Release Notes For GenBank Release 221

GBREL.TXT          Genetic Sequence Data Bank
                         August 15 2017

               NCBI-GenBank Flat File Release 221.0

                    Distribution Release Notes

 203180606 loci, 240343378258 bases, from 203180606 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA
   Phone:  (301) 496-2475
   Fax:    (301) 480-9241

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 221.0
1.2 Cutoff Date
1.3 Important Changes in Release 221.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 221.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 221.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Molecular Biology Laboratory (EMBL) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

A mirror of NCBI's GenBank FTP site is available at Indiana University,
courtesy of the Bio-Mirror project:

	ftp://bio-mirror.net/biomirror/genbank/

Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from this alternate site when the volume
of traffic at the NCBI is high. For a list of other Bio-Mirror nodes, visit:

	http://www.bio-mirror.net/

1.2 Cutoff Date

  This full release, 221.0, incorporates data processed by the INSDC databases
as of Sunday August 13 2017 at approximately 1:33AM EDT. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 221.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 45 with this release:

  - the BCT division is now composed of 391 files (+21)
  - the CON division is now composed of 359 files (-4)
  - the INV division is now composed of 155 files (+1)
  - the PAT division is now composed of 294 files (+3)
  - the PLN division is now composed of 150 files (+2)
  - the PRI division is now composed of  57 files (+1)
  - the TSA division is now composed of 234 files (+4)
  - the VRL division is now composed of  50 files (+1)
  - the VRT division is now composed of  80 files (+16)
  
  The decrease in the number of CON files is due to the removal of GI
  sequence identifiers on the VERSION and COMMENT lines of the GenBank
  flatfile format.

1.3.3 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 221.0. Consider gbgss175.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                          August 15 2017

                NCBI-GenBank Flat File Release 221.0

                           GSS Sequences (Part 1)

   87375 loci,    64103840 bases, from    87375 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "175" based on the number of files dumped from the other
system. Files gbgss175.seq.gz through gbgss304.seq.gz are affected. We hope
to resolve this discrepancy at some point, but the priority is certainly
much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 No changes impacting GenBank Release content are currently planned.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the EMBL and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the EMBL and DDBJ databases.
BankIt may be used with Netscape, Internet Explorer, and other common
WWW clients. You can access BankIt from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov or 301-496-2475.

