.seq
 245496545     gbvrl3.seq
 245732035     gbvrl30.seq
  76201635     gbvrl31.seq
 246179736     gbvrl32.seq
 246653272     gbvrl33.seq
 246095861     gbvrl34.seq
 246122788     gbvrl35.seq
 246436084     gbvrl36.seq
  41492219     gbvrl37.seq
 246235104     gbvrl38.seq
 245887152     gbvrl39.seq
 245606468     gbvrl4.seq
 246311855     gbvrl40.seq
 246527240     gbvrl41.seq
 232404777     gbvrl42.seq
 246197750     gbvrl43.seq
 246373417     gbvrl44.seq
 246296106     gbvrl45.seq
 245779978     gbvrl46.seq
 246455286     gbvrl47.seq
 246190993     gbvrl48.seq
  19389313     gbvrl49.seq
 245745990     gbvrl5.seq
  86861458     gbvrl6.seq
 246490330     gbvrl7.seq
 246627568     gbvrl8.seq
 246670195     gbvrl9.seq
 247196668     gbvrt1.seq
 249850475     gbvrt10.seq
 249874681     gbvrt11.seq
 137103306     gbvrt12.seq
 249699425     gbvrt13.seq
 249853556     gbvrt14.seq
 249926569     gbvrt15.seq
 248081414     gbvrt16.seq
 246713450     gbvrt17.seq
 246559722     gbvrt18.seq
  61866758     gbvrt19.seq
 249854293     gbvrt2.seq
 246837098     gbvrt20.seq
 248435744     gbvrt21.seq
 246640951     gbvrt22.seq
 246501060     gbvrt23.seq
 246553454     gbvrt24.seq
 108636690     gbvrt25.seq
 247587230     gbvrt26.seq
 246762736     gbvrt27.seq
 246965795     gbvrt28.seq
 196818761     gbvrt29.seq
 248112542     gbvrt3.seq
 247286383     gbvrt30.seq
 246763576     gbvrt31.seq
  30516127     gbvrt32.seq
 246445830     gbvrt33.seq
 190512477     gbvrt34.seq
 246865614     gbvrt35.seq
 246594077     gbvrt36.seq
 246440255     gbvrt37.seq
 120233250     gbvrt38.seq
 248309048     gbvrt39.seq
 248830118     gbvrt4.seq
 247159779     gbvrt40.seq
 125800552     gbvrt41.seq
 246994524     gbvrt42.seq
 247131594     gbvrt43.seq
 245372864     gbvrt44.seq
 230631100     gbvrt45.seq
 242942230     gbvrt46.seq
 247477341     gbvrt47.seq
 235785286     gbvrt48.seq
 236385917     gbvrt49.seq
 230810110     gbvrt5.seq
 246611453     gbvrt50.seq
 249851469     gbvrt51.seq
 199722638     gbvrt52.seq
 247520397     gbvrt53.seq
 179752053     gbvrt54.seq
 246247409     gbvrt55.seq
 227142979     gbvrt56.seq
 249608551     gbvrt57.seq
 234447370     gbvrt58.seq
 249646941     gbvrt59.seq
 247022934     gbvrt6.seq
 249734594     gbvrt60.seq
 249778843     gbvrt61.seq
 249918302     gbvrt62.seq
 248778143     gbvrt63.seq
 148988689     gbvrt64.seq
 248269344     gbvrt7.seq
 248223739     gbvrt8.seq
 249857194     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         63632      86438814
BCT10        12794      81351327
BCT100       39         113384349
BCT101       59         111542017
BCT102       44         107663978
BCT103       42         105130602
BCT104       62         106991504
BCT105       46         108660243
BCT106       30         91914592
BCT107       29         106059433
BCT108       23         100309671
BCT109       22         102815068
BCT11        3719       105004553
BCT110       22         103205495
BCT111       22         103088812
BCT112       22         103089220
BCT113       22         101716543
BCT114       21         101640086
BCT115       23         106816508
BCT116       46         109374731
BCT117       38         105562991
BCT118       6          15890032
BCT119       50         111764861
BCT12        71         117391350
BCT120       60         109369965
BCT121       59         112733607
BCT122       67         111056909
BCT123       44         114099662
BCT124       49         115100685
BCT125       56         113707704
BCT126       25         102521133
BCT127       30         108112665
BCT128       28         66943977
BCT129       44         114207420
BCT13        111        116660784
BCT130       48         116972150
BCT131       59         112456580
BCT132       41         109996351
BCT133       35         112558388
BCT134       24         105876768
BCT135       54         113797732
BCT136       10         26709327
BCT137       28         113584725
BCT138       60         113829391
BCT139       48         109240533
BCT14        73         115196991
BCT140       36         109739722
BCT141       31         120103946
BCT142       47         115043801
BCT143       52         112290738
BCT144       13         14836380
BCT145       78         113214393
BCT146       41         111552967
BCT147       52         114895149
BCT148       69         109578631
BCT149       69         114363423
BCT15        53         115328609
BCT150       57         117705409
BCT151       55         103731733
BCT152       18         40428169
BCT153       62         99560423
BCT154       43         103972342
BCT155       31         107564841
BCT156       43         111146788
BCT157       69         105178122
BCT158       40         106930486
BCT159       63         103214676
BCT16        74         122556134
BCT160       59         109908714
BCT161       3          5977905
BCT162       48         109450542
BCT163       52         109603502
BCT164       49         106107943
BCT165       42         106127600
BCT166       50         109569448
BCT167       31         108773312
BCT168       46         105971387
BCT169       11         45172131
BCT17        41         116033349
BCT170       35         106938488
BCT171       33         108751417
BCT172       39         109930943
BCT173       36         107844857
BCT174       46         108994757
BCT175       47         109730440
BCT176       46         108277996
BCT177       36         108233016
BCT178       24         71230905
BCT179       93         99698834
BCT18        68         116609452
BCT180       28         105910339
BCT181       26         106807776
BCT182       26         106791919
BCT183       30         105001148
BCT184       53         111345508
BCT185       41         108953811
BCT186       55         106874682
BCT187       33         107904771
BCT188       37         109061448
BCT189       33         102631478
BCT19        72         116818951
BCT190       46         108994132
BCT191       57         108439993
BCT192       47         113307875
BCT193       13         10996622
BCT194       99         108381810
BCT195       51         106146784
BCT196       44         108052927
BCT197       56         108771438
BCT198       37         104765115
BCT199       58         110929020
BCT2         32145      99731210
BCT20        67         115443289
BCT200       70         107091033
BCT201       56         113594219
BCT202       57         110829326
BCT203       32         107971097
BCT204       37         106777058
BCT205       78         112673391
BCT206       43         111510362
BCT207       8          9297509
BCT208       68         108609785
BCT209       43         109695697
BCT21        83         138286400
BCT210       42         108803289
BCT211       50         106367913
BCT212       63         105722279
BCT213       87         102463356
BCT214       47         106320436
BCT215       4          21185740
BCT216       46         106960142
BCT217       96         106643559
BCT218       31         105372309
BCT219       26         106805010
BCT22        15917      107820394
BCT220       48         108104213
BCT221       49         106450058
BCT222       37         106025707
BCT223       65         106064437
BCT224       47         109950858
BCT225       24         74426271
BCT226       64         110225618
BCT227       108        104825154
BCT228       60         107327528
BCT229       62         109685788
BCT23        140        137804
BCT230       53         102836312
BCT231       52         106485851
BCT232       74         108457079
BCT233       86         107960836
BCT234       36         104434144
BCT235       40         104611257
BCT236       39         85200679
BCT237       48         104760574
BCT238       78         107379341
BCT239       55         109333701
BCT24        53816      84836330
BCT240       66         108330468
BCT241       45         106996727
BCT242       55         108807555
BCT243       60         112884910
BCT244       69         111543349
BCT245       69         111355258
BCT246       44         109405058
BCT247       44         110238739
BCT248       50         110536713
BCT249       38         77587839
BCT25        86         109498452
BCT250       55         110239805
BCT251       46         107654458
BCT252       59         109333202
BCT253       48         108940727
BCT254       51         105800331
BCT255       62         106566440
BCT256       64         103497655
BCT257       52         107711718
BCT258       114        109583894
BCT259       40         111770334
BCT26        137        95492678
BCT260       61         109003100
BCT261       54         111352352
BCT262       52         109615621
BCT263       3          10777293
BCT264       57         107641125
BCT265       41         105332512
BCT266       56         111459085
BCT267       78         108349218
BCT268       48         107151077
BCT269       40         113948013
BCT27        57         111091737
BCT270       36         114338620
BCT271       73         106473845
BCT272       58         112936840
BCT273       39         105991837
BCT274       65         107261212
BCT275       41         107042374
BCT276       93         116169136
BCT277       54         103923581
BCT278       31         106058802
BCT279       66         107796714
BCT28        52         109549606
BCT280       63         103848564
BCT281       62         106391197
BCT282       88         104308361
BCT283       64         117864634
BCT284       84         115399361
BCT285       55         65447767
BCT286       76         118469179
BCT287       47         102340362
BCT288       61         106888510
BCT289       29         104024527
BCT29        46         112848420
BCT290       59         109272404
BCT291       41         106718542
BCT292       49         109060300
BCT293       80         113434350
BCT294       53         98792624
BCT295       74         114696727
BCT296       61         127587524
BCT297       44         105769856
BCT298       61         108238793
BCT299       52         113724423
BCT3         45         110044504
BCT30        57         112994744
BCT300       50         106415092
BCT301       58         114187172
BCT302       64         105940840
BCT303       22         33087651
BCT304       46         104060193
BCT305       74         112000454
BCT306       50         114244053
BCT307       82         103235416
BCT308       72         103194780
BCT309       78         137774795
BCT31        66         108817610
BCT310       85         75583024
BCT311       203        89845400
BCT312       325        25743984
BCT313       1589       2511957