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2932 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct4.seq - Bacterial sequence entries, part 4.
327. gbbct40.seq - Bacterial sequence entries, part 40.
328. gbbct41.seq - Bacterial sequence entries, part 41.
329. gbbct42.seq - Bacterial sequence entries, part 42.
330. gbbct43.seq - Bacterial sequence entries, part 43.
331. gbbct44.seq - Bacterial sequence entries, part 44.
332. gbbct45.seq - Bacterial sequence entries, part 45.
333. gbbct46.seq - Bacterial sequence entries, part 46.
334. gbbct47.seq - Bacterial sequence entries, part 47.
335. gbbct48.seq - Bacterial sequence entries, part 48.
336. gbbct49.seq - Bacterial sequence entries, part 49.
337. gbbct5.seq - Bacterial sequence entries, part 5.
338. gbbct50.seq - Bacterial sequence entries, part 50.
339. gbbct51.seq - Bacterial sequence entries, part 51.
340. gbbct52.seq - Bacterial sequence entries, part 52.
341. gbbct53.seq - Bacterial sequence entries, part 53.
342. gbbct54.seq - Bacterial sequence entries, part 54.
343. gbbct55.seq - Bacterial sequence entries, part 55.
344. gbbct56.seq - Bacterial sequence entries, part 56.
345. gbbct57.seq - Bacterial sequence entries, part 57.
346. gbbct58.seq - Bacterial sequence entries, part 58.
347. gbbct59.seq - Bacterial sequence entries, part 59.
348. gbbct6.seq - Bacterial sequence entries, part 6.
349. gbbct60.seq - Bacterial sequence entries, part 60.
350. gbbct61.seq - Bacterial sequence entries, part 61.
351. gbbct62.seq - Bacterial sequence entries, part 62.
352. gbbct63.seq - Bacterial sequence entries, part 63.
353. gbbct64.seq - Bacterial sequence entries, part 64.
354. gbbct65.seq - Bacterial sequence entries, part 65.
355. gbbct66.seq - Bacterial sequence entries, part 66.
356. gbbct67.seq - Bacterial sequence entries, part 67.
357. gbbct68.seq - Bacterial sequence entries, part 68.
358. gbbct69.seq - Bacterial sequence entries, part 69.
359. gbbct7.seq - Bacterial sequence entries, part 7.
360. gbbct70.seq - Bacterial sequence entries, part 70.
361. gbbct71.seq - Bacterial sequence entries, part 71.
362. gbbct72.seq - Bacterial sequence entries, part 72.
363. gbbct73.seq - Bacterial sequence entries, part 73.
364. gbbct74.seq - Bacterial sequence entries, part 74.
365. gbbct75.seq - Bacterial sequence entries, part 75.
366. gbbct76.seq - Bacterial sequence entries, part 76.
367. gbbct77.seq - Bacterial sequence entries, part 77.
368. gbbct78.seq - Bacterial sequence entries, part 78.
369. gbbct79.seq - Bacterial sequence entries, part 79.
370. gbbct8.seq - Bacterial sequence entries, part 8.
371. gbbct80.seq - Bacterial sequence entries, part 80.
372. gbbct81.seq - Bacterial sequence entries, part 81.
373. gbbct82.seq - Bacterial sequence entries, part 82.
374. gbbct83.seq - Bacterial sequence entries, part 83.
375. gbbct84.seq - Bacterial sequence entries, part 84.
376. gbbct85.seq - Bacterial sequence entries, part 85.
377. gbbct86.seq - Bacterial sequence entries, part 86.
378. gbbct87.seq - Bacterial sequence entries, part 87.
379. gbbct88.seq - Bacterial sequence entries, part 88.
380. gbbct89.seq - Bacterial sequence entries, part 89.
381. gbbct9.seq - Bacterial sequence entries, part 9.
382. gbbct90.seq - Bacterial sequence entries, part 90.
383. gbbct91.seq - Bacterial sequence entries, part 91.
384. gbbct92.seq - Bacterial sequence entries, part 92.
385. gbbct93.seq - Bacterial sequence entries, part 93.
386. gbbct94.seq - Bacterial sequence entries, part 94.
387. gbbct95.seq - Bacterial sequence entries, part 95.
388. gbbct96.seq - Bacterial sequence entries, part 96.
389. gbbct97.seq - Bacterial sequence entries, part 97.
390. gbbct98.seq - Bacterial sequence entries, part 98.
391. gbbct99.seq - Bacterial sequence entries, part 99.
392. gbchg.txt - Accession numbers of entries updated since the previous release.
393. gbcon1.seq - Constructed sequence entries, part 1.
394. gbcon10.seq - Constructed sequence entries, part 10.
395. gbcon100.seq - Constructed sequence entries, part 100.
396. gbcon101.seq - Constructed sequence entries, part 101.
397. gbcon102.seq - Constructed sequence entries, part 102.
398. gbcon103.seq - Constructed sequence entries, part 103.
399. gbcon104.seq - Constructed sequence entries, part 104.
400. gbcon105.seq - Constructed sequence entries, part 105.
401. gbcon106.seq - Constructed sequence entries, part 106.
402. gbcon107.seq - Constructed sequence entries, part 107.
403. gbcon108.seq - Constructed sequence entries, part 108.
404. gbcon109.seq - Constructed sequence entries, part 109.
405. gbcon11.seq - Constructed sequence entries, part 11.
406. gbcon110.seq - Constructed sequence entries, part 110.
407. gbcon111.seq - Constructed sequence entries, part 111.
408. gbcon112.seq - Constructed sequence entries, part 112.
409. gbcon113.seq - Constructed sequence entries, part 113.
410. gbcon114.seq - Constructed sequence entries, part 114.
411. gbcon115.seq - Constructed sequence entries, part 115.
412. gbcon116.seq - Constructed sequence entries, part 116.
413. gbcon117.seq - Constructed sequence entries, part 117.
414. gbcon118.seq - Constructed sequence entries, part 118.
415. gbcon119.seq - Constructed sequence entries, part 119.
416. gbcon12.seq - Constructed sequence entries, part 12.
417. gbcon120.seq - Constructed sequence entries, part 120.
418. gbcon121.seq - Constructed sequence entries, part 121.
419. gbcon122.seq - Constructed sequence entries, part 122.
420. gbcon123.seq - Constructed sequence entries, part 123.
421. gbcon124.seq - Constructed sequence entries, part 124.
422. gbcon125.seq - Constructed sequence entries, part 125.
423. gbcon126.seq - Constructed sequence entries, part 126.
424. gbcon127.seq - Constructed sequence entries, part 127.
425. gbcon128.seq - Constructed sequence entries, part 128.
426. gbcon129.seq - Constructed sequence entries, part 129.
427. gbcon13.seq - Constructed sequence entries, part 13.
428. gbcon130.seq - Constructed sequence entries, part 130.
429. gbcon131.seq - Constructed sequence entries, part 131.
430. gbcon132.seq - Constructed sequence entries, part 132.
431. gbcon133.seq - Constructed sequence entries, part 133.
432. gbcon134.seq - Constructed sequence entries, part 134.
433. gbcon135.seq - Constructed sequence entries, part 135.
434. gbcon136.seq - Constructed sequence entries, part 136.
435. gbcon137.seq - Constructed sequence entries, part 137.
436. gbcon138.seq - Constructed sequence entries, part 138.
437. gbcon139.seq - Constructed sequence entries, part 139.
438. gbcon14.seq - Constructed sequence entries, part 14.
439. gbcon140.seq - Constructed sequence entries, part 140.
440. gbcon141.seq - Constructed sequence entries, part 141.
441. gbcon142.seq - Constructed sequence entries, part 142.
442. gbcon143.seq - Constructed sequence entries, part 143.
443. gbcon144.seq - Constructed sequence entries, part 144.
444. gbcon145.seq - Constructed sequence entries, part 145.
445. gbcon146.seq - Constructed sequence entries, part 146.
446. gbcon147.seq - Constructed sequence entries, part 147.
447. gbcon148.seq - Constructed sequence entries, part 148.
448. gbcon149.seq - Constructed sequence entries, part 149.
449. gbcon15.seq - Constructed sequence entries, part 15.
450. gbcon150.seq - Constructed sequence entries, part 150.
451. gbcon151.seq - Constructed sequence entries, part 151.
452. gbcon152.seq - Constructed sequence entries, part 152.
453. gbcon153.seq - Constructed sequence entries, part 153.
454. gbcon154.seq - Constructed sequence entries, part 154.
455. gbcon155.seq - Constructed sequence entries, part 155.
456. gbcon156.seq - Constructed sequence entries, part 156.
457. gbcon157.seq - Constructed sequence entries, part 157.
458. gbcon158.seq - Constructed sequence entries, part 158.
459. gbcon159.seq - Constructed sequence entries, part 159.
460. gbcon16.seq - Constructed sequence entries, part 16.
461. gbcon160.seq - Constructed sequence entries, part 160.
462. gbcon161.seq - Constructed sequence entries, part 161.
463. gbcon162.seq - Constructed sequence entries, part 162.
464. gbcon163.seq - Constructed sequence entries, part 163.
465. gbcon164.seq - Constructed sequence entries, part 164.
466. gbcon165.seq - Constructed sequence entries, part 165.
467. gbcon166.seq - Constructed sequence entries, part 166.
468. gbcon167.seq - Constructed sequence entries, part 167.
469. gbcon168.seq - Constructed sequence entries, part 168.
470. gbcon169.seq - Constructed sequence entries, part 169.
471. gbcon17.seq - Constructed sequence entries, part 17.
472. gbcon170.seq - Constructed sequence entries, part 170.
473. gbcon171.seq - Constructed sequence entries, part 171.
474. gbcon172.seq - Constructed sequence entries, part 172.
475. gbcon173.seq - Constructed sequence entries, part 173.
476. gbcon174.seq - Constructed sequence entries, part 174.
477. gbcon175.seq - Constructed sequence entries, part 175.
478. gbcon176.seq - Constructed sequence entries, part 176.
479. gbcon177.seq - Constructed sequence entries, part 177.
480. gbcon178.seq - Constructed sequence entries, part 178.
481. gbcon179.seq - Constructed sequence entries, part 179.
482. gbcon18.seq - Constructed sequence entries, part 18.
483. gbcon180.seq - Constructed sequence entries, part 180.
484. gbcon181.seq - Constructed sequence entries, part 181.
485. gbcon182.seq - Constructed sequence entries, part 182.
486. gbcon183.seq - Constructed sequence entries, part 183.
487. gbcon184.seq - Constructed sequence entries, part 184.
488. gbcon185.seq - Constructed sequence entries, part 185.
489. gbcon186.seq - Constructed sequence entries, part 186.
490. gbcon187.seq - Constructed sequence entries, part 187.
491. gbcon188.seq - Constructed sequence entries, part 188.
492. gbcon189.seq - Constructed sequence entries, part 189.
493. gbcon19.seq - Constructed sequence entries, part 19.
494. gbcon190.seq - Constructed sequence entries, part 190.
495. gbcon191.seq - Constructed sequence entries, part 191.
496. gbcon192.seq - Constructed sequence entries, part 192.
497. gbcon193.seq - Constructed sequence entries, part 193.
498. gbcon194.seq - Constructed sequence entries, part 194.
499. gbcon195.seq - Constructed sequence entries, part 195.
500. gbcon196.seq - Constructed sequence entries, part 196.
501. gbcon197.seq - Constructed sequence entries, part 197.
502. gbcon198.seq - Constructed sequence entries, part 198.
503. gbcon199.seq - Constructed sequence entries, part 199.
504. gbcon2.seq - Constructed sequence entries, part 2.
505. gbcon20.seq - Constructed sequence entries, part 20.
506. gbcon200.seq - Constructed sequence entries, part 200.
507. gbcon201.seq - Constructed sequence entries, part 201.
508. gbcon202.seq - Constructed sequence entries, part 202.
509. gbcon203.seq - Constructed sequence entries, part 203.
510. gbcon204.seq - Constructed sequence entries, part 204.
511. gbcon205.seq - Constructed sequence entries, part 205.
512. gbcon206.seq - Constructed sequence entries, part 206.
513. gbcon207.seq - Constructed sequence entries, part 207.
514. gbcon208.seq - Constructed sequence entries, part 208.
515. gbcon209.seq - Constructed sequence entries, part 209.
516. gbcon21.seq - Constructed sequence entries, part 21.
517. gbcon210.seq - Constructed sequence entries, part 210.
518. gbcon211.seq - Constructed sequence entries, part 211.
519. gbcon212.seq - Constructed sequence entries, part 212.
520. gbcon213.seq - Constructed sequence entries, part 213.
521. gbcon214.seq - Constructed sequence entries, part 214.
522. gbcon215.seq - Constructed sequence entries, part 215.
523. gbcon216.seq - Constructed sequence entries, part 216.
524. gbcon217.seq - Constructed sequence entries, part 217.
525. gbcon218.seq - Constructed sequence entries, part 218.
526. gbcon219.seq - Constructed sequence entries, part 219.
527. gbcon22.seq - Constructed sequence entries, part 22.
528. gbcon220.seq - Constructed sequence entries, part 220.
529. gbcon221.seq - Constructed sequence entries, part 221.
530. gbcon222.seq - Constructed sequence entries, part 222.
531. gbcon223.seq - Constructed sequence entries, part 223.
532. gbcon224.seq - Constructed sequence entries, part 224.
533. gbcon225.seq - Constructed sequence entries, part 225.
534. gbcon226.seq - Constructed sequence entries, part 226.
535. gbcon227.seq - Constructed sequence entries, part 227.
536. gbcon228.seq - Constructed sequence entries, part 228.
537. gbcon229.seq - Constructed sequence entries, part 229.
538. gbcon23.seq - Constructed sequence entries, part 23.
539. gbcon230.seq - Constructed sequence entries, part 230.
540. gbcon231.seq - Constructed sequence entries, part 231.
541. gbcon232.seq - Constructed sequence entries, part 232.
542. gbcon233.seq - Constructed sequence entries, part 233.
543. gbcon234.seq - Constructed sequence entries, part 234.
544. gbcon235.seq - Constructed sequence entries, part 235.
545. gbcon236.seq - Constructed sequence entries, part 236.
546. gbcon237.seq - Constructed sequence entries, part 237.
547. gbcon238.seq - Constructed sequence entries, part 238.
548. gbcon239.seq - Constructed sequence entries, part 239.
549. gbcon24.seq - Constructed sequence entries, part 24.
550. gbcon240.seq - Constructed sequence entries, part 240.
551. gbcon241.seq - Constructed sequence entries, part 241.
552. gbcon242.seq - Constructed sequence entries, part 242.
553. gbcon243.seq - Constructed sequence entries, part 243.
554. gbcon244.seq - Constructed sequence entries, part 244.
555. gbcon245.seq - Constructed sequence entries, part 245.
556. gbcon246.seq - Constructed sequence entries, part 246.
557. gbcon247.seq - Constructed sequence entries, part 247.
558. gbcon248.seq - Constructed sequence entries, part 248.
559. gbcon249.seq - Constructed sequence entries, part 249.
560. gbcon25.seq - Constructed sequence entries, part 25.
561. gbcon250.seq - Constructed sequence entries, part 250.
562. gbcon251.seq - Constructed sequence entries, part 251.
563. gbcon252.seq - Constructed sequence entries, part 252.
564. gbcon253.seq - Constructed sequence entries, part 253.
565. gbcon254.seq - Constructed sequence entries, part 254.
566. gbcon255.seq - Constructed sequence entries, part 255.
567. gbcon256.seq - Constructed sequence entries, part 256.
568. gbcon257.seq - Constructed sequence entries, part 257.
569. gbcon258.seq - Constructed sequence entries, part 258.
570. gbcon259.seq - Constructed sequence entries, part 259.
571. gbcon26.seq - Constructed sequence entries, part 26.
572. gbcon260.seq - Constructed sequence entries, part 260.
573. gbcon261.seq - Constructed sequence entries, part 261.
574. gbcon262.seq - Constructed sequence entries, part 262.
575. gbcon263.seq - Constructed sequence entries, part 263.
576. gbcon264.seq - Constructed sequence entries, part 264.
577. gbcon265.seq - Constructed sequence entries, part 265.
578. gbcon266.seq - Constructed sequence entries, part 266.
579. gbcon267.seq - Constructed sequence entries, part 267.
580. gbcon268.seq - Constructed sequence entries, part 268.
581. gbcon269.seq - Constructed sequence entries, part 269.
582. gbcon27.seq - Constructed sequence entries, part 27.
583. gbcon270.seq - Constructed sequence entries, part 270.
584. gbcon271.seq - Constructed sequence entries, part 271.
585. gbcon272.seq - Constructed sequence entries, part 272.
586. gbcon273.seq - Constructed sequence entries, part 273.
587. gbcon274.seq - Constructed sequence entries, part 274.
588. gbcon275.seq - Constructed sequence entries, part 275.
589. gbcon276.seq - Constructed sequence entries, part 276.
590. gbcon277.seq - Constructed sequence entries, part 277.
591. gbcon278.seq - Constructed sequence entries, part 278.
592. gbcon279.seq - Constructed sequence entries, part 279.
593. gbcon28.seq - Constructed sequence entries, part 28.
594. gbcon280.seq - Constructed sequence entries, part 280.
595. gbcon281.seq - Constructed sequence entries, part 281.
596. gbcon282.seq - Constructed sequence entries, part 282.
597. gbcon283.seq - Constructed sequence entries, part 283.
598. gbcon284.seq - Constructed sequence entries, part 284.
599. gbcon285.seq - Constructed sequence entries, part 285.
600. gbcon286.seq - Constructed sequence entries, part 286.
601. gbcon287.seq - Constructed sequence entries, part 287.
602. gbcon288.seq - Constructed sequence entries, part 288.
603. gbcon289.seq - Constructed sequence entries, part 289.
604. gbcon29.seq - Constructed sequence entries, part 29.
605. gbcon290.seq - Constructed sequence entries, part 290.
606. gbcon291.seq - Constructed sequence entries, part 291.
607. gbcon292.seq - Constructed sequence entries, part 292.
608. gbcon293.seq - Constructed sequence entries, part 293.
609. gbcon294.seq - Constructed sequence entries, part 294.
610. gbcon295.seq - Constructed sequence entries, part 295.
611. gbcon296.seq - Constructed sequence entries, part 296.
612. gbcon297.seq - Constructed sequence entries, part 297.
613. gbcon298.seq - Constructed sequence entries, part 298.
614. gbcon299.seq - Constructed sequence entries, part 299.
615. gbcon3.seq - Constructed sequence entries, part 3.
616. gbcon30.seq - Constructed sequence entries, part 30.
617. gbcon300.seq - Constructed sequence entries, part 300.
618. gbcon301.seq - Constructed sequence entries, part 301.
619. gbcon302.seq - Constructed sequence entries, part 302.
620. gbcon303.seq - Constructed sequence entries, part 303.
621. gbcon304.seq - Constructed sequence entries, part 304.
622. gbcon305.seq - Constructed sequence entries, part 305.
623. gbcon306.seq - Constructed sequence entries, part 306.
624. gbcon307.seq - Constructed sequence entries, part 307.
625. gbcon308.seq - Constructed sequence entries, part 308.
626. gbcon309.seq - Constructed sequence entries, part 309.
627. gbcon31.seq - Constructed sequence entries, part 31.
628. gbcon310.seq - Constructed sequence entries, part 310.
629. gbcon311.seq - Constructed sequence entries, part 311.
630. gbcon312.seq - Constructed sequence entries, part 312.
631. gbcon313.seq - Constructed sequence entries, part 313.
632. gbcon314.seq - Constructed sequence entries, part 314.
633. gbcon315.seq - Constructed sequence entries, part 315.
634. gbcon316.seq - Constructed sequence entries, part 316.
635. gbcon317.seq - Constructed sequence entries, part 317.
636. gbcon318.seq - Constructed sequence entries, part 318.
637. gbcon319.seq - Constructed sequence entries, part 319.
638. gbcon32.seq - Constructed sequence entries, part 32.
639. gbcon320.seq - Constructed sequence entries, part 320.
640. gbcon321.seq - Constructed sequence entries, part 321.
641. gbcon322.seq - Constructed sequence entries, part 322.
642. gbcon323.seq - Constructed sequence entries, part 323.
643. gbcon324.seq - Constructed sequence entries, part 324.
644. gbcon325.seq - Constructed sequence entries, part 325.
645. gbcon326.seq - Constructed sequence entries, part 326.
646. gbcon327.seq - Constructed sequence entries, part 327.
647. gbcon328.seq - Constructed sequence entries, part 328.
648. gbcon329.seq - Constructed sequence entries, part 329.
649. gbcon33.seq - Constructed sequence entries, part 33.
650. gbcon330.seq - Constructed sequence entries, part 330.
651. gbcon331.seq - Constructed sequence entries, part 331.
652. gbcon332.seq - Constructed sequence entries, part 332.
653. gbcon333.seq - Constructed sequence entries, part 333.
654. gbcon334.seq - Constructed sequence entries, part 334.
655. gbcon335.seq - Constructed sequence entries, part 335.
656. gbcon336.seq - Constructed sequence entries, part 336.
657. gbcon337.seq - Constructed sequence entries, part 337.
658. gbcon338.seq - Constructed sequence entries, part 338.
659. gbcon339.seq - Constructed sequence entries, part 339.
660. gbcon34.seq - Constructed sequence entries, part 34.
661. gbcon340.seq - Constructed sequence entries, part 340.
662. gbcon341.seq - Constructed sequence entries, part 341.
663. gbcon342.seq - Constructed sequence entries, part 342.
664. gbcon343.seq - Constructed sequence entries, part 343.
665. gbcon344.seq - Constructed sequence entries, part 344.
666. gbcon345.seq - Constructed sequence entries, part 345.
667. gbcon346.seq - Constructed sequence entries, part 346.
668. gbcon347.seq - Constructed sequence entries, part 347.
669. gbcon348.seq - Constructed sequence entries, part 348.
670. gbcon349.seq - Constructed sequence entries, part 349.
671. gbcon35.seq - Constructed sequence entries, part 35.
672. gbcon350.seq - Constructed sequence entries, part 350.
673. gbcon351.seq - Constructed sequence entries, part 351.
674. gbcon352.seq - Constructed sequence entries, part 352.
675. gbcon353.seq - Constructed sequence entries, part 353.
676. gbcon354.seq - Constructed sequence entries, part 354.
677. gbcon355.seq - Constructed sequence entries, part 355.
678. gbcon356.seq - Constructed sequence entries, part 356.
679. gbcon357.seq - Constructed sequence entries, part 357.
680. gbcon358.seq - Constructed sequence entries, part 358.
681. gbcon359.seq - Constructed sequence entries, part 359.
682. gbcon36.seq - Constructed sequence entries, part 36.
683. gbcon37.seq - Constructed sequence entries, part 37.
684. gbcon38.seq - Constructed sequence entries, part 38.
685. gbcon39.seq - Constructed sequence entries, part 39.
686. gbcon4.seq - Constructed sequence entries, part 4.
687. gbcon40.seq - Constructed sequence entries, part 40.
688. gbcon41.seq - Constructed sequence entries, part 41.
689. gbcon42.seq - Constructed sequence entries, part 42.
690. gbcon43.seq - Constructed sequence entries, part 43.
691. gbcon44.seq - Constructed sequence entries, part 44.
692. gbcon45.seq - Constructed sequence entries, part 45.
693. gbcon46.seq - Constructed sequence entries, part 46.
694. gbcon47.seq - Constructed sequence entries, part 47.
695. gbcon48.seq - Constructed sequence entries, part 48.
696. gbcon49.seq - Constructed sequence entries, part 49.
697. gbcon5.seq - Constructed sequence entries, part 5.
698. gbcon50.seq - Constructed sequence entries, part 50.
699. gbcon51.seq - Constructed sequence entries, part 51.
700. gbcon52.seq - Constructed sequence entries, part 52.
701. gbcon53.seq - Constructed sequence entries, part 53.
702. gbcon54.seq - Constructed sequence entries, part 54.
703. gbcon55.seq - Constructed sequence entries, part 55.
704. gbcon56.seq - Constructed sequence entries, part 56.
705. gbcon57.seq - Constructed sequence entries, part 57.
706. gbcon58.seq - Constructed sequence entries, part 58.
707. gbcon59.seq - Constructed sequence entries, part 59.
708. gbcon6.seq - Constructed sequence entries, part 6.
709. gbcon60.seq - Constructed sequence entries, part 60.
710. gbcon61.seq - Constructed sequence entries, part 61.
711. gbcon62.seq - Constructed sequence entries, part 62.
712. gbcon63.seq - Constructed sequence entries, part 63.
713. gbcon64.seq - Constructed sequence entries, part 64.
714. gbcon65.seq - Constructed sequence entries, part 65.
715. gbcon66.seq - Constructed sequence entries, part 66.
716. gbcon67.seq - Constructed sequence entries, part 67.
717. gbcon68.seq - Constructed sequence entries, part 68.
718. gbcon69.seq - Constructed sequence entries, part 69.
719. gbcon7.seq - Constructed sequence entries, part 7.
720. gbcon70.seq - Constructed sequence entries, part 70.
721. gbcon71.seq - Constructed sequence entries, part 71.
722. gbcon72.seq - Constructed sequence entries, part 72.