BCT314       3172       5268484
BCT315       6338       7796395
BCT316       12613      14997742
BCT317       25523      27672627
BCT318       50567      54076291
BCT319       75851      77875292
BCT32        36         96325907
BCT320       71322      76774738
BCT321       10374      92231411
BCT322       5305       94797455
BCT323       3323       102716745
BCT324       125        92772533
BCT325       39         103801273
BCT326       214        102743901
BCT327       6101       97980407
BCT328       22122      93803429
BCT329       21154      21756572
BCT33        40         106881287
BCT330       71365      73593068
BCT331       3689       102660265
BCT332       3947       100740033
BCT333       6493       97486135
BCT334       3878       96543194
BCT335       10720      103933675
BCT336       74842      78898159
BCT337       73398      78173700
BCT338       4900       6069951
BCT339       75551      78478235
BCT34        59         107430269
BCT340       71982      77192860
BCT341       72756      73966235
BCT342       12831      14912432
BCT343       70762      75428335
BCT344       72148      73752750
BCT345       20613      19644240
BCT346       66542      81000967
BCT347       50123      61392695
BCT348       61106      85878758
BCT349       59441      87189086
BCT35        74         111675186
BCT350       7085       9967190
BCT351       23788      104838183
BCT352       3611       153498067
BCT353       1384       172277047
BCT354       5548       105653536
BCT355       1709       104406627
BCT356       2923       109297371
BCT357       1876       107853158
BCT358       2300       116228431
BCT359       1229       110448877
BCT36        55         110045255
BCT360       1112       123604481
BCT361       495        135800715
BCT362       209        115259196
BCT363       25         119086566
BCT364       22         118864761
BCT365       22         118660500
BCT366       323        119318078
BCT367       1669       126457300
BCT368       1369       121170285
BCT369       11756      91741114
BCT37        63         106845594
BCT370       22408      43855047
BCT38        55         109391464
BCT39        53         108650404
BCT4         59         112453622
BCT40        46         110495229
BCT41        95         109522868
BCT42        58         106383657
BCT43        67         109486091
BCT44        125        110095720
BCT45        37         71643089
BCT46        200        111474100
BCT47        54         111189650
BCT48        35         108859141
BCT49        59         107860764
BCT5         24103      103626464
BCT50        56         105257914
BCT51        45         109560296
BCT52        74         109517239
BCT53        64         110182754
BCT54        45         105399191
BCT55        59         110379618
BCT56        70         108888422
BCT57        77         109259245
BCT58        22         22714378
BCT59        67         109336234
BCT6         13434      19705486
BCT60        60         104664634
BCT61        53         102829098
BCT62        56         108908758
BCT63        58         105643854
BCT64        54         109754097
BCT65        72         109941269
BCT66        61         106056484
BCT67        70         111010690
BCT68        36         115917629
BCT69        79         110703954
BCT7         39659      80452954
BCT70        50         110061589
BCT71        60         113870153
BCT72        26         28417084
BCT73        43         109853786
BCT74        50         116699480
BCT75        66         111693041
BCT76        50         111467075
BCT77        53         109197672
BCT78        97         112945696
BCT79        73         112059377
BCT8         1992       59265649
BCT80        80         105681637
BCT81        61         114956262
BCT82        64         115718442
BCT83        53         114897025
BCT84        62         113790360
BCT85        47         110741363
BCT86        21         43870898
BCT87        48         118002347
BCT88        63         115290616
BCT89        248        115434499
BCT9         7656       93380719
BCT90        70         109982609
BCT91        297        115164977
BCT92        63         110836541
BCT93        68         108767418
BCT94        45         109031298
BCT95        61         108655373
BCT96        61         109296173
BCT97        4          12180716
BCT98        57         116195274
BCT99        61         106396448
ENV1         92453      71792747
ENV10        86260      70391284
ENV11        93076      72832110
ENV12        82353      86609106
ENV13        21807      18677444
ENV14        84711      80822818
ENV15        118343     43037482
ENV16        89150      77075409
ENV17        96416      67757575
ENV18        96023      63235778
ENV19        109632     66853009
ENV2         95825      68801220
ENV20        121969     64266446
ENV21        59519      80371226
ENV22        1985       2665839
ENV23        64036      80463296
ENV24        90211      75812600
ENV25        125172     39265203
ENV26        122785     28945679
ENV27        90679      20907713
ENV28        123097     49753756
ENV29        97826      67184945
ENV3         93820      67815866
ENV30        115023     56510803
ENV31        135877     52802848
ENV32        109127     60788442
ENV33        94509      64674963
ENV34        25386      24139665
ENV35        62536      84995133
ENV36        88722      73276073
ENV37        102896     44274222
ENV38        96867      56282212
ENV39        70673      54653611
ENV4         76085      80465372
ENV40        111231     47247564
ENV41        100826     61072895
ENV42        107050     61677059
ENV43        63693      90603085
ENV44        72539      78871276
ENV45        62024      84275376
ENV46        13567      18453103
ENV47        70511      78327058
ENV48        107795     49575769
ENV49        112481     56191673
ENV5         38932      97611029
ENV50        104683     61472505
ENV51        80597      42560094
ENV52        100601     44023151
ENV53        42885      53351901
ENV54        41970      54596651
ENV55        57474      57083783
ENV56        96502      61615312
ENV57        35186      19544059
ENV58        92149      66866589
ENV59        80785      71288245
ENV6         69841      91136060
ENV60        78505      67768188
ENV61        85907      69827379
ENV62        95714      60414267
ENV63        83358      53464794
ENV64        109664     46034771
ENV65        90166      60778487
ENV66        101129     51571747
ENV67        93883      57055224
ENV68        80597      73549385
ENV69        32008      24968989
ENV7         90236      83949171
ENV70        74046      82694498
ENV71        82785      51575961
ENV72        86341      59390740
ENV73        56640      76524467
ENV74        105211     32167213
ENV75        66972      16917102
ENV76        78570      74345752
ENV77        91974      57749440
ENV78        101474     59816385
ENV79        108091     39992549
ENV8         78893      46003690
ENV80        108261     37626521
ENV81        34840      24688781
ENV82        98675      54408600
ENV83        116351     29438819
ENV84        107390     41886989
ENV85        104014     49450266
ENV86        90522      35344308
ENV87        101425     50416641
ENV88        113919     49805349
ENV89        122023     39875178
ENV9         131421     31025284
ENV90        112486     47368668
ENV91        35163      24343692
ENV92        93501      57256130
ENV93        91294      60332533
ENV94        102485     50514226
ENV95        73346      47481382
ENV96        94715      64900310
ENV97        92673      69230702
ENV98        120981     45891793
ENV99        42386      15539280
EST1         160147     62055496
EST10        169952     73460692
EST100       231467     141034041
EST101       239302     125377034
EST102       194702     104546771
EST103       182390     102756230
EST104       93676      66316239
EST105       161408     120611065
EST106       175080     106821755
EST107       134235     84331809
EST108       63884      23749865
EST109       63412      22288910
EST11        168586     72947808
EST110       63854      23122662
EST111       63916      26929608
EST112       64401      22911933
EST113       64607      24630352
EST114       63537      27083983
EST115       63849      26181805
EST116       64075      27278891
EST117       63912      25159791
EST118       61292      34058859
EST119       129465     64374313
EST12        172601     74138666
EST120       161381     86187352
EST121       184500     93030982
EST122       149303     95971061
EST123       158292     93247176
EST124       125571     81782695
EST125       189329     90796862
EST126       157056     83452617
EST127       158256     84994411
EST128       158540     85468239
EST129       151341     84885369
EST13        56802      27080034
EST130       174571     93803865
EST131       184745     117854590
EST132       202240     102157316
EST133       161242     88509158
EST134       162126     81444013
EST135       144252     85119542
EST136       144328     90732582
EST137       91848      47763062
EST138       173608     98196766
EST139       244890     113054960
EST14        218895     109883726
EST140       155950     84221852
EST141       168113     92696340
EST142       150608     87915330
EST143       135832     83840394
EST144       155967     96186857
EST145       155069     85664984
EST146       124018     63573321
EST147       121156     65083578
EST148       127875     57370129
EST149       127025     51016874
EST15        169755     106514026
EST150       128320     51159594
EST151       111563     41545840
EST152       164718     83016142
EST153       177835     74484978
EST154       162637     111157878
EST155       201803     123525139
EST156       214137     121574464
EST157       175720     96916367
EST158       155860     108342852
EST159       140168     95323614
EST16        183761     113817553
EST160       157879     96786992
EST161       156709     82478966
EST162       139376     78560162
EST163       172464     95510251
EST164       60627      38725179
EST165       151294     92666129
EST166       193520     111110208
EST167       146575     84280592
EST168       142424     72159558
EST169       152819     88513114
EST17        195553     117851861
EST170       190077     105263772
EST171       156987     96391796
EST172       168561     83487962
EST173       130231     87261566
EST174       173554     101809499
EST175       173671     100169549
EST176       119220     67656042
EST177       159851     91252752
EST178       21159      13016064