723. gbcon73.seq - Constructed sequence entries, part 73.
724. gbcon74.seq - Constructed sequence entries, part 74.
725. gbcon75.seq - Constructed sequence entries, part 75.
726. gbcon76.seq - Constructed sequence entries, part 76.
727. gbcon77.seq - Constructed sequence entries, part 77.
728. gbcon78.seq - Constructed sequence entries, part 78.
729. gbcon79.seq - Constructed sequence entries, part 79.
730. gbcon8.seq - Constructed sequence entries, part 8.
731. gbcon80.seq - Constructed sequence entries, part 80.
732. gbcon81.seq - Constructed sequence entries, part 81.
733. gbcon82.seq - Constructed sequence entries, part 82.
734. gbcon83.seq - Constructed sequence entries, part 83.
735. gbcon84.seq - Constructed sequence entries, part 84.
736. gbcon85.seq - Constructed sequence entries, part 85.
737. gbcon86.seq - Constructed sequence entries, part 86.
738. gbcon87.seq - Constructed sequence entries, part 87.
739. gbcon88.seq - Constructed sequence entries, part 88.
740. gbcon89.seq - Constructed sequence entries, part 89.
741. gbcon9.seq - Constructed sequence entries, part 9.
742. gbcon90.seq - Constructed sequence entries, part 90.
743. gbcon91.seq - Constructed sequence entries, part 91.
744. gbcon92.seq - Constructed sequence entries, part 92.
745. gbcon93.seq - Constructed sequence entries, part 93.
746. gbcon94.seq - Constructed sequence entries, part 94.
747. gbcon95.seq - Constructed sequence entries, part 95.
748. gbcon96.seq - Constructed sequence entries, part 96.
749. gbcon97.seq - Constructed sequence entries, part 97.
750. gbcon98.seq - Constructed sequence entries, part 98.
751. gbcon99.seq - Constructed sequence entries, part 99.
752. gbdel.txt - Accession numbers of entries deleted since the previous release.
753. gbenv1.seq - Environmental sampling sequence entries, part 1.
754. gbenv10.seq - Environmental sampling sequence entries, part 10.
755. gbenv11.seq - Environmental sampling sequence entries, part 11.
756. gbenv12.seq - Environmental sampling sequence entries, part 12.
757. gbenv13.seq - Environmental sampling sequence entries, part 13.
758. gbenv14.seq - Environmental sampling sequence entries, part 14.
759. gbenv15.seq - Environmental sampling sequence entries, part 15.
760. gbenv16.seq - Environmental sampling sequence entries, part 16.
761. gbenv17.seq - Environmental sampling sequence entries, part 17.
762. gbenv18.seq - Environmental sampling sequence entries, part 18.
763. gbenv19.seq - Environmental sampling sequence entries, part 19.
764. gbenv2.seq - Environmental sampling sequence entries, part 2.
765. gbenv20.seq - Environmental sampling sequence entries, part 20.
766. gbenv21.seq - Environmental sampling sequence entries, part 21.
767. gbenv22.seq - Environmental sampling sequence entries, part 22.
768. gbenv23.seq - Environmental sampling sequence entries, part 23.
769. gbenv24.seq - Environmental sampling sequence entries, part 24.
770. gbenv25.seq - Environmental sampling sequence entries, part 25.
771. gbenv26.seq - Environmental sampling sequence entries, part 26.
772. gbenv27.seq - Environmental sampling sequence entries, part 27.
773. gbenv28.seq - Environmental sampling sequence entries, part 28.
774. gbenv29.seq - Environmental sampling sequence entries, part 29.
775. gbenv3.seq - Environmental sampling sequence entries, part 3.
776. gbenv30.seq - Environmental sampling sequence entries, part 30.
777. gbenv31.seq - Environmental sampling sequence entries, part 31.
778. gbenv32.seq - Environmental sampling sequence entries, part 32.
779. gbenv33.seq - Environmental sampling sequence entries, part 33.
780. gbenv34.seq - Environmental sampling sequence entries, part 34.
781. gbenv35.seq - Environmental sampling sequence entries, part 35.
782. gbenv36.seq - Environmental sampling sequence entries, part 36.
783. gbenv37.seq - Environmental sampling sequence entries, part 37.
784. gbenv38.seq - Environmental sampling sequence entries, part 38.
785. gbenv39.seq - Environmental sampling sequence entries, part 39.
786. gbenv4.seq - Environmental sampling sequence entries, part 4.
787. gbenv40.seq - Environmental sampling sequence entries, part 40.
788. gbenv41.seq - Environmental sampling sequence entries, part 41.
789. gbenv42.seq - Environmental sampling sequence entries, part 42.
790. gbenv43.seq - Environmental sampling sequence entries, part 43.
791. gbenv44.seq - Environmental sampling sequence entries, part 44.
792. gbenv45.seq - Environmental sampling sequence entries, part 45.
793. gbenv46.seq - Environmental sampling sequence entries, part 46.
794. gbenv47.seq - Environmental sampling sequence entries, part 47.
795. gbenv48.seq - Environmental sampling sequence entries, part 48.
796. gbenv49.seq - Environmental sampling sequence entries, part 49.
797. gbenv5.seq - Environmental sampling sequence entries, part 5.
798. gbenv50.seq - Environmental sampling sequence entries, part 50.
799. gbenv51.seq - Environmental sampling sequence entries, part 51.
800. gbenv52.seq - Environmental sampling sequence entries, part 52.
801. gbenv53.seq - Environmental sampling sequence entries, part 53.
802. gbenv54.seq - Environmental sampling sequence entries, part 54.
803. gbenv55.seq - Environmental sampling sequence entries, part 55.
804. gbenv56.seq - Environmental sampling sequence entries, part 56.
805. gbenv57.seq - Environmental sampling sequence entries, part 57.
806. gbenv58.seq - Environmental sampling sequence entries, part 58.
807. gbenv59.seq - Environmental sampling sequence entries, part 59.
808. gbenv6.seq - Environmental sampling sequence entries, part 6.
809. gbenv60.seq - Environmental sampling sequence entries, part 60.
810. gbenv61.seq - Environmental sampling sequence entries, part 61.
811. gbenv62.seq - Environmental sampling sequence entries, part 62.
812. gbenv63.seq - Environmental sampling sequence entries, part 63.
813. gbenv64.seq - Environmental sampling sequence entries, part 64.
814. gbenv65.seq - Environmental sampling sequence entries, part 65.
815. gbenv66.seq - Environmental sampling sequence entries, part 66.
816. gbenv67.seq - Environmental sampling sequence entries, part 67.
817. gbenv68.seq - Environmental sampling sequence entries, part 68.
818. gbenv69.seq - Environmental sampling sequence entries, part 69.
819. gbenv7.seq - Environmental sampling sequence entries, part 7.
820. gbenv70.seq - Environmental sampling sequence entries, part 70.
821. gbenv71.seq - Environmental sampling sequence entries, part 71.
822. gbenv72.seq - Environmental sampling sequence entries, part 72.
823. gbenv73.seq - Environmental sampling sequence entries, part 73.
824. gbenv74.seq - Environmental sampling sequence entries, part 74.
825. gbenv75.seq - Environmental sampling sequence entries, part 75.
826. gbenv76.seq - Environmental sampling sequence entries, part 76.
827. gbenv77.seq - Environmental sampling sequence entries, part 77.
828. gbenv78.seq - Environmental sampling sequence entries, part 78.
829. gbenv79.seq - Environmental sampling sequence entries, part 79.
830. gbenv8.seq - Environmental sampling sequence entries, part 8.
831. gbenv80.seq - Environmental sampling sequence entries, part 80.
832. gbenv81.seq - Environmental sampling sequence entries, part 81.
833. gbenv82.seq - Environmental sampling sequence entries, part 82.
834. gbenv83.seq - Environmental sampling sequence entries, part 83.
835. gbenv84.seq - Environmental sampling sequence entries, part 84.
836. gbenv85.seq - Environmental sampling sequence entries, part 85.
837. gbenv86.seq - Environmental sampling sequence entries, part 86.
838. gbenv87.seq - Environmental sampling sequence entries, part 87.
839. gbenv88.seq - Environmental sampling sequence entries, part 88.
840. gbenv89.seq - Environmental sampling sequence entries, part 89.
841. gbenv9.seq - Environmental sampling sequence entries, part 9.
842. gbenv90.seq - Environmental sampling sequence entries, part 90.
843. gbenv91.seq - Environmental sampling sequence entries, part 91.
844. gbenv92.seq - Environmental sampling sequence entries, part 92.
845. gbenv93.seq - Environmental sampling sequence entries, part 93.
846. gbenv94.seq - Environmental sampling sequence entries, part 94.
847. gbenv95.seq - Environmental sampling sequence entries, part 95.
848. gbenv96.seq - Environmental sampling sequence entries, part 96.
849. gbenv97.seq - Environmental sampling sequence entries, part 97.
850. gbenv98.seq - Environmental sampling sequence entries, part 98.
851. gbenv99.seq - Environmental sampling sequence entries, part 99.
852. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
853. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
854. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
855. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
856. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
857. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
858. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
859. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
860. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
861. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
862. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
863. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
864. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
865. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
866. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
867. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
868. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
869. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
870. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
871. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
872. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
873. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
874. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
875. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
876. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
877. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
878. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
879. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
880. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
881. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
882. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
883. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
884. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
885. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
886. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
887. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
888. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
889. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
890. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
891. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
892. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
893. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
894. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
895. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
896. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
897. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
898. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
899. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
900. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
901. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
902. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
903. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
904. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
905. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
906. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
907. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
908. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
909. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
910. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
911. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
912. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
913. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
914. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
915. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
916. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
917. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
918. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
919. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
920. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
921. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
922. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
923. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
924. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
925. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
926. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
927. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
928. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
929. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
930. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
931. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
932. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
933. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
934. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
935. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
936. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
937. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
938. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
939. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
940. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
941. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
942. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
943. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
944. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
945. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
946. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
947. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
948. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
949. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
950. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
951. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
952. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
953. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
954. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
955. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
956. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
957. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
958. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
959. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
960. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
961. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
962. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
963. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
964. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
965. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
966. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
967. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
968. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
969. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
970. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
971. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
972. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
973. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
974. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
975. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
976. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
977. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
978. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
979. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
980. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
981. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
982. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
983. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
984. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
985. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
986. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
987. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
988. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
989. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
990. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
991. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
992. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
993. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
994. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
995. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
996. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
997. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
998. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
999. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1000. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1001. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1002. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1003. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1004. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1005. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1006. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1007. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1008. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1009. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1010. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1011. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1012. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1013. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1014. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1015. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1016. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1017. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1018. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1019. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1020. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1021. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1022. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1023. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1024. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1025. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1026. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1027. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1028. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1029. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1030. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1031. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1032. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1033. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1034. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1035. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1036. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1037. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1038. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1039. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1040. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1041. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1042. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1043. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1044. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1045. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1046. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1047. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1048. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1049. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1050. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1051. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1052. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1053. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1054. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1055. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1056. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1057. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1058. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1059. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1060. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1061. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1062. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1063. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1064. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1065. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1066. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1067. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1068. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1069. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1070. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1071. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1072. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1073. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1074. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1075. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1076. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1077. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1078. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1079. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1080. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1081. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1082. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1083. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1084. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1085. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1086. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1087. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1088. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1089. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1090. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1091. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1092. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1093. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1094. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1095. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1096. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1097. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1098. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1099. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1100. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1101. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1102. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1103. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1104. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1105. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1106. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1107. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1108. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1109. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1110. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1111. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1112. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1113. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1114. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1115. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1116. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1117. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1118. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1119. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1120. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1121. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1122. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1123. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1124. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1125. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1126. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1127. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1128. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1129. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1130. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1131. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1132. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1133. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1134. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1135. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1136. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1137. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1138. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1139. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1140. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1141. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1142. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1143. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1144. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1145. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1146. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1147. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1148. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1149. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1150. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1151. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1152. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1153. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1154. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1155. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1156. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1157. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1158. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1159. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1160. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1161. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1162. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1163. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1164. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1165. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1166. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1167. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1168. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1169. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1170. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1171. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1172. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1173. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1174. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1175. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1176. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1177. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1178. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1179. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1180. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1181. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1182. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1183. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1184. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1185. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1186. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1187. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1188. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1189. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1190. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1191. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1192. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1193. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1194. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1195. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1196. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1197. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1198. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1199. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1200. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1201. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1202. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1203. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1204. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1205. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1206. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1207. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1208. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1209. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1210. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1211. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1212. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1213. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1214. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1215. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1216. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1217. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1218. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1219. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1220. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1221. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1222. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1223. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1224. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1225. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1226. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1227. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1228. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1229. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1230. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1231. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1232. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1233. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1234. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1235. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1236. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1237. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1238. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1239. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1240. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1241. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1242. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1243. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1244. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1245. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1246. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1247. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1248. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1249. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1250. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1251. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1252. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1253. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1254. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1255. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1256. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1257. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1258. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1259. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1260. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1261. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1262. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1263. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1264. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1265. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1266. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1267. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1268. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1269. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1270. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1271. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1272. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1273. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1274. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1275. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1276. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1277. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1278. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1279. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1280. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1281. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1282. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1283. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1284. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1285. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1286. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1287. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1288. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1289. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1290. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1291. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1292. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1293. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1294. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1295. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1296. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1297. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1298. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1299. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1300. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1301. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1302. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1303. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1304. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1305. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1306. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1307. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1308. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1309. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1310. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1311. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1312. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1313. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1314. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1315. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1316. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1317. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1318. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1319. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1320. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1321. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1322. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1323. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1324. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1325. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1326. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1327. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1328. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1329. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1330. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1331. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1332. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1333. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1334. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1335. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1336. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1337. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1338. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1339. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1340. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1341. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1342. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1343. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1344. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1345. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1346. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1347. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1348. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1349. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1350. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1351. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1352. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1353. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1354. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1355. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1356. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1357. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1358. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1359. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1360. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1361. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1362. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1363. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1364. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1365. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1366. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1367. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1368. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1369. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1370. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1371. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1372. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1373. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1374. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1375. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1376. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1377. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1378. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1379. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1380. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1381. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1382. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1383. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1384. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1385. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1386. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1387. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1388. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1389. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1390. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1391. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1392. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1393. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1394. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1395. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1396. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1397. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1398. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1399. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1400. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1401. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1402. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1403. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1404. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1405. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1406. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1407. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1408. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1409. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1410. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1411. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1412. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1413. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1414. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1415. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1416. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1417. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1418. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1419. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1420. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1421. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1422. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1423. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1424. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1425. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1426. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1427. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1428. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1429. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1430. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1431. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1432. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1433. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1434. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1435. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1436. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1437. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1438. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1439. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1440. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1441. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1442. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1443. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1444. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1445. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1446. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1447. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1448. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1449. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1450. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1451. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1452. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1453. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1454. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1455. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1456. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1457. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1458. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1459. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1460. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1461. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1462. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1463. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1464. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1465. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1466. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1467. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1468. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1469. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1470. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1471. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1472. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1473. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1474. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1475. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1476. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1477. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1478. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1479. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1480. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1481. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1482. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1483. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1484. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1485. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1486. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1487. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1488. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1489. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1490. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1491. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1492. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1493. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1494. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1495. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1496. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1497. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1498. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1499. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1500. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1501. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1502. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1503. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1504. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1505. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1506. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1507. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1508. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1509. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1510. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1511. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1512. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1513. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1514. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1515. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1516. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1517. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1518. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1519. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1520. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1521. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1522. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1523. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1524. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1525. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1526. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1527. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1528. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1529. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1530. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1531. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1532. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1533. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1534. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1535. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1536. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1537. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1538. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1539. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1540. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1541. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1542. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1543. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1544. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1545. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1546. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1547. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1548. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1549. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1550. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1551. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1552. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1553. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1554. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1555. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1556. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1557. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1558. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1559. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1560. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1561. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1562. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1563. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1564. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1565. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1566. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1567. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1568. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1569. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1570. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1571. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1572. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1573. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1574. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1575. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1576. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1577. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1578. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1579. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1580. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1581. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1582. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1583. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1584. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1585. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1586. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1587. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1588. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1589. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1590. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1591. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1592. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1593. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1594. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1595. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1596. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1597. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1598. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1599. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1600. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1601. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1602. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1603. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1604. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1605. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1606. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1607. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1608. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1609. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1610. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1611. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1612. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1613. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1614. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1615. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1616. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1617. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1618. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1619. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1620. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1621. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1622. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1623. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1624. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1625. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1626. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1627. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1628. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1629. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1630. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1631. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1632. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1633. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1634. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1635. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1636. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1637. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1638. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1639. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1640. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1641. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1642. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1643. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1644. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1645. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1646. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1647. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1648. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1649. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1650. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1651. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1652. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1653. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1654. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1655. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1656. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1657. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1658. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1659. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1660. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1661. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1662. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1663. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1664. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1665. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1666. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1667. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1668. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1669. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1670. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1671. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1672. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1673. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1674. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1675. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1676. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1677. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1678. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1679. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1680. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1681. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1682. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1683. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1684. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1685. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1686. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1687. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1688. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1689. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1690. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1691. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1692. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1693. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1694. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1695. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1696. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1697. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1698. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1699. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1700. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1701. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1702. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1703. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1704. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1705. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1706. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1707. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1708. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1709. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1710. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1711. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1712. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1713. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1714. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1715. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1716. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1717. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1718. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1719. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1720. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1721. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1722. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1723. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1724. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1725. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1726. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1727. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1728. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1729. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1730. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1731. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1732. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1733. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1734. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1735. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1736. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1737. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1738. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1739. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1740. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1741. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1742. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1743. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1744. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1745. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1746. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1747. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1748. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1749. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1750. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1751. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1752. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1753. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1754. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1755. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1756. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1757. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1758. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1759. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1760. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1761. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1762. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1763. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1764. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1765. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1766. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1767. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1768. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1769. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1770. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1771. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1772. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1773. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1774. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1775. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1776. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1777. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1778. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1779. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1780. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1781. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1782. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1783. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1784. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1785. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1786. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1787. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1788. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1789. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1790. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1791. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1792. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1793. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1794. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1795. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1796. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1797. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1798. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1799. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1800. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1801. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1802. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1803. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1804. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1805. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1806. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1807. gbinv1.seq - Invertebrate sequence entries, part 1.
1808. gbinv10.seq - Invertebrate sequence entries, part 10.
1809. gbinv100.seq - Invertebrate sequence entries, part 100.
1810. gbinv101.seq - Invertebrate sequence entries, part 101.
1811. gbinv102.seq - Invertebrate sequence entries, part 102.
1812. gbinv103.seq - Invertebrate sequence entries, part 103.
1813. gbinv104.seq - Invertebrate sequence entries, part 104.
1814. gbinv105.seq - Invertebrate sequence entries, part 105.
1815. gbinv106.seq - Invertebrate sequence entries, part 106.
1816. gbinv107.seq - Invertebrate sequence entries, part 107.
1817. gbinv108.seq - Invertebrate sequence entries, part 108.
1818. gbinv109.seq - Invertebrate sequence entries, part 109.
1819. gbinv11.seq - Invertebrate sequence entries, part 11.
1820. gbinv110.seq - Invertebrate sequence entries, part 110.
1821. gbinv111.seq - Invertebrate sequence entries, part 111.
1822. gbinv112.seq - Invertebrate sequence entries, part 112.
1823. gbinv113.seq - Invertebrate sequence entries, part 113.
1824. gbinv114.seq - Invertebrate sequence entries, part 114.
1825. gbinv115.seq - Invertebrate sequence entries, part 115.
1826. gbinv116.seq - Invertebrate sequence entries, part 116.
1827. gbinv117.seq - Invertebrate sequence entries, part 117.
1828. gbinv118.seq - Invertebrate sequence entries, part 118.
1829. gbinv119.seq - Invertebrate sequence entries, part 119.
1830. gbinv12.seq - Invertebrate sequence entries, part 12.
1831. gbinv120.seq - Invertebrate sequence entries, part 120.
1832. gbinv121.seq - Invertebrate sequence entries, part 121.
1833. gbinv122.seq - Invertebrate sequence entries, part 122.
1834. gbinv123.seq - Invertebrate sequence entries, part 123.
1835. gbinv124.seq - Invertebrate sequence entries, part 124.
1836. gbinv125.seq - Invertebrate sequence entries, part 125.
1837. gbinv126.seq - Invertebrate sequence entries, part 126.
1838. gbinv127.seq - Invertebrate sequence entries, part 127.
1839. gbinv128.seq - Invertebrate sequence entries, part 128.
1840. gbinv129.seq - Invertebrate sequence entries, part 129.
1841. gbinv13.seq - Invertebrate sequence entries, part 13.
1842. gbinv130.seq - Invertebrate sequence entries, part 130.
1843. gbinv131.seq - Invertebrate sequence entries, part 131.
1844. gbinv132.seq - Invertebrate sequence entries, part 132.
1845. gbinv133.seq - Invertebrate sequence entries, part 133.
1846. gbinv134.seq - Invertebrate sequence entries, part 134.
1847. gbinv135.seq - Invertebrate sequence entries, part 135.
1848. gbinv136.seq - Invertebrate sequence entries, part 136.
1849. gbinv137.seq - Invertebrate sequence entries, part 137.
1850. gbinv138.seq - Invertebrate sequence entries, part 138.
1851. gbinv139.seq - Invertebrate sequence entries, part 139.
1852. gbinv14.seq - Invertebrate sequence entries, part 14.
1853. gbinv140.seq - Invertebrate sequence entries, part 140.
1854. gbinv141.seq - Invertebrate sequence entries, part 141.
1855. gbinv142.seq - Invertebrate sequence entries, part 142.
1856. gbinv143.seq - Invertebrate sequence entries, part 143.
1857. gbinv144.seq - Invertebrate sequence entries, part 144.
1858. gbinv145.seq - Invertebrate sequence entries, part 145.
1859. gbinv146.seq - Invertebrate sequence entries, part 146.
1860. gbinv147.seq - Invertebrate sequence entries, part 147.
1861. gbinv148.seq - Invertebrate sequence entries, part 148.
1862. gbinv149.seq - Invertebrate sequence entries, part 149.
1863. gbinv15.seq - Invertebrate sequence entries, part 15.
1864. gbinv150.seq - Invertebrate sequence entries, part 150.
1865. gbinv151.seq - Invertebrate sequence entries, part 151.
1866. gbinv152.seq - Invertebrate sequence entries, part 152.
1867. gbinv153.seq - Invertebrate sequence entries, part 153.
1868. gbinv154.seq - Invertebrate sequence entries, part 154.
1869. gbinv155.seq - Invertebrate sequence entries, part 155.
1870. gbinv16.seq - Invertebrate sequence entries, part 16.
1871. gbinv17.seq - Invertebrate sequence entries, part 17.
1872. gbinv18.seq - Invertebrate sequence entries, part 18.
1873. gbinv19.seq - Invertebrate sequence entries, part 19.
1874. gbinv2.seq - Invertebrate sequence entries, part 2.
1875. gbinv20.seq - Invertebrate sequence entries, part 20.
1876. gbinv21.seq - Invertebrate sequence entries, part 21.
1877. gbinv22.seq - Invertebrate sequence entries, part 22.
1878. gbinv23.seq - Invertebrate sequence entries, part 23.
1879. gbinv24.seq - Invertebrate sequence entries, part 24.
1880. gbinv25.seq - Invertebrate sequence entries, part 25.
1881. gbinv26.seq - Invertebrate sequence entries, part 26.
1882. gbinv27.seq - Invertebrate sequence entries, part 27.
1883. gbinv28.seq - Invertebrate sequence entries, part 28.
1884. gbinv29.seq - Invertebrate sequence entries, part 29.
1885. gbinv3.seq - Invertebrate sequence entries, part 3.
1886. gbinv30.seq - Invertebrate sequence entries, part 30.
1887. gbinv31.seq - Invertebrate sequence entries, part 31.
1888. gbinv32.seq - Invertebrate sequence entries, part 32.
1889. gbinv33.seq - Invertebrate sequence entries, part 33.
1890. gbinv34.seq - Invertebrate sequence entries, part 34.
1891. gbinv35.seq - Invertebrate sequence entries, part 35.
1892. gbinv36.seq - Invertebrate sequence entries, part 36.
1893. gbinv37.seq - Invertebrate sequence entries, part 37.
1894. gbinv38.seq - Invertebrate sequence entries, part 38.
1895. gbinv39.seq - Invertebrate sequence entries, part 39.
1896. gbinv4.seq - Invertebrate sequence entries, part 4.
1897. gbinv40.seq - Invertebrate sequence entries, part 40.
1898. gbinv41.seq - Invertebrate sequence entries, part 41.
1899. gbinv42.seq - Invertebrate sequence entries, part 42.
1900. gbinv43.seq - Invertebrate sequence entries, part 43.
1901. gbinv44.seq - Invertebrate sequence entries, part 44.
1902. gbinv45.seq - Invertebrate sequence entries, part 45.
1903. gbinv46.seq - Invertebrate sequence entries, part 46.
1904. gbinv47.seq - Invertebrate sequence entries, part 47.
1905. gbinv48.seq - Invertebrate sequence entries, part 48.
1906. gbinv49.seq - Invertebrate sequence entries, part 49.
1907. gbinv5.seq - Invertebrate sequence entries, part 5.
1908. gbinv50.seq - Invertebrate sequence entries, part 50.
1909. gbinv51.seq - Invertebrate sequence entries, part 51.
1910. gbinv52.seq - Invertebrate sequence entries, part 52.
1911. gbinv53.seq - Invertebrate sequence entries, part 53.
1912. gbinv54.seq - Invertebrate sequence entries, part 54.
1913. gbinv55.seq - Invertebrate sequence entries, part 55.
1914. gbinv56.seq - Invertebrate sequence entries, part 56.
1915. gbinv57.seq - Invertebrate sequence entries, part 57.
1916. gbinv58.seq - Invertebrate sequence entries, part 58.
1917. gbinv59.seq - Invertebrate sequence entries, part 59.
1918. gbinv6.seq - Invertebrate sequence entries, part 6.
1919. gbinv60.seq - Invertebrate sequence entries, part 60.
1920. gbinv61.seq - Invertebrate sequence entries, part 61.
1921. gbinv62.seq - Invertebrate sequence entries, part 62.
1922. gbinv63.seq - Invertebrate sequence entries, part 63.
1923. gbinv64.seq - Invertebrate sequence entries, part 64.
1924. gbinv65.seq - Invertebrate sequence entries, part 65.
1925. gbinv66.seq - Invertebrate sequence entries, part 66.
1926. gbinv67.seq - Invertebrate sequence entries, part 67.
1927. gbinv68.seq - Invertebrate sequence entries, part 68.
1928. gbinv69.seq - Invertebrate sequence entries, part 69.
1929. gbinv7.seq - Invertebrate sequence entries, part 7.
1930. gbinv70.seq - Invertebrate sequence entries, part 70.
1931. gbinv71.seq - Invertebrate sequence entries, part 71.
1932. gbinv72.seq - Invertebrate sequence entries, part 72.
1933. gbinv73.seq - Invertebrate sequence entries, part 73.
1934. gbinv74.seq - Invertebrate sequence entries, part 74.
1935. gbinv75.seq - Invertebrate sequence entries, part 75.
1936. gbinv76.seq - Invertebrate sequence entries, part 76.
1937. gbinv77.seq - Invertebrate sequence entries, part 77.
1938. gbinv78.seq - Invertebrate sequence entries, part 78.
1939. gbinv79.seq - Invertebrate sequence entries, part 79.
1940. gbinv8.seq - Invertebrate sequence entries, part 8.
1941. gbinv80.seq - Invertebrate sequence entries, part 80.
1942. gbinv81.seq - Invertebrate sequence entries, part 81.
1943. gbinv82.seq - Invertebrate sequence entries, part 82.
1944. gbinv83.seq - Invertebrate sequence entries, part 83.
1945. gbinv84.seq - Invertebrate sequence entries, part 84.
1946. gbinv85.seq - Invertebrate sequence entries, part 85.
1947. gbinv86.seq - Invertebrate sequence entries, part 86.
1948. gbinv87.seq - Invertebrate sequence entries, part 87.
1949. gbinv88.seq - Invertebrate sequence entries, part 88.
1950. gbinv89.seq - Invertebrate sequence entries, part 89.
1951. gbinv9.seq - Invertebrate sequence entries, part 9.
1952. gbinv90.seq - Invertebrate sequence entries, part 90.
1953. gbinv91.seq - Invertebrate sequence entries, part 91.
1954. gbinv92.seq - Invertebrate sequence entries, part 92.
1955. gbinv93.seq - Invertebrate sequence entries, part 93.
1956. gbinv94.seq - Invertebrate sequence entries, part 94.
1957. gbinv95.seq - Invertebrate sequence entries, part 95.
1958. gbinv96.seq - Invertebrate sequence entries, part 96.
1959. gbinv97.seq - Invertebrate sequence entries, part 97.
1960. gbinv98.seq - Invertebrate sequence entries, part 98.
1961. gbinv99.seq - Invertebrate sequence entries, part 99.
1962. gbmam1.seq - Other mammalian sequence entries, part 1.
1963. gbmam10.seq - Other mammalian sequence entries, part 10.
1964. gbmam11.seq - Other mammalian sequence entries, part 11.
1965. gbmam12.seq - Other mammalian sequence entries, part 12.
1966. gbmam13.seq - Other mammalian sequence entries, part 13.
1967. gbmam14.seq - Other mammalian sequence entries, part 14.
1968. gbmam15.seq - Other mammalian sequence entries, part 15.
1969. gbmam16.seq - Other mammalian sequence entries, part 16.
1970. gbmam17.seq - Other mammalian sequence entries, part 17.
1971. gbmam18.seq - Other mammalian sequence entries, part 18.
1972. gbmam19.seq - Other mammalian sequence entries, part 19.
1973. gbmam2.seq - Other mammalian sequence entries, part 2.
1974. gbmam20.seq - Other mammalian sequence entries, part 20.
1975. gbmam21.seq - Other mammalian sequence entries, part 21.
1976. gbmam22.seq - Other mammalian sequence entries, part 22.
1977. gbmam23.seq - Other mammalian sequence entries, part 23.
1978. gbmam24.seq - Other mammalian sequence entries, part 24.
1979. gbmam25.seq - Other mammalian sequence entries, part 25.
1980. gbmam26.seq - Other mammalian sequence entries, part 26.
1981. gbmam27.seq - Other mammalian sequence entries, part 27.
1982. gbmam28.seq - Other mammalian sequence entries, part 28.
1983. gbmam29.seq - Other mammalian sequence entries, part 29.
1984. gbmam3.seq - Other mammalian sequence entries, part 3.
1985. gbmam30.seq - Other mammalian sequence entries, part 30.
1986. gbmam31.seq - Other mammalian sequence entries, part 31.
1987. gbmam32.seq - Other mammalian sequence entries, part 32.
1988. gbmam33.seq - Other mammalian sequence entries, part 33.
1989. gbmam34.seq - Other mammalian sequence entries, part 34.
1990. gbmam35.seq - Other mammalian sequence entries, part 35.
1991. gbmam36.seq - Other mammalian sequence entries, part 36.
1992. gbmam37.seq - Other mammalian sequence entries, part 37.
1993. gbmam38.seq - Other mammalian sequence entries, part 38.
1994. gbmam39.seq - Other mammalian sequence entries, part 39.
1995. gbmam4.seq - Other mammalian sequence entries, part 4.
1996. gbmam5.seq - Other mammalian sequence entries, part 5.
1997. gbmam6.seq - Other mammalian sequence entries, part 6.
1998. gbmam7.seq - Other mammalian sequence entries, part 7.
1999. gbmam8.seq - Other mammalian sequence entries, part 8.
2000. gbmam9.seq - Other mammalian sequence entries, part 9.
2001. gbnew.txt - Accession numbers of entries new since the previous release.
2002. gbpat1.seq - Patent sequence entries, part 1.
2003. gbpat10.seq - Patent sequence entries, part 10.
2004. gbpat100.seq - Patent sequence entries, part 100.
2005. gbpat101.seq - Patent sequence entries, part 101.
2006. gbpat102.seq - Patent sequence entries, part 102.
2007. gbpat103.seq - Patent sequence entries, part 103.
2008. gbpat104.seq - Patent sequence entries, part 104.
2009. gbpat105.seq - Patent sequence entries, part 105.
2010. gbpat106.seq - Patent sequence entries, part 106.
2011. gbpat107.seq - Patent sequence entries, part 107.
2012. gbpat108.seq - Patent sequence entries, part 108.
2013. gbpat109.seq - Patent sequence entries, part 109.
2014. gbpat11.seq - Patent sequence entries, part 11.
2015. gbpat110.seq - Patent sequence entries, part 110.
2016. gbpat111.seq - Patent sequence entries, part 111.
2017. gbpat112.seq - Patent sequence entries, part 112.
2018. gbpat113.seq - Patent sequence entries, part 113.
2019. gbpat114.seq - Patent sequence entries, part 114.
2020. gbpat115.seq - Patent sequence entries, part 115.
2021. gbpat116.seq - Patent sequence entries, part 116.
2022. gbpat117.seq - Patent sequence entries, part 117.
2023. gbpat118.seq - Patent sequence entries, part 118.
2024. gbpat119.seq - Patent sequence entries, part 119.
2025. gbpat12.seq - Patent sequence entries, part 12.
2026. gbpat120.seq - Patent sequence entries, part 120.
2027. gbpat121.seq - Patent sequence entries, part 121.
2028. gbpat122.seq - Patent sequence entries, part 122.
2029. gbpat123.seq - Patent sequence entries, part 123.
2030. gbpat124.seq - Patent sequence entries, part 124.
2031. gbpat125.seq - Patent sequence entries, part 125.
2032. gbpat126.seq - Patent sequence entries, part 126.
2033. gbpat127.seq - Patent sequence entries, part 127.
2034. gbpat128.seq - Patent sequence entries, part 128.
2035. gbpat129.seq - Patent sequence entries, part 129.
2036. gbpat13.seq - Patent sequence entries, part 13.
2037. gbpat130.seq - Patent sequence entries, part 130.
2038. gbpat131.seq - Patent sequence entries, part 131.
2039. gbpat132.seq - Patent sequence entries, part 132.
2040. gbpat133.seq - Patent sequence entries, part 133.
2041. gbpat134.seq - Patent sequence entries, part 134.
2042. gbpat135.seq - Patent sequence entries, part 135.
2043. gbpat136.seq - Patent sequence entries, part 136.
2044. gbpat137.seq - Patent sequence entries, part 137.
2045. gbpat138.seq - Patent sequence entries, part 138.
2046. gbpat139.seq - Patent sequence entries, part 139.
2047. gbpat14.seq - Patent sequence entries, part 14.
2048. gbpat140.seq - Patent sequence entries, part 140.
2049. gbpat141.seq - Patent sequence entries, part 141.
2050. gbpat142.seq - Patent sequence entries, part 142.
2051. gbpat143.seq - Patent sequence entries, part 143.
2052. gbpat144.seq - Patent sequence entries, part 144.
2053. gbpat145.seq - Patent sequence entries, part 145.
2054. gbpat146.seq - Patent sequence entries, part 146.
2055. gbpat147.seq - Patent sequence entries, part 147.
2056. gbpat148.seq - Patent sequence entries, part 148.
2057. gbpat149.seq - Patent sequence entries, part 149.
2058. gbpat15.seq - Patent sequence entries, part 15.
2059. gbpat150.seq - Patent sequence entries, part 150.
2060. gbpat151.seq - Patent sequence entries, part 151.
2061. gbpat152.seq - Patent sequence entries, part 152.
2062. gbpat153.seq - Patent sequence entries, part 153.
2063. gbpat154.seq - Patent sequence entries, part 154.
2064. gbpat155.seq - Patent sequence entries, part 155.
2065. gbpat156.seq - Patent sequence entries, part 156.
2066. gbpat157.seq - Patent sequence entries, part 157.
2067. gbpat158.seq - Patent sequence entries, part 158.
2068. gbpat159.seq - Patent sequence entries, part 159.
2069. gbpat16.seq - Patent sequence entries, part 16.
2070. gbpat160.seq - Patent sequence entries, part 160.
2071. gbpat161.seq - Patent sequence entries, part 161.
2072. gbpat162.seq - Patent sequence entries, part 162.
2073. gbpat163.seq - Patent sequence entries, part 163.
2074. gbpat164.seq - Patent sequence entries, part 164.
2075. gbpat165.seq - Patent sequence entries, part 165.
2076. gbpat166.seq - Patent sequence entries, part 166.
2077. gbpat167.seq - Patent sequence entries, part 167.
2078. gbpat168.seq - Patent sequence entries, part 168.
2079. gbpat169.seq - Patent sequence entries, part 169.
2080. gbpat17.seq - Patent sequence entries, part 17.
2081. gbpat170.seq - Patent sequence entries, part 170.
2082. gbpat171.seq - Patent sequence entries, part 171.
2083. gbpat172.seq - Patent sequence entries, part 172.
2084. gbpat173.seq - Patent sequence entries, part 173.
2085. gbpat174.seq - Patent sequence entries, part 174.
2086. gbpat175.seq - Patent sequence entries, part 175.
2087. gbpat176.seq - Patent sequence entries, part 176.
2088. gbpat177.seq - Patent sequence entries, part 177.
2089. gbpat178.seq - Patent sequence entries, part 178.
2090. gbpat179.seq - Patent sequence entries, part 179.
2091. gbpat18.seq - Patent sequence entries, part 18.
2092. gbpat180.seq - Patent sequence entries, part 180.
2093. gbpat181.seq - Patent sequence entries, part 181.
2094. gbpat182.seq - Patent sequence entries, part 182.
2095. gbpat183.seq - Patent sequence entries, part 183.
2096. gbpat184.seq - Patent sequence entries, part 184.
2097. gbpat185.seq - Patent sequence entries, part 185.
2098. gbpat186.seq - Patent sequence entries, part 186.
2099. gbpat187.seq - Patent sequence entries, part 187.
2100. gbpat188.seq - Patent sequence entries, part 188.
2101. gbpat189.seq - Patent sequence entries, part 189.
2102. gbpat19.seq - Patent sequence entries, part 19.
2103. gbpat190.seq - Patent sequence entries, part 190.
2104. gbpat191.seq - Patent sequence entries, part 191.
2105. gbpat192.seq - Patent sequence entries, part 192.
2106. gbpat193.seq - Patent sequence entries, part 193.
2107. gbpat194.seq - Patent sequence entries, part 194.
2108. gbpat195.seq - Patent sequence entries, part 195.
2109. gbpat196.seq - Patent sequence entries, part 196.
2110. gbpat197.seq - Patent sequence entries, part 197.
2111. gbpat198.seq - Patent sequence entries, part 198.
2112. gbpat199.seq - Patent sequence entries, part 199.
2113. gbpat2.seq - Patent sequence entries, part 2.
2114. gbpat20.seq - Patent sequence entries, part 20.
2115. gbpat200.seq - Patent sequence entries, part 200.
2116. gbpat201.seq - Patent sequence entries, part 201.
2117. gbpat202.seq - Patent sequence entries, part 202.
2118. gbpat203.seq - Patent sequence entries, part 203.
2119. gbpat204.seq - Patent sequence entries, part 204.
2120. gbpat205.seq - Patent sequence entries, part 205.
2121. gbpat206.seq - Patent sequence entries, part 206.
2122. gbpat207.seq - Patent sequence entries, part 207.
2123. gbpat208.seq - Patent sequence entries, part 208.
2124. gbpat209.seq - Patent sequence entries, part 209.
2125. gbpat21.seq - Patent sequence entries, part 21.
2126. gbpat210.seq - Patent sequence entries, part 210.
2127. gbpat211.seq - Patent sequence entries, part 211.
2128. gbpat212.seq - Patent sequence entries, part 212.
2129. gbpat213.seq - Patent sequence entries, part 213.
2130. gbpat214.seq - Patent sequence entries, part 214.
2131. gbpat215.seq - Patent sequence entries, part 215.
2132. gbpat216.seq - Patent sequence entries, part 216.
2133. gbpat217.seq - Patent sequence entries, part 217.
2134. gbpat218.seq - Patent sequence entries, part 218.
2135. gbpat219.seq - Patent sequence entries, part 219.
2136. gbpat22.seq - Patent sequence entries, part 22.
2137. gbpat220.seq - Patent sequence entries, part 220.
2138. gbpat221.seq - Patent sequence entries, part 221.
2139. gbpat222.seq - Patent sequence entries, part 222.
2140. gbpat223.seq - Patent sequence entries, part 223.
2141. gbpat224.seq - Patent sequence entries, part 224.
2142. gbpat225.seq - Patent sequence entries, part 225.
2143. gbpat226.seq - Patent sequence entries, part 226.
2144. gbpat227.seq - Patent sequence entries, part 227.
2145. gbpat228.seq - Patent sequence entries, part 228.
2146. gbpat229.seq - Patent sequence entries, part 229.
2147. gbpat23.seq - Patent sequence entries, part 23.
2148. gbpat230.seq - Patent sequence entries, part 230.
2149. gbpat231.seq - Patent sequence entries, part 231.
2150. gbpat232.seq - Patent sequence entries, part 232.
2151. gbpat233.seq - Patent sequence entries, part 233.
2152. gbpat234.seq - Patent sequence entries, part 234.
2153. gbpat235.seq - Patent sequence entries, part 235.
2154. gbpat236.seq - Patent sequence entries, part 236.
2155. gbpat237.seq - Patent sequence entries, part 237.
2156. gbpat238.seq - Patent sequence entries, part 238.
2157. gbpat239.seq - Patent sequence entries, part 239.
2158. gbpat24.seq - Patent sequence entries, part 24.
2159. gbpat240.seq - Patent sequence entries, part 240.
2160. gbpat241.seq - Patent sequence entries, part 241.
2161. gbpat242.seq - Patent sequence entries, part 242.
2162. gbpat243.seq - Patent sequence entries, part 243.
2163. gbpat244.seq - Patent sequence entries, part 244.
2164. gbpat245.seq - Patent sequence entries, part 245.
2165. gbpat246.seq - Patent sequence entries, part 246.
2166. gbpat247.seq - Patent sequence entries, part 247.
2167. gbpat248.seq - Patent sequence entries, part 248.
2168. gbpat249.seq - Patent sequence entries, part 249.
2169. gbpat25.seq - Patent sequence entries, part 25.
2170. gbpat250.seq - Patent sequence entries, part 250.
2171. gbpat251.seq - Patent sequence entries, part 251.
2172. gbpat252.seq - Patent sequence entries, part 252.
2173. gbpat253.seq - Patent sequence entries, part 253.
2174. gbpat254.seq - Patent sequence entries, part 254.
2175. gbpat255.seq - Patent sequence entries, part 255.
2176. gbpat256.seq - Patent sequence entries, part 256.
2177. gbpat257.seq - Patent sequence entries, part 257.
2178. gbpat258.seq - Patent sequence entries, part 258.
2179. gbpat259.seq - Patent sequence entries, part 259.
2180. gbpat26.seq - Patent sequence entries, part 26.
2181. gbpat260.seq - Patent sequence entries, part 260.
2182. gbpat261.seq - Patent sequence entries, part 261.
2183. gbpat262.seq - Patent sequence entries, part 262.
2184. gbpat263.seq - Patent sequence entries, part 263.
2185. gbpat264.seq - Patent sequence entries, part 264.
2186. gbpat265.seq - Patent sequence entries, part 265.
2187. gbpat266.seq - Patent sequence entries, part 266.
2188. gbpat267.seq - Patent sequence entries, part 267.
2189. gbpat268.seq - Patent sequence entries, part 268.
2190. gbpat269.seq - Patent sequence entries, part 269.
2191. gbpat27.seq - Patent sequence entries, part 27.
2192. gbpat270.seq - Patent sequence entries, part 270.
2193. gbpat271.seq - Patent sequence entries, part 271.
2194. gbpat272.seq - Patent sequence entries, part 272.
2195. gbpat273.seq - Patent sequence entries, part 273.
2196. gbpat274.seq - Patent sequence entries, part 274.
2197. gbpat275.seq - Patent sequence entries, part 275.
2198. gbpat276.seq - Patent sequence entries, part 276.
2199. gbpat277.seq - Patent sequence entries, part 277.
2200. gbpat278.seq - Patent sequence entries, part 278.
2201. gbpat279.seq - Patent sequence entries, part 279.
2202. gbpat28.seq - Patent sequence entries, part 28.
2203. gbpat280.seq - Patent sequence entries, part 280.
2204. gbpat281.seq - Patent sequence entries, part 281.
2205. gbpat282.seq - Patent sequence entries, part 282.
2206. gbpat283.seq - Patent sequence entries, part 283.
2207. gbpat284.seq - Patent sequence entries, part 284.
2208. gbpat285.seq - Patent sequence entries, part 285.
2209. gbpat286.seq - Patent sequence entries, part 286.
2210. gbpat287.seq - Patent sequence entries, part 287.
2211. gbpat288.seq - Patent sequence entries, part 288.
2212. gbpat289.seq - Patent sequence entries, part 289.
2213. gbpat29.seq - Patent sequence entries, part 29.
2214. gbpat290.seq - Patent sequence entries, part 290.
2215. gbpat291.seq - Patent sequence entries, part 291.
2216. gbpat292.seq - Patent sequence entries, part 292.
2217. gbpat293.seq - Patent sequence entries, part 293.
2218. gbpat294.seq - Patent sequence entries, part 294.
2219. gbpat3.seq - Patent sequence entries, part 3.
2220. gbpat30.seq - Patent sequence entries, part 30.
2221. gbpat31.seq - Patent sequence entries, part 31.
2222. gbpat32.seq - Patent sequence entries, part 32.
2223. gbpat33.seq - Patent sequence entries, part 33.
2224. gbpat34.seq - Patent sequence entries, part 34.
2225. gbpat35.seq - Patent sequence entries, part 35.
2226. gbpat36.seq - Patent sequence entries, part 36.
2227. gbpat37.seq - Patent sequence entries, part 37.
2228. gbpat38.seq - Patent sequence entries, part 38.
2229. gbpat39.seq - Patent sequence entries, part 39.
2230. gbpat4.seq - Patent sequence entries, part 4.
2231. gbpat40.seq - Patent sequence entries, part 40.
2232. gbpat41.seq - Patent sequence entries, part 41.
2233. gbpat42.seq - Patent sequence entries, part 42.
2234. gbpat43.seq - Patent sequence entries, part 43.
2235. gbpat44.seq - Patent sequence entries, part 44.
2236. gbpat45.seq - Patent sequence entries, part 45.
2237. gbpat46.seq - Patent sequence entries, part 46.
2238. gbpat47.seq - Patent sequence entries, part 47.
2239. gbpat48.seq - Patent sequence entries, part 48.
2240. gbpat49.seq - Patent sequence entries, part 49.
2241. gbpat5.seq - Patent sequence entries, part 5.
2242. gbpat50.seq - Patent sequence entries, part 50.
2243. gbpat51.seq - Patent sequence entries, part 51.
2244. gbpat52.seq - Patent sequence entries, part 52.
2245. gbpat53.seq - Patent sequence entries, part 53.
2246. gbpat54.seq - Patent sequence entries, part 54.
2247. gbpat55.seq - Patent sequence entries, part 55.
2248. gbpat56.seq - Patent sequence entries, part 56.
2249. gbpat57.seq - Patent sequence entries, part 57.
2250. gbpat58.seq - Patent sequence entries, part 58.
2251. gbpat59.seq - Patent sequence entries, part 59.
2252. gbpat6.seq - Patent sequence entries, part 6.
2253. gbpat60.seq - Patent sequence entries, part 60.
2254. gbpat61.seq - Patent sequence entries, part 61.
2255. gbpat62.seq - Patent sequence entries, part 62.
2256. gbpat63.seq - Patent sequence entries, part 63.
2257. gbpat64.seq - Patent sequence entries, part 64.
2258. gbpat65.seq - Patent sequence entries, part 65.
2259. gbpat66.seq - Patent sequence entries, part 66.
2260. gbpat67.seq - Patent sequence entries, part 67.
2261. gbpat68.seq - Patent sequence entries, part 68.
2262. gbpat69.seq - Patent sequence entries, part 69.
2263. gbpat7.seq - Patent sequence entries, part 7.
2264. gbpat70.seq - Patent sequence entries, part 70.
2265. gbpat71.seq - Patent sequence entries, part 71.
2266. gbpat72.seq - Patent sequence entries, part 72.
2267. gbpat73.seq - Patent sequence entries, part 73.
2268. gbpat74.seq - Patent sequence entries, part 74.
2269. gbpat75.seq - Patent sequence entries, part 75.
2270. gbpat76.seq - Patent sequence entries, part 76.
2271. gbpat77.seq - Patent sequence entries, part 77.
2272. gbpat78.seq - Patent sequence entries, part 78.
2273. gbpat79.seq - Patent sequence entries, part 79.
2274. gbpat8.seq - Patent sequence entries, part 8.
2275. gbpat80.seq - Patent sequence entries, part 80.
2276. gbpat81.seq - Patent sequence entries, part 81.
2277. gbpat82.seq - Patent sequence entries, part 82.
2278. gbpat83.seq - Patent sequence entries, part 83.
2279. gbpat84.seq - Patent sequence entries, part 84.
2280. gbpat85.seq - Patent sequence entries, part 85.
2281. gbpat86.seq - Patent sequence entries, part 86.
2282. gbpat87.seq - Patent sequence entries, part 87.
2283. gbpat88.seq - Patent sequence entries, part 88.
2284. gbpat89.seq - Patent sequence entries, part 89.
2285. gbpat9.seq - Patent sequence entries, part 9.
2286. gbpat90.seq - Patent sequence entries, part 90.
2287. gbpat91.seq - Patent sequence entries, part 91.
2288. gbpat92.seq - Patent sequence entries, part 92.
2289. gbpat93.seq - Patent sequence entries, part 93.
2290. gbpat94.seq - Patent sequence entries, part 94.
2291. gbpat95.seq - Patent sequence entries, part 95.
2292. gbpat96.seq - Patent sequence entries, part 96.
2293. gbpat97.seq - Patent sequence entries, part 97.
2294. gbpat98.seq - Patent sequence entries, part 98.
2295. gbpat99.seq - Patent sequence entries, part 99.
2296. gbphg1.seq - Phage sequence entries, part 1.
2297. gbphg2.seq - Phage sequence entries, part 2.
2298. gbphg3.seq - Phage sequence entries, part 3.
2299. gbphg4.seq - Phage sequence entries, part 4.