EST179       171661     103705274
EST18        195686     119611845
EST180       182535     120344935
EST181       144523     116575465
EST182       195086     100059024
EST183       153518     105316008
EST184       153546     99036742
EST185       142348     82799443
EST186       179090     73130023
EST187       150401     83236889
EST188       157507     100798354
EST189       160824     98390126
EST19        160172     113594769
EST190       141675     86065445
EST191       149184     89028683
EST192       147352     94376905
EST193       132174     91879327
EST194       142344     87476663
EST195       138321     90275238
EST196       133568     93949721
EST197       164879     88034958
EST198       175502     96471761
EST199       174857     97279330
EST2         162886     61826800
EST20        190578     100880305
EST200       172548     96905113
EST201       169976     95253890
EST202       173439     96374625
EST203       174883     95832116
EST204       175407     96455587
EST205       4743       2477962
EST206       190346     105932551
EST207       207615     105884500
EST208       172756     103038308
EST209       181827     103024656
EST21        221396     107287800
EST210       201946     122678856
EST211       198533     114015988
EST212       194118     125093798
EST213       137598     92197682
EST214       221002     141080417
EST215       237982     119308438
EST216       149114     101361890
EST217       183390     101249253
EST218       203514     99789075
EST219       132275     95254621
EST22        184955     59854910
EST220       147764     87094550
EST221       211166     117041693
EST222       160618     104269498
EST223       105055     110341348
EST224       155111     103390592
EST225       162753     97821844
EST226       142146     101636857
EST227       223685     106885671
EST228       137162     99224246
EST229       115361     82157219
EST23        137189     39299163
EST230       138523     98358366
EST231       123251     88291525
EST232       144460     90212907
EST233       130137     88896080
EST234       140886     105536040
EST235       132399     93271628
EST236       125284     84806555
EST237       142639     88354075
EST238       160221     121972361
EST239       124212     118263838
EST24        102669     27765924
EST240       139885     103644921
EST241       178428     107974649
EST242       164398     102200056
EST243       159443     100700313
EST244       75824      44337431
EST245       167493     126123545
EST246       144069     106400874
EST247       157002     100609225
EST248       215112     97853316
EST249       184835     113212203
EST25        119100     50117663
EST250       156547     84361761
EST251       219287     30220793
EST252       218175     87936370
EST253       163712     122152690
EST254       174603     102452238
EST255       163662     108622282
EST256       108117     67073765
EST257       156107     114045258
EST258       185604     112470099
EST259       189789     98483392
EST26        215597     98196770
EST260       177165     111128392
EST261       163781     111633759
EST262       233562     109784930
EST263       279464     121769268
EST264       189028     113913229
EST265       188672     37198323
EST266       260685     125131164
EST267       56114      36729310
EST268       153853     98124293
EST269       166625     102596812
EST27        220492     110846129
EST270       167449     114854190
EST271       197930     103295217
EST272       159066     107916501
EST273       195622     114558964
EST274       199145     46972093
EST275       204883     45134375
EST276       183726     103090243
EST277       177273     119118612
EST278       182041     115065000
EST279       116998     66656061
EST28        190466     88175343
EST280       176217     114708471
EST281       172195     75100832
EST282       132663     82986174
EST283       132773     86102821
EST284       157008     101434759
EST285       262659     27693871
EST286       266657     24517606
EST287       145337     107847166
EST288       170010     111141988
EST289       160932     101310118
EST29        158680     69288682
EST290       163191     89630117
EST291       138801     12694771
EST292       210501     74869326
EST293       166662     107911009
EST294       177574     107016795
EST295       154640     100182934
EST296       202013     108759466
EST297       153418     110782949
EST298       168059     101810996
EST299       187994     115321548
EST3         152205     54001983
EST30        172610     69767365
EST300       180716     104179745
EST301       188061     98062394
EST302       184124     64334000
EST303       117551     41443935
EST304       183963     71375244
EST305       184618     69637582
EST306       186536     96911878
EST307       183246     131704566
EST308       145965     84869416
EST309       153086     92925668
EST31        152091     64370071
EST310       132113     100758998
EST311       162236     97337905
EST312       173139     99093205
EST313       150430     97326808
EST314       167789     94919743
EST315       161110     107773384
EST316       95340      67618991
EST317       165803     108821995
EST318       158176     109514559
EST319       179779     152479576
EST32        167654     76279613
EST320       171142     111560463
EST321       142636     76713511
EST322       143983     98171339
EST323       147340     100921125
EST324       135645     91410751
EST325       149938     100207096
EST326       150961     101537017
EST327       178610     109566038
EST328       148866     84413930
EST329       149383     85201034
EST33        179342     70572819
EST330       57738      35903309
EST331       151264     108835887
EST332       162152     97447449
EST333       144247     91767002
EST334       142549     89682937
EST335       206368     111977400
EST336       136391     74610436
EST337       91279      54622989
EST338       131551     86733934
EST339       137990     87633080
EST34        113584     37347505
EST340       125499     80142761
EST341       162869     86553495
EST342       217595     84797806
EST343       169066     88392482
EST344       100433     59082767
EST345       166183     104019135
EST346       147235     90048541
EST347       133515     88935987
EST348       136754     89158866
EST349       187975     122731074
EST35        96454      29606959
EST350       160498     97231524
EST351       155702     78610158
EST352       187910     128757301
EST353       115644     79882190
EST354       73577      44088101
EST355       139173     76863178
EST356       131078     78423288
EST357       149482     56586901
EST358       159298     32688999
EST359       35083      7094333
EST36        96819      30305623
EST360       156187     43024119
EST361       191763     121728611
EST362       240593     114305215
EST363       249181     113808961
EST364       186254     103313994
EST365       141532     91301328
EST366       137345     86967076
EST367       155359     91525728
EST368       194163     119915732
EST369       227296     62373154
EST37        95746      29047849
EST370       182955     111644815
EST371       16464      8974124
EST372       215642     118405823
EST373       205664     122189970
EST374       204384     116385172
EST375       144884     69973987
EST376       197246     121779596
EST377       163472     103508868
EST378       163249     125626949
EST379       182851     147570301
EST38        97638      29503072
EST380       158158     91280256
EST381       164857     106434120
EST382       186658     106365569
EST383       89136      52217751
EST384       206160     112270920
EST385       196701     109558496
EST386       193945     119410256
EST387       190613     124821324
EST388       202848     133490023
EST389       221578     133902451
EST39        98185      30985777
EST390       208001     133301544
EST391       198711     150772546
EST392       213387     164769098
EST393       200954     121617880
EST394       45674      27993077
EST395       181603     95534559
EST396       173733     69537175
EST397       168600     13121674
EST398       155912     15755245
EST399       159240     32813502
EST4         172169     67671492
EST40        24642      6286733
EST400       159352     32545667
EST401       157868     41066338
EST402       150510     94590265
EST403       186106     115958373
EST404       164998     107385765
EST405       166352     107067380
EST406       146074     98141756
EST407       101423     70996587
EST408       145449     94975411
EST409       173025     118632652
EST41        101644     53117804
EST410       142767     99315020
EST411       177797     105111062
EST412       173198     36316155
EST413       166534     59324959
EST414       156482     110523373
EST415       163157     104443087
EST416       162225     100611229
EST417       159402     92275676
EST418       189675     124591619
EST419       145083     95826044
EST42        119850     50999334
EST420       125118     85907851
EST421       154606     95682650
EST422       156773     94053096
EST423       175989     94204527
EST424       160098     96712148
EST425       168382     97039009
EST426       172937     106168875
EST427       139375     88073954
EST428       101988     72866569
EST429       80525      61911466
EST43        167628     92700573
EST430       106643     70202329
EST431       156973     86125067
EST432       127069     77344454
EST433       139425     91449999
EST434       141983     83475933
EST435       43022      29151552
EST436       168039     97975397
EST437       179737     93690931
EST438       164436     105744898
EST439       156128     96921491
EST44        170958     72058651
EST440       172775     77542481
EST441       195448     107876207
EST442       153771     83571130
EST443       170201     99443753
EST444       221072     129208839
EST445       157102     107720944
EST446       168715     103302968
EST447       140257     91129047
EST448       17124      11233029
EST449       136211     91197333
EST45        167918     85558292
EST450       199626     74744246
EST451       181464     86301518
EST452       207384     88843214
EST453       201327     81811373
EST454       182675     107408077
EST455       184109     112313435
EST456       191007     109972640
EST457       196212     116588309
EST458       200202     127408200
EST459       189580     88456038
EST46        169839     87309406
EST460       9907       4692135
EST461       188214     115153064
EST462       204985     121430046
EST463       202282     120558873
EST464       171608     104739390
EST465       200493     126049333
EST466       154790     90977835
EST467       149714     112582907
EST468       159997     87302752
EST469       191083     98132165
EST47        164138     88254874
EST470       144933     77954831
EST471       155108     84899309
EST472       128478     64739273
EST473       182420     113177210
EST474       172089     103458215
EST475       181265     122765614
EST476       183496     122566130
EST477       187971     115273326
EST478       176604     101986354
EST479       188353     99931865
EST48        163278     83088436
EST480       168258     59608292
EST481       161648     62314637
EST482       33929      11445568
EST49        160383     91747250
EST5         170274     66706241
EST50        163023     90617850
EST51        158737     97332743
EST52        159952     71235567
EST53        149283     83476774
EST54        63369      43122119
EST55        168245     70344184
EST56        165800     75339984
EST57        166080     91732740
EST58        159227     96899031
EST59        157542     103351009
EST6         172387     67094668
EST60        165691     99692388
EST61        161244     109143492
EST62        172969     78932876
EST63        174733     94959811
EST64        155680     84615648
EST65        149018     82982473
EST66        160924     97883267
EST67        122846     70616208
EST68        150502     92247281
EST69        197248     109655294
EST7         171645     73631196
EST70        182802     95391295
EST71        223277     122528758
EST72        187783     112781248
EST73        203233     120228301
EST74        164882     90230246
EST75        132642     61027641
EST76        136202     67086237
EST77        161029     103059257
EST78        157797     94063310
EST79        143927     79273076
EST8         181630     73732762
EST80        38661      17988472
EST81        164990     100912511
EST82        213947     115981599
EST83        226435     124844688
EST84        201693     95139207
EST85        213087     93823593
EST86        159919     92074537
EST87        145149     88667417
EST88        164669     80708786
EST89        160945     81095810
EST9         168699     69394213
EST90        153050     102327291
EST91        152424     91799937
EST92        123637     77991402
EST93        156662     113328317
EST94        141747     103763614
EST95        142590     101967148
EST96        141874     98039482
EST97        148160     81652750
EST98        179766     111991817
EST99        227664     137797165
GSS1         201766     88393856
GSS10        133597     61508119
GSS100       145752     114882991
GSS101       142374     116384778
GSS102       144253     117845900
GSS103       170446     129093145
GSS104       137456     74721011
GSS105       192290     121402485
GSS106       169510     113264079
GSS107       200404     117639849
GSS108       206385     135350340
GSS109       210698     139056866
GSS11        137308     73395094
GSS110       209780     139919217
GSS111       205663     145147197
GSS112       206482     144071047
GSS113       205586     145388557
GSS114       203091     147406629
GSS115       181517     137766286
GSS116       7078       3527864
GSS117       133693     84580020
GSS118       171024     80543081
GSS119       184853     80317336
GSS12        148972     76163539
GSS120       171265     149231516
GSS121       178609     120900679
GSS122       179757     146317241
GSS123       188837     121943143
GSS124       188257     138764645
GSS125       192853     128024154
GSS126       192160     95527689
GSS127       167089     153827896
GSS128       164916     116276994
GSS129       52118      29729233
GSS13        146064     69710590
GSS130       171707     156104957
GSS131       173053     155053669
GSS132       173062     155788815
GSS133       174513     154746450
GSS134       172801     155172413
GSS135       180860     139411917
GSS136       179838     146147488
GSS137       164915     119078062
GSS138       195645     96165596
GSS139       258703     40811533
GSS14        173150     86526823
GSS140       258653     39866758
GSS141       83883      12897561
GSS142       256944     59254341
GSS143       266389     55283745
GSS144       191915     88032131
GSS145       197995     66798009
GSS146       185657     147614485
GSS147       182068     150420567
GSS148       168208     155391890
GSS149       171791     158498945
GSS15        163032     97556699
GSS150       238052     73457744
GSS151       229182     82172993
GSS152       120032     51399360
GSS153       214489     54789313
GSS154       158718     98268775
GSS155       182695     113505883
GSS156       136355     87245102
GSS157       166455     132071803
GSS158       185089     162317826
GSS159       195022     160336808
GSS16        173394     88684185
GSS160       191961     125532496
GSS161       218404     139096798
GSS162       222682     133649914
GSS163       158908     97282819
GSS164       149719     87248804
GSS165       29468      22393825
GSS166       212912     158797598
GSS167       193250     101963779
GSS168       173558     69993786
GSS169       207351     160785410
GSS17        186109     116615710
GSS170       209371     162937228
GSS171       207954     164751088
GSS172       206670     132789857
GSS173       204167     148030160
GSS174       125210     86194274
GSS175       87034      63855245
GSS176       83577      62786371
GSS177       103116     48366085
GSS178       68990      58637252
GSS179       8510       7648264
GSS18        192111     112001243
GSS180       68650      57968938
GSS181       69281      56696847
GSS182       69518      56234995
GSS183       71267      56043617
GSS184       68322      51682051
GSS185       75915      58209304
GSS186       86540      74277212
GSS187       81348      44404013
GSS188       92264      45106435
GSS189       65102      48523381
GSS19        99203      44390134
GSS190       77817      61671469
GSS191       70214      59194095
GSS192       68204      63290904
GSS193       62733      52925089
GSS194       94993      42344588
GSS195       19502      4535679
GSS196       112930     70870954
GSS197       830        565879
GSS198       23226      28867035
GSS199       109084     70678875
GSS2         183363     92903519
GSS20        182134     102018573
GSS200       84411      34587755
GSS201       35896      22276911
GSS202       103434     62565003
GSS203       102447     63849638
GSS204       104373     67711538
GSS205       81746      41058579
GSS206       83102      54651503
GSS207       95565      61249467
GSS208       107362     78589335
GSS209       106444     76728833
GSS21        167232     114859942
GSS210       106101     79982459
GSS211       104001     80014803
GSS212       75801      50678132
GSS213       105097     63619915
GSS214       109868     66415305
GSS215       105969     59182678
GSS216       68062      37223883
GSS217       69097      38525198
GSS218       38174      18339130
GSS219       85817      46213833
GSS22        170202     97916777
GSS220       97774      56293008
GSS221       94834      49464944
GSS222       96316      55977648
GSS223       41259      23116851
GSS224       114107     43462563
GSS225       116481     39262549
GSS226       108537     52758264
GSS227       108498     66975496
GSS228       100920     77744360
GSS229       57790      34653929
GSS23        187607     128076472
GSS230       96897      36918766
GSS231       96399      37676586
GSS232       97739      35452830
GSS233       95145      39751140
GSS234       33820      15967145
GSS235       103643     66079771
GSS236       94657      61262657
GSS237       95235      60429693
GSS238       94882      60936668
GSS239       75733      70088559
GSS24        194112     129263191
GSS240       80768      68567938
GSS241       36701      34808193
GSS242       82451      27787824
GSS243       82925      26902290
GSS244       83483      25713611
GSS245       18873      5507584
GSS246       16547      7508221
GSS247       94102      60581881
GSS248       95569      64262166
GSS249       94824      64683423
GSS25        177441     104584455
GSS250       105259     69398136
GSS251       92415      46209601
GSS252       91707      49888873
GSS253       79006      43118631
GSS254       90911      57070316
GSS255       89786      61908922
GSS256       88601      63777484
GSS257       89396      62541094
GSS258       9342       6742661
GSS259       88085      63867833
GSS26        186610     108911114
GSS260       90679      62789788
GSS261       94860      59835949
GSS262       74809      63957256
GSS263       84506      78714665
GSS264       82944      80898169
GSS265       69059      51310496
GSS266       114900     62956729
GSS267       108980     55519998
GSS268       107208     51972208
GSS269       99627      44671760
GSS27        169596     151636730
GSS270       109459     48915853
GSS271       98719      45881699
GSS272       80973      62819023
GSS273       72826      72790774
GSS274       64574      55877660
GSS275       60740      46994351
GSS276       37095      27996803
GSS277       60845      46734002
GSS278       61946      49327951
GSS279       84047      86740412
GSS28        189649     144752617
GSS280       82536      88549611
GSS281       77949      74213298
GSS282       84442      64951795
GSS283       60134      48386085
GSS284       60082      48548768
GSS285       79755      51505702
GSS286       81394      61015678
GSS287       46325      27866603
GSS288       94787      57200301
GSS289       93517      59081345
GSS29        152614     107633448
GSS290       93900      58510429
GSS291       94714      57307691
GSS292       83843      51265303
GSS293       103666     69242174
GSS294       104299     74321241
GSS295       109373     68331863
GSS296       106994     71135784
GSS297       38781      26571815
GSS298       111314     66044649
GSS299       97520      60954006
GSS3         176506     88394950
GSS30        191222     130927043
GSS300       106950     56669730
GSS301       93076      72615543
GSS302       82646      87962916
GSS303       78596      93791277
GSS304       53021      31246397
GSS31        12106      7890148
GSS32        196439     127533969
GSS33        218981     117362130
GSS34        220852     114831387
GSS35        221963     113324105
GSS36        214667     124302089
GSS37        197225     155397680
GSS38        193935     145875400
GSS39        191369     68974205
GSS4         167759     85518632
GSS40        185160     97600580