2300. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2301. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2302. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2303. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2304. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2305. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2306. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2307. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2308. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2309. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2310. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2311. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2312. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2313. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2314. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2315. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2316. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2317. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2318. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2319. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2320. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2321. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2322. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2323. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2324. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2325. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2326. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2327. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2328. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2329. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2330. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2331. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2332. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2333. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2334. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2335. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2336. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2337. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2338. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2339. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2340. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2341. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2342. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2343. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2344. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2345. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2346. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2347. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2348. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2349. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2350. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2351. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2352. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2353. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2354. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2355. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2356. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2357. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2358. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2359. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2360. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2361. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2362. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2363. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2364. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2365. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2366. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2367. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2368. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2369. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2370. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2371. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2372. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2373. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2374. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2375. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2376. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2377. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2378. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2379. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2380. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2381. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2382. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2383. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2384. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2385. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2386. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2387. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2388. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2389. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2390. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2391. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2392. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2393. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2394. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2395. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2396. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2397. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2398. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2399. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2400. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2401. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2402. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2403. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2404. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2405. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2406. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2407. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2408. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2409. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2410. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2411. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2412. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2413. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2414. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2415. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2416. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2417. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2418. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2419. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2420. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2421. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2422. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2423. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2424. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2425. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2426. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2427. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2428. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2429. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2430. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2431. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2432. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2433. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2434. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2435. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2436. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2437. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2438. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2439. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2440. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2441. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2442. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2443. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2444. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2445. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2446. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2447. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2448. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2449. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2450. gbpri1.seq - Primate sequence entries, part 1.
2451. gbpri10.seq - Primate sequence entries, part 10.
2452. gbpri11.seq - Primate sequence entries, part 11.
2453. gbpri12.seq - Primate sequence entries, part 12.
2454. gbpri13.seq - Primate sequence entries, part 13.
2455. gbpri14.seq - Primate sequence entries, part 14.
2456. gbpri15.seq - Primate sequence entries, part 15.
2457. gbpri16.seq - Primate sequence entries, part 16.
2458. gbpri17.seq - Primate sequence entries, part 17.
2459. gbpri18.seq - Primate sequence entries, part 18.
2460. gbpri19.seq - Primate sequence entries, part 19.
2461. gbpri2.seq - Primate sequence entries, part 2.
2462. gbpri20.seq - Primate sequence entries, part 20.
2463. gbpri21.seq - Primate sequence entries, part 21.
2464. gbpri22.seq - Primate sequence entries, part 22.
2465. gbpri23.seq - Primate sequence entries, part 23.
2466. gbpri24.seq - Primate sequence entries, part 24.
2467. gbpri25.seq - Primate sequence entries, part 25.
2468. gbpri26.seq - Primate sequence entries, part 26.
2469. gbpri27.seq - Primate sequence entries, part 27.
2470. gbpri28.seq - Primate sequence entries, part 28.
2471. gbpri29.seq - Primate sequence entries, part 29.
2472. gbpri3.seq - Primate sequence entries, part 3.
2473. gbpri30.seq - Primate sequence entries, part 30.
2474. gbpri31.seq - Primate sequence entries, part 31.
2475. gbpri32.seq - Primate sequence entries, part 32.
2476. gbpri33.seq - Primate sequence entries, part 33.
2477. gbpri34.seq - Primate sequence entries, part 34.
2478. gbpri35.seq - Primate sequence entries, part 35.
2479. gbpri36.seq - Primate sequence entries, part 36.
2480. gbpri37.seq - Primate sequence entries, part 37.
2481. gbpri38.seq - Primate sequence entries, part 38.
2482. gbpri39.seq - Primate sequence entries, part 39.
2483. gbpri4.seq - Primate sequence entries, part 4.
2484. gbpri40.seq - Primate sequence entries, part 40.
2485. gbpri41.seq - Primate sequence entries, part 41.
2486. gbpri42.seq - Primate sequence entries, part 42.
2487. gbpri43.seq - Primate sequence entries, part 43.
2488. gbpri44.seq - Primate sequence entries, part 44.
2489. gbpri45.seq - Primate sequence entries, part 45.
2490. gbpri46.seq - Primate sequence entries, part 46.
2491. gbpri47.seq - Primate sequence entries, part 47.
2492. gbpri48.seq - Primate sequence entries, part 48.
2493. gbpri49.seq - Primate sequence entries, part 49.
2494. gbpri5.seq - Primate sequence entries, part 5.
2495. gbpri50.seq - Primate sequence entries, part 50.
2496. gbpri51.seq - Primate sequence entries, part 51.
2497. gbpri52.seq - Primate sequence entries, part 52.
2498. gbpri53.seq - Primate sequence entries, part 53.
2499. gbpri54.seq - Primate sequence entries, part 54.
2500. gbpri55.seq - Primate sequence entries, part 55.
2501. gbpri56.seq - Primate sequence entries, part 56.
2502. gbpri57.seq - Primate sequence entries, part 57.
2503. gbpri6.seq - Primate sequence entries, part 6.
2504. gbpri7.seq - Primate sequence entries, part 7.
2505. gbpri8.seq - Primate sequence entries, part 8.
2506. gbpri9.seq - Primate sequence entries, part 9.
2507. gbrel.txt - Release notes (this document).
2508. gbrod1.seq - Rodent sequence entries, part 1.
2509. gbrod10.seq - Rodent sequence entries, part 10.
2510. gbrod11.seq - Rodent sequence entries, part 11.
2511. gbrod12.seq - Rodent sequence entries, part 12.
2512. gbrod13.seq - Rodent sequence entries, part 13.
2513. gbrod14.seq - Rodent sequence entries, part 14.
2514. gbrod15.seq - Rodent sequence entries, part 15.
2515. gbrod16.seq - Rodent sequence entries, part 16.
2516. gbrod17.seq - Rodent sequence entries, part 17.
2517. gbrod18.seq - Rodent sequence entries, part 18.
2518. gbrod19.seq - Rodent sequence entries, part 19.
2519. gbrod2.seq - Rodent sequence entries, part 2.
2520. gbrod20.seq - Rodent sequence entries, part 20.
2521. gbrod21.seq - Rodent sequence entries, part 21.
2522. gbrod22.seq - Rodent sequence entries, part 22.
2523. gbrod23.seq - Rodent sequence entries, part 23.
2524. gbrod24.seq - Rodent sequence entries, part 24.
2525. gbrod25.seq - Rodent sequence entries, part 25.
2526. gbrod26.seq - Rodent sequence entries, part 26.
2527. gbrod27.seq - Rodent sequence entries, part 27.
2528. gbrod28.seq - Rodent sequence entries, part 28.
2529. gbrod29.seq - Rodent sequence entries, part 29.
2530. gbrod3.seq - Rodent sequence entries, part 3.
2531. gbrod30.seq - Rodent sequence entries, part 30.
2532. gbrod4.seq - Rodent sequence entries, part 4.
2533. gbrod5.seq - Rodent sequence entries, part 5.
2534. gbrod6.seq - Rodent sequence entries, part 6.
2535. gbrod7.seq - Rodent sequence entries, part 7.
2536. gbrod8.seq - Rodent sequence entries, part 8.
2537. gbrod9.seq - Rodent sequence entries, part 9.
2538. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2539. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2540. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2541. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2542. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2543. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2544. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2545. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2546. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2547. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2548. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2549. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2550. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2551. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2552. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2553. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2554. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2555. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2556. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2557. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2558. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2559. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2560. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2561. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2562. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2563. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2564. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2565. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2566. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2567. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2568. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2569. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2570. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2571. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2572. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2573. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2574. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2575. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2576. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2577. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2578. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2579. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2580. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2581. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2582. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2583. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2584. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2585. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2586. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2587. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2588. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2589. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2590. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2591. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2592. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2593. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2594. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2595. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2596. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2597. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2598. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2599. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2600. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2601. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2602. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2603. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2604. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2605. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2606. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2607. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2608. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2609. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2610. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2611. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2612. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2613. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2614. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2615. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2616. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2617. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2618. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2619. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2620. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2621. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2622. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2623. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2624. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2625. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2626. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2627. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2628. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2629. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2630. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2631. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2632. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2633. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2634. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2635. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2636. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2637. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2638. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2639. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2640. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2641. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2642. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2643. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2644. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2645. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2646. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2647. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2648. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2649. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2650. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2651. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2652. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2653. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2654. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2655. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2656. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2657. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2658. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2659. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2660. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2661. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2662. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2663. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2664. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2665. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2666. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2667. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2668. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2669. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2670. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2671. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2672. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2673. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2674. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2675. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2676. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2677. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2678. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2679. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2680. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2681. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2682. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2683. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2684. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2685. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2686. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2687. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2688. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2689. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2690. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2691. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2692. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2693. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2694. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2695. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2696. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2697. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2698. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2699. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2700. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2701. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2702. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2703. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2704. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2705. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2706. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2707. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2708. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2709. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2710. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2711. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2712. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2713. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2714. gbtsa230.seq - TSA (transcriptome shotgun assembly) sequence entries, part 230.
2715. gbtsa231.seq - TSA (transcriptome shotgun assembly) sequence entries, part 231.
2716. gbtsa232.seq - TSA (transcriptome shotgun assembly) sequence entries, part 232.
2717. gbtsa233.seq - TSA (transcriptome shotgun assembly) sequence entries, part 233.
2718. gbtsa234.seq - TSA (transcriptome shotgun assembly) sequence entries, part 234.