GSS41        189761     125955498
GSS42        173642     160888425
GSS43        5987       3927599
GSS44        183966     100311532
GSS45        173274     121807446
GSS46        184128     124082945
GSS47        189635     121468909
GSS48        72701      63946125
GSS49        170766     101351050
GSS5         48508      29143102
GSS50        166917     102544217
GSS51        167103     101960328
GSS52        182672     120780882
GSS53        185111     116752809
GSS54        181953     122997714
GSS55        187100     113038211
GSS56        189343     135272415
GSS57        179005     104600319
GSS58        194201     119694328
GSS59        180383     132168671
GSS6         162428     84847761
GSS60        6752       6136544
GSS61        172439     138674275
GSS62        162915     112375740
GSS63        162938     112418280
GSS64        156424     106001592
GSS65        156671     129033606
GSS66        170936     143092732
GSS67        176931     115277478
GSS68        203418     127438263
GSS69        194384     110910486
GSS7         166528     79923105
GSS70        245897     127170802
GSS71        160709     106726812
GSS72        159975     120169213
GSS73        163425     125119374
GSS74        163390     125180587
GSS75        176013     109444765
GSS76        191298     140385847
GSS77        9295       5463053
GSS78        197587     125566180
GSS79        169882     110987161
GSS8         166565     89352425
GSS80        200252     131233072
GSS81        213078     87883995
GSS82        189425     98967539
GSS83        132405     92512465
GSS84        147250     118257640
GSS85        140219     117487940
GSS86        143489     114780353
GSS87        144607     120323535
GSS88        142692     116459835
GSS89        102514     85346116
GSS9         138313     67423895
GSS90        150146     122846863
GSS91        148368     118148342
GSS92        144647     113644015
GSS93        143499     116030340
GSS94        144993     120382598
GSS95        149051     121555980
GSS96        148092     118941829
GSS97        146794     121586586
GSS98        146798     121584467
GSS99        147331     120524208
HTC1         25050      27033299
HTC10        71312      72126281
HTC11        70240      69500626
HTC12        40134      41771500
HTC13        67517      60542416
HTC14        68999      69658873
HTC15        53090      41085186
HTC2         16074      36212642
HTC3         16017      36610472
HTC4         16238      35518163
HTC5         15962      40336042
HTC6         16045      37398239
HTC7         53621      31263603
HTC8         31433      19847768
HTC9         60708      77605740
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1052       190082308
HTG107       1392       191645363
HTG108       1294       191585801
HTG109       1640       191144599
HTG11        4          606452
HTG110       1331       191903664
HTG111       888        128859857
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1590       179393068
HTG121       1587       179603616
HTG122       1580       179595063
HTG123       1598       179568613
HTG124       1603       179517182
HTG125       1582       180855862
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1477       185749970
HTG129       1134       190249540
HTG13        875        191786413
HTG130       1103       184582645
HTG131       4          407375
HTG132       1557       186483382
HTG133       1855       177768696
HTG134       986        186174720
HTG135       1072       192049994
HTG136       1089       193222951
HTG137       602        109520336
HTG138       1031       189469892
HTG139       1055       192678789
HTG14        753        191921309
HTG140       1163       191852916
HTG141       1080       192395765
HTG142       1083       192975115
HTG143       589        103841272
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2127       191603389
HTG149       1096       192456765
HTG15        745        191963148
HTG150       1077       192049291
HTG151       1088       192458469
HTG152       1037       190364444
HTG153       1983       182136963
HTG154       1799       183915240
HTG16        785        191933231
HTG17        796        191351096
HTG18        775        192103394
HTG19        2069       170638342
HTG2         2464       186026155
HTG20        1096       187413748
HTG21        887        180042173
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2513       185231866
HTG30        911        190941779
HTG31        841        171449145
HTG32        875        191097680
HTG33        968        189501635
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2556       188418164
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1256       188119418
HTG43        1169       188010117
HTG44        1150       188080035
HTG45        1117       191232412
HTG46        1269       190680440
HTG47        1176       190900424
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        968        190053772
HTG53        1105       190190847
HTG54        1046       190167631
HTG55        1013       189639817
HTG56        969        189170679
HTG57        81         14306584
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1168       188733578
HTG66        1179       187376477
HTG67        1282       184377078
HTG68        92         11899003
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         93654      48189012
INV10        48901      92492823
INV100       66634      130026281
INV101       38635      162651925
INV102       37923      155535140
INV103       47450      148279075
INV104       31582      35878775
INV105       41258      162193552
INV106       8649       189035299
INV107       14549      181577331
INV108       5295       188760704
INV109       18509      176900436
INV11        35         174810098
INV110       34351      158679406
INV111       14344      172158272
INV112       23577      45955779
INV113       16795      180349455
INV114       21027      172501512
INV115       4891       191046501
INV116       26084      174037919
INV117       14547      181030545
INV118       44397      155376448
INV119       27112      171621394
INV12        15632      161930509
INV120       19370      174154051
INV121       49371      138775955
INV122       29055      84543185
INV123       96245      108547326
INV124       35892      166944993
INV125       23159      177277868
INV126       22654      170374262
INV127       4699       190767649
INV128       29376      152389625
INV129       55624      119361124
INV13        83320      64862023
INV130       566        40635863
INV131       7358       190633905
INV132       51895      153104512
INV133       5607       188059543
INV134       35090      162258474
INV135       3364       19014860
INV136       39813      159668855
INV137       62444      141571579
INV138       19462      30223725
INV139       104664     106635585
INV14        54262      46037418
INV140       74577      120116541
INV141       12112      167732182
INV142       18278      163726949
INV143       13818      94808827
INV144       29262      155753563
INV145       38610      149060814
INV146       51684      139700572
INV147       70877      126444377
INV148       97323      108082698
INV149       125942     86452766
INV15        84551      65952642
INV150       27952      144312677
INV151       15687      138046417
INV152       259        150404987
INV153       28170      133163500
INV154       2054       23919148
INV16        80708      66715382
INV17        78535      66745066
INV18        50027      47095215
INV19        36852      121660608
INV2         59883      89727063
INV20        284        149846609
INV21        49901      102945335
INV22        77099      55622827
INV23        72039      61785715
INV24        433        280958
INV25        23152      127349602
INV26        6          133712559
INV27        56684      101642857
INV28        74037      50295649
INV29        70509      51206099
INV3         1369       188232507
INV30        76778      54990017
INV31        75550      57241877
INV32        76755      57105312
INV33        73317      54076217
INV34        55315      36620754
INV35        78726      56779609
INV36        74407      55055516
INV37        74452      60717971
INV38        77035      58620822
INV39        56736      37855865
INV4         880        127630174
INV40        77754      55997244
INV41        73573      52348805
INV42        74613      56061121
INV43        76869      57485703
INV44        39032      33770295
INV45        75583      48318527
INV46        73051      44522611
INV47        75238      45559743
INV48        76635      52698121
INV49        29743      22551483
INV5         26263      110055492
INV50        76263      54033959
INV51        74152      44288843
INV52        73521      43360732
INV53        73714      42564104
INV54        31508      18994610
INV55        69263      41138927
INV56        68916      41290612
INV57        68620      41253451
INV58        68643      40808098
INV59        69631      44995693
INV6         77732      71344429
INV60        69288      41878100
INV61        57162      34098961
INV62        65599      48948231
INV63        68598      49372446
INV64        74298      58060162
INV65        69069      51831241
INV66        70762      59286048
INV67        75927      55847255
INV68        48275      98274118
INV69        44282      121053207
INV7         53246      95775007
INV70        81479      126211856
INV71        100429     109691945
INV72        116036     96137263
INV73        101319     70777781
INV74        35239      166647152
INV75        30755      171594048
INV76        27724      170864744
INV77        2640       190498229
INV78        6183       191107737
INV79        17837      180141483
INV8         43830      90570152
INV80        15378      184713635
INV81        6839       167378491
INV82        8875       189509571
INV83        15662      184182101
INV84        30722      171526293
INV85        65600      142208408
INV86        21638      22670137
INV87        50224      153584896
INV88        4095       191102716
INV89        11177      184659675
INV9         80241      71418624
INV90        29153      168751324
INV91        3317       189349389
INV92        6330       186171285
INV93        12367      180474553
INV94        39596      157268982
INV95        60755      142074593
INV96        67983      110944176
INV97        93063      112788673
INV98        14244      174036919
INV99        29357      160122987
MAM1         21062      154718152
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         13953      164815330
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         20463      32049652
MAM30        1706       2411269
MAM31        6836       6159435
MAM32        79403      74424925
MAM33        31122      118975141
MAM34        75932      62136143
MAM35        68735      72277472
MAM36        63941      77814317
MAM37        55661      87329507
MAM38        9135       183039345
MAM39        3401       3838872
MAM4         26816      24996486
MAM5         13731      20581346
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         222546     70101214
PAT10        124328     102489015
PAT100       178683     3394977
PAT101       178342     3388498
PAT102       178198     3385762
PAT103       178185     3385515
PAT104       132610     2848492
PAT105       342935     8573375
PAT106       188806     88519660
PAT107       111348     132068608
PAT108       3850       194703659
PAT109       131292     110979300
PAT11        98822      64203799
PAT110       158599     54826034
PAT111       224681     34110381
PAT112       250080     15844313
PAT113       180683     63516304
PAT114       51694      26210127
PAT115       114138     110461042
PAT116       137534     83209364
PAT117       164373     99021773
PAT118       158392     103578951
PAT119       137596     115028387
PAT12        141823     62679900
PAT120       42621      28098514
PAT121       193712     81686401
PAT122       150218     108404223
PAT123       356051     11379519
PAT124       257211     57607676
PAT125       138160     48226316
PAT126       322021     22795469
PAT127       155642     102753966
PAT128       132724     110696205
PAT129       128341     121313309
PAT13        103925     59409514
PAT130       21664      184390005
PAT131       144889     112900617
PAT132       171997     96405634
PAT133       44617      171215968
PAT134       9167       47581637
PAT135       33645      178334734
PAT136       153558     109675196
PAT137       178705     90913377
PAT138       136050     115324192
PAT139       120392     123343236
PAT14        102676     49411116
PAT140       8526       8991488
PAT141       155429     101473147
PAT142       184764     88815933
PAT143       182409     85292093
PAT144       174403     93928365
PAT145       28829      20461016
PAT146       147930     108545990
PAT147       160944     101973644
PAT148       185311     90980420
PAT149       231649     49265020
PAT15        120394     52414325
PAT150       203020     47532890
PAT151       277498     9808008
PAT152       220401     46464935
PAT153       107699     2905642
PAT154       270386     21672571
PAT155       186661     61148963
PAT156       109664     106102047
PAT157       47743      9596046
PAT158       87159      87872668
PAT159       78136      95530847
PAT16        108574     62734669
PAT160       144044     78090090
PAT161       168235     70788797
PAT162       121013     93305897
PAT163       103747     84895124
PAT164       166138     46774575
PAT165       270022     5130418
PAT166       269978     5129582
PAT167       269978     5129582
PAT168       237888     4519872
PAT169       269396     5118524
PAT17        47626      17037088
PAT170       235450     25552370
PAT171       203699     47174946
PAT172       12098      424776
PAT173       165310     74498391
PAT174       91503      126582622
PAT175       171357     72073196
PAT176       214404     66354931
PAT177       42874      49260630
PAT178       235138     59544089
PAT179       123750     125093767
PAT18        146771     52594264
PAT180       217504     66591902
PAT181       198097     84199370
PAT182       2346       5855451
PAT183       190271     85554469
PAT184       158609     102172052
PAT185       157481     102983510
PAT186       99253      76900838
PAT187       156209     98316380
PAT188       91682      138752301
PAT189       160779     88041379
PAT19        153717     78039882
PAT190       136985     111168356
PAT191       42350      35878823
PAT192       168931     98953101
PAT193       142774     114661479
PAT194       131583     119360876
PAT195       97976      135115181
PAT196       155419     106223733
PAT197       188151     61193131
PAT198       33691      32835681
PAT199       93113      87245332
PAT2         194518     84672670
PAT20        104762     118103022
PAT200       91789      79969642
PAT201       83786      91658083
PAT202       108685     54204939
PAT203       101025     56652559
PAT204       150189     24631215
PAT205       93817      82459162
PAT206       26010      162900357
PAT207       113939     65759888
PAT208       81618      28134684
PAT209       3631       191518875
PAT21        133723     95370485
PAT210       84408      78157905
PAT211       145070     26290630
PAT212       76933      99953933
PAT213       95327      71448753
PAT214       129839     31394838
PAT215       4940       7291482
PAT216       106326     62280116
PAT217       140007     12601685
PAT218       150519     23976386
PAT219       74131      6340298
PAT22        84646      79523445
PAT220       58028      68766855
PAT221       41081      54488985
PAT222       60875      54847144
PAT223       37721      64051648
PAT224       41404      61065384
PAT225       40778      53269659
PAT226       79940      57624117
PAT227       111539     54516872
PAT228       37061      8158333
PAT229       103405     55692396
PAT23        123541     103398512
PAT230       99422      44580758
PAT231       84105      73951091
PAT232       98252      10041952
PAT233       123244     19683537
PAT234       86788      129976495
PAT235       158952     78754789
PAT236       213334     47020463
PAT237       169350     66529413
PAT238       59805      8708633
PAT239       161863     78377268
PAT24        119437     105663274
PAT240       119782     100490233
PAT241       86768      128899853
PAT242       37958      167204138
PAT243       35970      168659354
PAT244       75398      138092775
PAT245       252324     29172044
PAT246       137108     91854654
PAT247       148311     82349447
PAT248       141896     74982856
PAT249       16862      11367627
PAT25        145191     86610850
PAT250       141695     86763404
PAT251       144995     93151551
PAT252       257285     12186129
PAT253       152526     4584721
PAT254       240738     21500238
PAT255       248574     11702646
PAT256       258799     3881985
PAT257       76619      1149285
PAT258       258799     3881985
PAT259       253598     6415258
PAT26        175020     64347291
PAT260       181107     64057890
PAT261       108663     133104260
PAT262       212027     72771336
PAT263       93467      6222697
PAT264       96024      21414322
PAT265       36373      149540958
PAT266       17430      176266906
PAT267       156074     8162466
PAT268       33395      148991922
PAT269       31806      82266406
PAT27        71811      1795275
PAT270       5144       9240794
PAT271       37903      57481578
PAT272       37752      57968298
PAT273       37840      57577626
PAT274       37917      57289516
PAT275       60382      56854467
PAT276       129180     17677268
PAT277       114910     50076717
PAT278       124134     25061875
PAT279       89517      45410224
PAT28        102088     77372284
PAT280       138413     26721996
PAT281       151725     82171011
PAT282       257582     3863730
PAT283       218701     27637905
PAT284       93122      67891398
PAT285       213438     42144702
PAT286       141246     78850338
PAT287       132021     3962125
PAT288       131924     3958408
PAT289       131925     3957998
PAT29        93955      87562996
PAT290       100941     56917753
PAT291       63973      21035549
PAT3         171992     95904578
PAT30        119912     61673341
PAT31        96696      78993347
PAT32        128069     54909348
PAT33        92415      51184294
PAT34        117830     69179507
PAT35        119659     35930880
PAT36        121821     44323545
PAT37        94341      86760546
PAT38        147256     22244931
PAT39        149446     31043032
PAT4         153752     106058463
PAT40        114635     50136824
PAT41        33896      45999593
PAT42        95723      83167099
PAT43        100229     70745785
PAT44        136003     39561489
PAT45        143801     35449077
PAT46        123827     64350153
PAT47        104440     81121401
PAT48        93089      74613582
PAT49        113260     66580372
PAT5         57129      23913162
PAT50        65582      54917156
PAT51        135192     108000182
PAT52        167082     97033300
PAT53        116398     127556257
PAT54        196344     76722199
PAT55        80300      127990932
PAT56        27631      180872621
PAT57        185409     93066654
PAT58        274258     6856450
PAT59        129447     31627433
PAT6         170645     91912459
PAT60        161320     77719729
PAT61        92639      89107951
PAT62        106058     74951034
PAT63        122370     64033005
PAT64        68048      30422705
PAT65        70748      109764944
PAT66        87946      82759037
PAT67        92971      78935157
PAT68        93164      72444136
PAT69        93383      75087244
PAT7         154883     88272027
PAT70        115771     60532312
PAT71        102746     9942033
PAT72        175928     10547489
PAT73        171510     10872561
PAT74        171496     10866737
PAT75        99864      86225363
PAT76        99         196466297
PAT77        67         192869889
PAT78        103        195600591
PAT79        1130       196318180
PAT8         131115     96982407
PAT80        97606      5772813
PAT81        151009     9636510
PAT82        151022     9621259
PAT83        151024     9622125
PAT84        151021     9620837
PAT85        94629      88051226
PAT86        92261      94524506
PAT87        37556      34675173
PAT88        83459      93185861
PAT89        15567      180450135
PAT9         129292     101012169
PAT90        164894     19209797
PAT91        178944     3399936
PAT92        177543     3373317
PAT93        175669     3337711
PAT94        100925     1917575
PAT95        169273     12414184
PAT96        178699     3395281
PAT97        178691     3395129
PAT98        178677     3394863
PAT99        140678     2672882
PHG1         5832       104156299
PHG2         3018       106306663
PHG3         2139       106724458
PHG4         1267       16062735
PLN1         59768      93443696
PLN10        48141      48499493
PLN100       81769      65436220
PLN101       92268      57791387
PLN102       23113      15640971
PLN103       77249      71107364
PLN104       69886      84136486
PLN105       76103      67753205
PLN106       71997      76770879
PLN107       79840      65141419
PLN108       8196       7803071
PLN109       77988      63206991
PLN11        71513      76915686
PLN110       75181      68227382
PLN111       81290      59405230
PLN112       81478      58205734
PLN113       24658      27426107
PLN114       73331      62791182
PLN115       72328      70336457
PLN116       62386      85095807
PLN117       59309      66951946
PLN118       91199      52604089
PLN119       74883      67386057
PLN12        39834      50768399
PLN120       71072      68497282
PLN121       43536      51232698
PLN122       70429      70808014
PLN123       62166      78199948
PLN124       61528      82325526
PLN125       37510      35624911
PLN126       69807      72406014
PLN127       63354      76935226
PLN128       66100      77969913
PLN129       39169      53941605
PLN13        38792      63002202
PLN130       59255      85477744
PLN131       57801      84089070
PLN132       61039      81341345
PLN133       57568      77935018
PLN134       50485      91686676
PLN135       51402      91674491
PLN136       62714      82546654
PLN137       5789       88254223
PLN138       9403       170953957
PLN139       81         188747955
PLN14        25631      117600281
PLN140       31330      134371407
PLN141       6          180795696
PLN142       17810      154150030
PLN143       1812       159218244
PLN144       229        188494919
PLN145       1900       143577864
PLN146       4          165102368
PLN147       4482       166172321
PLN148       43486      95954375
PLN15        21200      111005920
PLN16        17546      144588177
PLN17        17595      146020060
PLN18        17540      146083811
PLN19        1473       11877350
PLN2         74359      77718236
PLN20        23259      121287391
PLN21        6071       150261554
PLN22        1195       166515226
PLN23        1478       165896561
PLN24        40         167664829
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21965      107652471
PLN3         36850      104251910
PLN30        66902      69634123
PLN31        29625      31674071
PLN32        76745      76009276
PLN33        36377      41275526
PLN34        57312      72147499
PLN35        28689      28923618
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        280        132296769
PLN4         1374       178896303
PLN40        99         128278470
PLN41        276        130066439
PLN42        162        128507084
PLN43        96         78235858
PLN44        155        127161655
PLN45        140        128498419
PLN46        171        128468478
PLN47        168        134239052
PLN48        201        152936626
PLN49        273        194235260
PLN5         1844       185907969
PLN50        65         46109956
PLN51        272        193886506
PLN52        227        194049434
PLN53        137        175158920
PLN54        5          182400284
PLN55        14         189437622
PLN56        111        163524389
PLN57        56         152076426
PLN58        5          188904320
PLN59        6          174816511
PLN6         1848       194251054
PLN60        33         193402397
PLN61        571        183782887
PLN62        2328       93715621
PLN63        7181       18795412
PLN64        14346      29953091
PLN65        18728      133869997
PLN66        77688      74484298
PLN67        96349      58610732
PLN68        34373      32441944
PLN69        80141      71418727
PLN7         1687       194244196
PLN70        77549      75752419
PLN71        79949      70164290
PLN72        81481      74630799
PLN73        60116      34157612
PLN74        98776      55107411
PLN75        82271      68239069
PLN76        44599      98665547
PLN77        5548       152863845
PLN78        11882      165587691
PLN79        29507      120346017
PLN8         1832       193363296
PLN80        53388      102415894
PLN81        17732      12656832
PLN82        80785      72344014
PLN83        17682      12951951
PLN84        49499      72634826
PLN85        25061      110565816
PLN86        13564      89766260
PLN87        1          774434471
PLN88        8305       28494018
PLN89        1858       148969943
PLN9         48571      107189665
PLN90        2          135217911
PLN91        2          155188403
PLN92        2          140023111
PLN93        2          154604167
PLN94        2          148753627
PLN95        3          173772618
PLN96        3          178836778
PLN97        3          176344173
PLN98        3          195539469
PLN99        12431      129466187
PRI1         23034      59762327
PRI10        1254       178692891
PRI11        865        105120773
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22385      144320815
PRI20        1737       191814810
PRI21        2630       189830893
PRI22        2076       191838079
PRI23        2728       191093809
PRI24        14310      36013904
PRI25        27930      79134981
PRI26        59717      83898737
PRI27        36333      82367491
PRI28        8758       172032991
PRI29        2264       191408780
PRI3         1439       174314309
PRI30        1666       190944985
PRI31        2075       192251373
PRI32        2195       191150383
PRI33        13091      162158571
PRI34        2067       170809233
PRI35        56434      88259866
PRI36        4477       9299641
PRI37        32154      63605650
PRI38        20538      119329276
PRI39        18691      150583407
PRI4         1276       185669146
PRI40        67703      85010878
PRI41        50233      89169807
PRI42        41721      84345041
PRI43        46895      96169090
PRI44        27237      100589780
PRI45        28492      108982747
PRI46        23073      105477066
PRI47        21188      48647314
PRI48        23091      123853411
PRI49        37848      110097486
PRI5         1337       184500937
PRI50        32520      95073513
PRI51        26229      60724224
PRI52        1          229594237
PRI53        1          190673448
PRI54        1          197221778
PRI55        17702      164557105
PRI56        42526      80505616
PRI6         1180       180111971
PRI7         1229       180255349
PRI8         1219       179122541
PRI9         1372       174797659
ROD1         37503      132672337
ROD10        989        181994394
ROD11        312        58991276
ROD12        1034       185475616
ROD13        940        182703335
ROD14        1040       189324025
ROD15        950        180306408
ROD16        967        182057152
ROD17        991        185811349
ROD18        1190       190649663
ROD19        15161      159097939
ROD2         908        176227506
ROD20        20993      153433493
ROD21        1216       193805576
ROD22        1007       158474097
ROD23        15265      168415953
ROD24        37538      68993966
ROD25        20030      114484890
ROD26        1532       193340301
ROD27        150892     18257065
ROD28        75067      78611305
ROD29        83927      53021715
ROD3         910        173109878
ROD30        58884      69412284
ROD4         900        173795989
ROD5         920        174584743
ROD6         965        177316696
ROD7         974        179597759
ROD8         968        181268865
ROD9         1001       181597689
STS1         85269      36754064
STS10        57907      44420409
STS11        48921      37511590
STS12        57924      43637361
STS13        64058      42737902
STS14        93169      34131972
STS15        104293     26506104
STS16        10772      2917144
STS17        103700     27504029
STS18        97622      33595743
STS19        96640      34557490
STS2         84267      49943832
STS20        71165      25112676
STS3         65814      25950758
STS4         77831      37070104
STS5         9074       5318304
STS6         54259      31650966
STS7         54162      31838227
STS8         54316      31957697
STS9         55705      37758824
SYN1         52834      70947325
SYN10        15699      46933217
SYN2         43529      80464814
SYN3         24042      124045322
SYN4         4594       176465653
SYN5         4587       176328465
SYN6         4592       176418315
SYN7         10055      163761060
SYN8         56713      73345318
SYN9         51495      82585261
TSA1         119083     37789268
TSA10        18300      20792149
TSA100       84109      38689281
TSA101       76680      52659255
TSA102       66774      66687697
TSA103       63892      75957536
TSA104       86991      55453747
TSA105       51740      27880810
TSA106       74245      86358066
TSA107       80229      75622518
TSA108       84801      72305810
TSA109       77881      83686531
TSA11        134170     34616677
TSA110       94375      51986778
TSA111       99157      69089270
TSA112       59230      97228833
TSA113       109175     49378845
TSA114       63354      68310026
TSA115       80830      88898180
TSA116       70542      71924922
TSA117       57860      119442120
TSA118       4989       6788692
TSA119       106689     67779914
TSA12        59768      19488440
TSA120       93410      83369889
TSA121       98615      76609458
TSA122       88033      68056906
TSA123       84937      58874659
TSA124       77596      62181659
TSA125       82440      76710835
TSA126       98411      60372500
TSA127       94493      42587561
TSA128       76552      54456374
TSA129       42476      39765869
TSA13        64542      58862448
TSA130       59626      61176103
TSA131       59047      61657426
TSA132       59168      62167042
TSA133       71956      78379950
TSA134       87818      51643326
TSA135       63336      64766777
TSA136       2563       1147163
TSA137       77745      34626570
TSA138       74689      66831444
TSA139       81079      78598444
TSA14        91996      62507406
TSA140       74692      64675647
TSA141       41882      34789042
TSA142       87600      70235611
TSA143       89003      68194525
TSA144       84656      77065314
TSA145       76791      81310397
TSA146       12038      10028761
TSA147       104187     53670971
TSA148       80878      61177338
TSA149       69693      78323809
TSA15        91372      64121244
TSA150       73196      67845845
TSA151       86992      75471245
TSA152       89428      70000229
TSA153       62319      102884821
TSA154       95611      74149955
TSA155       20791      14545229
TSA156       82974      63616708
TSA157       83472      63790182
TSA158       78941      73480275
TSA159       76936      75992422
TSA16        9128       4927184
TSA160       93259      58485302
TSA161       100927     67776776
TSA162       35505      24272476
TSA163       103445     64539230
TSA164       94920      75734700
TSA165       80355      64233867
TSA166       30552      47121787
TSA167       51839      98295419
TSA168       46917      107683976
TSA169       44952      111436512
TSA17        76022      85946159
TSA170       42000      117073120
TSA171       39479      121890914
TSA172       37678      125330444
TSA173       30670      109097872
TSA174       78905      65671407
TSA175       61768      78120260
TSA176       65837      57430512
TSA177       40178      19221061
TSA178       38344      27282958
TSA179       35786      38619991
TSA18        79282      72813963
TSA180       34449      33150587
TSA181       31670      56857624
TSA182       31446      57845848
TSA183       39266      23134620
TSA184       40382      18182813
TSA185       41061      15174943
TSA186       41459      13408377
TSA187       41699      12346210
TSA188       26552      7560175
TSA189       41889      11506042
TSA19        86989      44504472
TSA190       41935      11303163
TSA191       41981      11096976
TSA192       42054      10770114
TSA193       42099      10570948
TSA194       42146      10365212
TSA195       43310      10362437
TSA196       69628      80166526
TSA197       26910      63134534
TSA198       89435      47294686
TSA199       47226      118117513
TSA2         112869     41275558
TSA20        73713      88531920
TSA200       86178      55950179
TSA201       79779      68257786
TSA202       4129       6891513
TSA203       51810      113451337
TSA204       44478      125316911
TSA205       37710      136261228
TSA206       63745      93693139
TSA207       62733      93188032
TSA208       46272      60834700
TSA209       62975      91394238
TSA21        66317      50611440
TSA210       75292      70263885
TSA211       48709      114829937
TSA212       81093      60467913
TSA213       48570      115557813
TSA214       79701      62923086
TSA215       71271      77126499
TSA216       52295      59003911
TSA217       80946      60040947
TSA218       40977      127425221
TSA219       88564      47079213
TSA22        81010      82050811
TSA220       61990      92418969
TSA221       79672      61642103
TSA222       88127      48478546
TSA223       55713      72150571
TSA224       71032      77857062
TSA225       68846      81288967
TSA226       85630      49828768
TSA227       66592      82370296
TSA228       91286      39468744
TSA229       62647      88850855
TSA23        62985      84306912
TSA230       51927      26167229
TSA24        84181      72787897
TSA25        99576      53554958
TSA26        62468      19072636
TSA27        85797      70106183
TSA28        120080     38852195
TSA29        135076     34048893
TSA3         109734     40829934
TSA30        52645      68403499
TSA31        47703      62725162
TSA32        2553       4328254
TSA33        60999      81852793
TSA34        93057      67088413
TSA35        109462     50198029
TSA36        106063     49698912
TSA37        101827     53965176
TSA38        104090     48094179
TSA39        24792      15630613
TSA4         110501     47448210
TSA40        66196      59263779
TSA41        92196      67722853
TSA42        92655      62163067
TSA43        80015      85986735
TSA44        99477      49894572
TSA45        113589     34208477
TSA46        95196      67511573
TSA47        13750      8571985
TSA48        94376      35380174
TSA49        77496      35938873
TSA5         78287      23622128
TSA50        106331     43405855
TSA51        113836     45499687
TSA52        29689      20438208
TSA53        103698     51338286
TSA54        101105     54210094
TSA55        97800      59154259
TSA56        81481      86126685
TSA57        69638      30922650
TSA58        90384      71308401
TSA59        97533      54431384
TSA6         111597     58983147
TSA60        60134      105510191
TSA61        86906      65105824
TSA62        78642      70611672
TSA63        83071      72200117
TSA64        82788      72062655
TSA65        68928      90836785
TSA66        90700      66690213
TSA67        75912      84453478
TSA68        71901      73253892
TSA69        68803      60800732
TSA7         87422      57902459
TSA70        84871      78037306
TSA71        85120      77966877
TSA72        70349      97897448
TSA73        85576      69690202
TSA74        85010      51571050
TSA75        102429     68721771
TSA76        87413      59050295
TSA77        103675     57047705
TSA78        73595      72842551
TSA79        78548      44480601
TSA8         104453     72519280
TSA80        87348      79224218
TSA81        91720      69212644
TSA82        78369      53162346
TSA83        78406      56943880
TSA84        97316      60085378
TSA85        38910      36143127
TSA86        88948      76782378
TSA87        95034      55397472
TSA88        110915     44811175
TSA89        97306      57970666
TSA9         109481     60972019
TSA90        65140      97031134
TSA91        15357      14810180
TSA92        101299     55496095
TSA93        91074      53959118
TSA94        93807      43529343
TSA95        85650      73899579
TSA96        73232      72091377
TSA97        40015      46848652
TSA98        77159      80203977
TSA99        77312      55431136
UNA1         334        209439
VRL1         64905      70780737
VRL10        43229      72883414
VRL11        43117      72988572
VRL12        62283      72175376
VRL13        69192      65751601
VRL14        61239      72857828
VRL15        26391      36945189
VRL16        62732      70795480
VRL17        57073      72677650
VRL18        63478      63545511
VRL19        57003      73286513
VRL2         66359      66527832
VRL20        52520      66788908
VRL21        54644      72257272
VRL22        58250      71171169
VRL23        55971      73239126
VRL24        55163      73758164
VRL25        28898      46630983
VRL26        52047      74784613
VRL27        37901      81591920
VRL28        47388      75065544
VRL29        48219      73981437
VRL3         70112      63543039
VRL30        48900      76415586
VRL31        13956      25863451
VRL32        49427      77631991
VRL33        42127      87335007
VRL34        41697      82763476
VRL35        48488      79765746
VRL36        37777      86214216
VRL37        5535       16032274
VRL38        37753      90562787
VRL39        45298      80769228
VRL4         68045      65174898
VRL40        45691      78577419
VRL41        43042      84036671
VRL42        44682      75942060
VRL43        40116      84919398
VRL44        39786      82420530
VRL45        43001      82217819
VRL46        32218      89484450
VRL47        44286      85816675
VRL48        50300      86063208
VRL49        6196       4640572
VRL5         68678      68748676
VRL6         19763      24882159
VRL7         47936      77148735
VRL8         46495      71634496
VRL9         43814      71160830
VRT1         67692      78174145
VRT10        1319       193297450
VRT11        8963       180814244
VRT12        3138       102269796
VRT13        13369      172251922
VRT14        5825       185117490
VRT15        3795       188803260
VRT16        49449      115674913
VRT17        79233      69218997
VRT18        77241      66384369
VRT19        20265      15014166
VRT2         2100       192805226
VRT20        71597      76198558
VRT21        44682      123261113
VRT22        77123      63348829
VRT23        79212      62101999
VRT24        81622      58047047
VRT25        35912      24790654
VRT26        102766     66105706
VRT27        81115      56348580
VRT28        85588      58022764
VRT29        62986      47287466
VRT3         47703      121505101
VRT30        90667      54055096
VRT31        76028      57807134
VRT32        8982       7584443
VRT33        74773      58270406
VRT34        56339      45468756
VRT35        80922      56797643
VRT36        75082      59369642
VRT37        78231      59518603
VRT38        56288      22354283
VRT39        109800     52936793
VRT4         25122      147983901
VRT40        76988      66370927
VRT41        47725      25855713
VRT42        89063      53813925
VRT43        83359      55766424
VRT44        68801      83248389
VRT45        50         179974623
VRT46        67         189797372
VRT47        98         192889703
VRT48        255        183465989
VRT49        465        183664700
VRT5         39301      104026174
VRT50        1233       190360138
VRT51        9520       184763260
VRT52        84085      77344243
VRT53        177067     28429798
VRT54        53955      90444098
VRT55        3242       189215331
VRT56        9          178794778
VRT57        10         196480447
VRT58        11         184541365
VRT59        28         196498040
VRT6         72853      66444508
VRT60        389        196385145
VRT61        1315       195608731
VRT62        2566       194640733
VRT63        3378       193090756
VRT64        23420      79992728
VRT7         31811      63611074
VRT8         30162      115609108
VRT9         1265       193453095

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 220.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

24268240 18911109794   Homo sapiens
9884464  10230159530   Mus musculus
2197853   6529056715   Rattus norvegicus
2229496   5429710224   Bos taurus
4198099   5227203246   Zea mays
3299424   5072301470   Sus scrofa
1346802   3235943621   Hordeum vulgare subsp. vulgare
1729059   3191003498   Danio rerio
72        2590574434   Ovis canadensis canadensis
1812940   1943716555   Triticum aestivum
205373    1836506360   Cyprinus carpio
745983    1746422207   Solanum lycopersicum
118972    1712523465   Escherichia coli
1378324   1642527191   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
258052    1436154042   Strongylocentrotus purpuratus
463427    1337088680   Macaca mulatta
490332    1264448364   Spirometra erinaceieuropaei
1588051   1250004640   Xenopus tropicalis
2583352   1212405447   Arabidopsis thaliana

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568

  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          June 15 2017

                NCBI-GenBank Flat File Release 220.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Clark, K. et al, Nucleic Acids Res. 44(D1), D67-72 (2016)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Michael Kornbluh, Jim Ostell, Vasuki Palanigobu,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Kamen Todorov, Eugene Yaschenko,
	Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	David Lipman


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center