2719. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2720. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2721. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2722. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2723. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2724. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2725. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2726. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2727. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2728. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2729. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2730. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2731. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2732. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2733. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2734. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2735. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2736. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2737. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2738. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2739. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2740. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2741. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2742. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2743. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2744. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2745. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2746. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2747. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2748. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2749. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2750. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2751. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2752. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2753. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2754. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2755. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2756. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2757. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2758. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2759. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2760. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2761. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2762. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2763. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2764. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2765. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2766. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2767. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2768. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2769. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2770. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2771. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2772. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2773. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2774. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2775. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2776. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2777. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2778. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2779. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2780. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2781. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2782. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2783. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2784. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2785. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2786. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2787. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2788. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2789. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2790. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2791. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2792. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2793. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2794. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2795. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2796. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2797. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2798. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2799. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2800. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2801. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2802. gbuna1.seq - Unannotated sequence entries, part 1.
2803. gbvrl1.seq - Viral sequence entries, part 1.
2804. gbvrl10.seq - Viral sequence entries, part 10.
2805. gbvrl11.seq - Viral sequence entries, part 11.
2806. gbvrl12.seq - Viral sequence entries, part 12.
2807. gbvrl13.seq - Viral sequence entries, part 13.
2808. gbvrl14.seq - Viral sequence entries, part 14.
2809. gbvrl15.seq - Viral sequence entries, part 15.
2810. gbvrl16.seq - Viral sequence entries, part 16.
2811. gbvrl17.seq - Viral sequence entries, part 17.
2812. gbvrl18.seq - Viral sequence entries, part 18.
2813. gbvrl19.seq - Viral sequence entries, part 19.
2814. gbvrl2.seq - Viral sequence entries, part 2.
2815. gbvrl20.seq - Viral sequence entries, part 20.
2816. gbvrl21.seq - Viral sequence entries, part 21.
2817. gbvrl22.seq - Viral sequence entries, part 22.
2818. gbvrl23.seq - Viral sequence entries, part 23.
2819. gbvrl24.seq - Viral sequence entries, part 24.
2820. gbvrl25.seq - Viral sequence entries, part 25.
2821. gbvrl26.seq - Viral sequence entries, part 26.
2822. gbvrl27.seq - Viral sequence entries, part 27.
2823. gbvrl28.seq - Viral sequence entries, part 28.
2824. gbvrl29.seq - Viral sequence entries, part 29.
2825. gbvrl3.seq - Viral sequence entries, part 3.
2826. gbvrl30.seq - Viral sequence entries, part 30.
2827. gbvrl31.seq - Viral sequence entries, part 31.
2828. gbvrl32.seq - Viral sequence entries, part 32.
2829. gbvrl33.seq - Viral sequence entries, part 33.
2830. gbvrl34.seq - Viral sequence entries, part 34.
2831. gbvrl35.seq - Viral sequence entries, part 35.
2832. gbvrl36.seq - Viral sequence entries, part 36.
2833. gbvrl37.seq - Viral sequence entries, part 37.
2834. gbvrl38.seq - Viral sequence entries, part 38.
2835. gbvrl39.seq - Viral sequence entries, part 39.
2836. gbvrl4.seq - Viral sequence entries, part 4.
2837. gbvrl40.seq - Viral sequence entries, part 40.
2838. gbvrl41.seq - Viral sequence entries, part 41.
2839. gbvrl42.seq - Viral sequence entries, part 42.
2840. gbvrl43.seq - Viral sequence entries, part 43.
2841. gbvrl44.seq - Viral sequence entries, part 44.
2842. gbvrl45.seq - Viral sequence entries, part 45.
2843. gbvrl46.seq - Viral sequence entries, part 46.
2844. gbvrl47.seq - Viral sequence entries, part 47.
2845. gbvrl48.seq - Viral sequence entries, part 48.
2846. gbvrl49.seq - Viral sequence entries, part 49.
2847. gbvrl5.seq - Viral sequence entries, part 5.
2848. gbvrl50.seq - Viral sequence entries, part 50.
2849. gbvrl6.seq - Viral sequence entries, part 6.
2850. gbvrl7.seq - Viral sequence entries, part 7.
2851. gbvrl8.seq - Viral sequence entries, part 8.
2852. gbvrl9.seq - Viral sequence entries, part 9.
2853. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2854. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2855. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2856. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2857. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2858. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2859. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2860. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2861. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2862. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2863. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2864. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2865. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2866. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2867. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2868. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2869. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2870. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2871. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2872. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2873. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2874. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2875. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2876. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2877. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2878. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2879. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2880. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2881. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2882. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2883. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2884. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2885. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2886. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2887. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2888. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2889. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2890. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2891. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2892. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2893. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2894. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2895. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2896. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2897. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2898. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2899. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2900. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2901. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2902. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2903. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2904. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2905. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2906. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2907. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2908. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2909. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2910. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2911. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2912. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2913. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2914. gbvrt65.seq - Other vertebrate sequence entries, part 65.
2915. gbvrt66.seq - Other vertebrate sequence entries, part 66.
2916. gbvrt67.seq - Other vertebrate sequence entries, part 67.
2917. gbvrt68.seq - Other vertebrate sequence entries, part 68.
2918. gbvrt69.seq - Other vertebrate sequence entries, part 69.
2919. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2920. gbvrt70.seq - Other vertebrate sequence entries, part 70.
2921. gbvrt71.seq - Other vertebrate sequence entries, part 71.
2922. gbvrt72.seq - Other vertebrate sequence entries, part 72.
2923. gbvrt73.seq - Other vertebrate sequence entries, part 73.
2924. gbvrt74.seq - Other vertebrate sequence entries, part 74.
2925. gbvrt75.seq - Other vertebrate sequence entries, part 75.
2926. gbvrt76.seq - Other vertebrate sequence entries, part 76.
2927. gbvrt77.seq - Other vertebrate sequence entries, part 77.
2928. gbvrt78.seq - Other vertebrate sequence entries, part 78.
2929. gbvrt79.seq - Other vertebrate sequence entries, part 79.
2930. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2931. gbvrt80.seq - Other vertebrate sequence entries, part 80.
2932. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 221.0 flatfiles require roughly 841 GB (sequence
files only) or 841 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249997812     gbbct1.seq
 212439006     gbbct10.seq
 244190644     gbbct100.seq
 249690527     gbbct101.seq
 241508299     gbbct102.seq
 244822462     gbbct103.seq
 241167034     gbbct104.seq
 242301032     gbbct105.seq
 248821990     gbbct106.seq
 247964762     gbbct107.seq
 246713580     gbbct108.seq
  58570566     gbbct109.seq
 102201125     gbbct11.seq
 244951418     gbbct110.seq
 246522126     gbbct111.seq
 240783673     gbbct112.seq
 242853380     gbbct113.seq
 242365577     gbbct114.seq
 242436790     gbbct115.seq
 243237447     gbbct116.seq
 244466731     gbbct117.seq
 246861818     gbbct118.seq
 247623317     gbbct119.seq
 245569206     gbbct12.seq
 245209832     gbbct120.seq
  42313590     gbbct121.seq
 241009171     gbbct122.seq
 241974689     gbbct123.seq
 247957281     gbbct124.seq
 245909858     gbbct125.seq
 243013381     gbbct126.seq
 249715889     gbbct127.seq
 240691803     gbbct128.seq
 234647548     gbbct129.seq
 236848560     gbbct13.seq
 249720351     gbbct130.seq
 179663842     gbbct131.seq
 243058380     gbbct132.seq
 241430483     gbbct133.seq
 243604811     gbbct134.seq
 239278573     gbbct135.seq
 246102618     gbbct136.seq
 249420803     gbbct137.seq
 245389811     gbbct138.seq
  55581024     gbbct139.seq
 245118629     gbbct14.seq
 244041850     gbbct140.seq
 241424723     gbbct141.seq
 243791931     gbbct142.seq
 249604591     gbbct143.seq
 241689266     gbbct144.seq
 246829915     gbbct145.seq
 247519184     gbbct146.seq
  15017248     gbbct147.seq
 241267602     gbbct148.seq
 242274259     gbbct149.seq
 242152377     gbbct15.seq
 241254593     gbbct150.seq
 245675590     gbbct151.seq
 248346558     gbbct152.seq
 247531541     gbbct153.seq
 239985113     gbbct154.seq
  23678419     gbbct155.seq
 246553114     gbbct156.seq
 244026129     gbbct157.seq
 240103193     gbbct158.seq
 249050572     gbbct159.seq
 243704214     gbbct16.seq
 249641603     gbbct160.seq
 244933745     gbbct161.seq
 247898708     gbbct162.seq
 249336516     gbbct163.seq
  21583910     gbbct164.seq
 241763959     gbbct165.seq
 245868115     gbbct166.seq
 245654345     gbbct167.seq
 239591716     gbbct168.seq
 244863664     gbbct169.seq
 248715170     gbbct17.seq
 241259292     gbbct170.seq
 247518974     gbbct171.seq
 148985471     gbbct172.seq
 240744632     gbbct173.seq
 247042018     gbbct174.seq
 249730383     gbbct175.seq
 249337429     gbbct176.seq
 244007754     gbbct177.seq
 248697080     gbbct178.seq
 249943196     gbbct179.seq
 246933137     gbbct18.seq
 245555752     gbbct180.seq
  61986517     gbbct181.seq
 249325361     gbbct182.seq
 249672011     gbbct183.seq
 242373605     gbbct184.seq
 242412790     gbbct185.seq
 244507215     gbbct186.seq
 243396823     gbbct187.seq
 240931778     gbbct188.seq
 248536618     gbbct189.seq
 245805251     gbbct19.seq
 248415188     gbbct190.seq
 242732953     gbbct191.seq
 248121859     gbbct192.seq
 241184549     gbbct193.seq
 249692027     gbbct194.seq
 244306329     gbbct195.seq
  35667441     gbbct196.seq
 243951044     gbbct197.seq
 240030040     gbbct198.seq
 243596613     gbbct199.seq
 242014468     gbbct2.seq
 246886970     gbbct20.seq
 249226867     gbbct200.seq
 249590638     gbbct201.seq
 242930431     gbbct202.seq
 244121452     gbbct203.seq
 241589167     gbbct204.seq
 245919940     gbbct205.seq
 249113942     gbbct206.seq
 242703591     gbbct207.seq
 243091446     gbbct208.seq
 245534072     gbbct209.seq
 249045968     gbbct21.seq
  15754012     gbbct210.seq
 246349049     gbbct211.seq
 246022782     gbbct212.seq
 246696265     gbbct213.seq
 247944133     gbbct214.seq
 249486201     gbbct215.seq
 240173473     gbbct216.seq
 239458381     gbbct217.seq
 178518582     gbbct218.seq
 244729443     gbbct219.seq
 241274245     gbbct22.seq
 243079926     gbbct220.seq
 242843124     gbbct221.seq
 248177784     gbbct222.seq
 238123575     gbbct223.seq
 249595745     gbbct224.seq
 249529523     gbbct225.seq
 243522522     gbbct226.seq
 249589932     gbbct227.seq
  13899626     gbbct228.seq
 243098032     gbbct229.seq
 236930070     gbbct23.seq
 239674307     gbbct230.seq
 245066804     gbbct231.seq
 249634647     gbbct232.seq
 244437800     gbbct233.seq
 248436146     gbbct234.seq
 241338438     gbbct235.seq
 242881326     gbbct236.seq
 242806155     gbbct237.seq
  63933363     gbbct238.seq
 249968996     gbbct239.seq
 243987751     gbbct24.seq
 246026514     gbbct240.seq
 249672365     gbbct241.seq
 249031157     gbbct242.seq
 242898162     gbbct243.seq
 245710415     gbbct244.seq
 246630473     gbbct245.seq
 245738164     gbbct246.seq
 244211900     gbbct247.seq
 247461225     gbbct248.seq
  93612754     gbbct249.seq
  80608925     gbbct25.seq
 237839620     gbbct250.seq
 246105582     gbbct251.seq
 237805372     gbbct252.seq
 249614595     gbbct253.seq
 246013238     gbbct254.seq
 224470333     gbbct255.seq
 247084974     gbbct256.seq
 245834764     gbbct257.seq
 243562330     gbbct258.seq
 245452506     gbbct259.seq
  21361218     gbbct26.seq
 249708148     gbbct260.seq
 240426913     gbbct261.seq
  66617755     gbbct262.seq
 248505916     gbbct263.seq
 249194384     gbbct264.seq
 248809322     gbbct265.seq
 245606289     gbbct266.seq
 236737420     gbbct267.seq
 248395110     gbbct268.seq
 249794470     gbbct269.seq
  38582609     gbbct27.seq
 245244181     gbbct270.seq
 239474977     gbbct271.seq
 244327509     gbbct272.seq
 241324223     gbbct273.seq
 239890065     gbbct274.seq
 246600840     gbbct275.seq
 248892008     gbbct276.seq
 246766292     gbbct277.seq
 243137808     gbbct278.seq
 247479238     gbbct279.seq
 238481414     gbbct28.seq
 244401941     gbbct280.seq
 247889871     gbbct281.seq
 241119935     gbbct282.seq
 244468470     gbbct283.seq
 243903932     gbbct284.seq
 149391327     gbbct285.seq
 249860172     gbbct286.seq
 248110836     gbbct287.seq
 232975787     gbbct288.seq
 247462623     gbbct289.seq
 242844193     gbbct29.seq
 245806476     gbbct290.seq
 245010832     gbbct291.seq
 242459150     gbbct292.seq
 162864645     gbbct293.seq
 248960275     gbbct294.seq
 248583686     gbbct295.seq
 248832331     gbbct296.seq
 247178125     gbbct297.seq
 249243605     gbbct298.seq
 248687878     gbbct299.seq
 248983496     gbbct3.seq
 240149183     gbbct30.seq
 248285593     gbbct300.seq
 243206809     gbbct301.seq
 243953577     gbbct302.seq
 229884526     gbbct303.seq
 179981582     gbbct304.seq
 246618731     gbbct305.seq
  59045444     gbbct306.seq
   6831045     gbbct307.seq
  14103555     gbbct308.seq
  22748410     gbbct309.seq
 246548744     gbbct31.seq
  44381239     gbbct310.seq
  86366091     gbbct311.seq
 168073686     gbbct312.seq
 249998228     gbbct313.seq
 249884503     gbbct314.seq
 245880628     gbbct315.seq
 245549336     gbbct316.seq
 248944046     gbbct317.seq
 248162642     gbbct318.seq
 244183985     gbbct319.seq
 245894449     gbbct32.seq
 244104986     gbbct320.seq
 249999398     gbbct321.seq
 249998721     gbbct322.seq
  19797482     gbbct323.seq
 248637470     gbbct324.seq
 244383589     gbbct325.seq
 249044972     gbbct326.seq
 249999877     gbbct327.seq
 248161425     gbbct328.seq
 249998617     gbbct329.seq
 249518771     gbbct33.seq
 249999638     gbbct330.seq
 224596267     gbbct331.seq
 249994836     gbbct332.seq
 249999531     gbbct333.seq
 249999421     gbbct334.seq
  37387705     gbbct335.seq
 249999148     gbbct336.seq
 249998806     gbbct337.seq
  80760850     gbbct338.seq
 249994324     gbbct339.seq
 246134545     gbbct34.seq
 249945959     gbbct340.seq
 107724019     gbbct341.seq
 249971334     gbbct342.seq
 140439236     gbbct343.seq
 249797189     gbbct344.seq
 249952108     gbbct345.seq
 249691848     gbbct346.seq
 244073242     gbbct347.seq
 246046786     gbbct348.seq
 245923138     gbbct349.seq
 242475743     gbbct35.seq
 241491766     gbbct350.seq
 242732148     gbbct351.seq
 246937252     gbbct352.seq
  73322094     gbbct353.seq
 242374924     gbbct354.seq
 242743673     gbbct355.seq
 249283114     gbbct356.seq
 244988380     gbbct357.seq
 248834240     gbbct358.seq
 247755026     gbbct359.seq
 178904842     gbbct36.seq
 242269135     gbbct360.seq
 244026227     gbbct361.seq
 240528070     gbbct362.seq
 247110780     gbbct363.seq
 246214187     gbbct364.seq
 219948280     gbbct365.seq
 243483790     gbbct366.seq
   3285770     gbbct367.seq
 223180728     gbbct368.seq
 200970337     gbbct369.seq
 249772570     gbbct37.seq
 215531946     gbbct370.seq
 223326709     gbbct371.seq
 237955592     gbbct372.seq
 239294004     gbbct373.seq
 244306298     gbbct374.seq
 134166095     gbbct375.seq
 188639804     gbbct376.seq
 270763089     gbbct377.seq
 236507577     gbbct378.seq
 205730003     gbbct379.seq
 245216616     gbbct38.seq
 183733006     gbbct380.seq
 205400684     gbbct381.seq
 243073095     gbbct382.seq
 186948147     gbbct383.seq
 203009767     gbbct384.seq
 144638510     gbbct385.seq
 149575862     gbbct386.seq
 195820674     gbbct387.seq
 172002128     gbbct388.seq
 201915323     gbbct389.seq
 246908906     gbbct39.seq
 200501503     gbbct390.seq
  87532539     gbbct391.seq
 248864576     gbbct4.seq
 248715994     gbbct40.seq
 240139219     gbbct41.seq
 247363964     gbbct42.seq
 238146903     gbbct43.seq
 248620387     gbbct44.seq
 249758024     gbbct45.seq
 247753498     gbbct46.seq
 246732524     gbbct47.seq
 244482216     gbbct48.seq
 116082071     gbbct49.seq
 249963954     gbbct5.seq
 245316186     gbbct50.seq
 239965684     gbbct51.seq
 243797198     gbbct52.seq
 246827033     gbbct53.seq
 249206263     gbbct54.seq
 248428188     gbbct55.seq
 245611043     gbbct56.seq
 243530947     gbbct57.seq
 249938158     gbbct58.seq
 247966636     gbbct59.seq
  40300046     gbbct6.seq
 249559144     gbbct60.seq
 243878271     gbbct61.seq
 240165646     gbbct62.seq
 249557493     gbbct63.seq
 249998436     gbbct64.seq
 242573578     gbbct65.seq
 249165703     gbbct66.seq
 246719258     gbbct67.seq
 244405889     gbbct68.seq
 242760622     gbbct69.seq
 249770099     gbbct7.seq
 249982641     gbbct70.seq
 247124168     gbbct71.seq
 244747554     gbbct72.seq
 249639403     gbbct73.seq
 247348162     gbbct74.seq
   4108412     gbbct75.seq
 244230369     gbbct76.seq
 247972809     gbbct77.seq
 249362143     gbbct78.seq
 240279429     gbbct79.seq
 143467320     gbbct8.seq
 249670039     gbbct80.seq
 247055846     gbbct81.seq
 244594512     gbbct82.seq
 249789616     gbbct83.seq
 238886077     gbbct84.seq
 248633923     gbbct85.seq
 249773945     gbbct86.seq
 247795868     gbbct87.seq
 248440013     gbbct88.seq
  22803063     gbbct89.seq
 246785106     gbbct9.seq
 245122918     gbbct90.seq
 248417710     gbbct91.seq
 244246389     gbbct92.seq
 245114608     gbbct93.seq
 248209754     gbbct94.seq
 240342508     gbbct95.seq
 241744580     gbbct96.seq
 246700557     gbbct97.seq
 249734496     gbbct98.seq
 239894668     gbbct99.seq
   2785686     gbchg.txt
 247048598     gbcon1.seq
 249993616     gbcon10.seq
  48471727     gbcon100.seq
 249995058     gbcon101.seq
 249995292     gbcon102.seq
 249999081     gbcon103.seq
 249996003     gbcon104.seq
 249997161     gbcon105.seq
   9912200     gbcon106.seq
 249999865     gbcon107.seq
 249997281     gbcon108.seq
 249998854     gbcon109.seq
 247757181     gbcon11.seq
 249998474     gbcon110.seq
 187377117     gbcon111.seq
 249993476     gbcon112.seq
 249996617     gbcon113.seq
 249996794     gbcon114.seq
 249995754     gbcon115.seq
 249995024     gbcon116.seq
 114605876     gbcon117.seq
 249997526     gbcon118.seq
 249996436     gbcon119.seq
 249445060     gbcon12.seq
 249997759     gbcon120.seq
 249997192     gbcon121.seq
 249996943     gbcon122.seq
 136128497     gbcon123.seq
 249998114     gbcon124.seq
 249995914     gbcon125.seq
 249999832     gbcon126.seq
 222788052     gbcon127.seq
 173591655     gbcon128.seq
 249996463     gbcon129.seq
 248095195     gbcon13.seq
 249997575     gbcon130.seq
  45106383     gbcon131.seq
 249999603     gbcon132.seq
 249983531     gbcon133.seq
 203591373     gbcon134.seq
 199346006     gbcon135.seq
 249841767     gbcon136.seq
 249611925     gbcon137.seq
 249998936     gbcon138.seq
 249999162     gbcon139.seq
 247415159     gbcon14.seq
 249997540     gbcon140.seq
 126473604     gbcon141.seq
 250000136     gbcon142.seq
 249414186     gbcon143.seq
 244775416     gbcon144.seq
 244013501     gbcon145.seq
 249998477     gbcon146.seq
 249862330     gbcon147.seq
 249993450     gbcon148.seq
  85451615     gbcon149.seq
 245353383     gbcon15.seq
 249999726     gbcon150.seq
 249995880     gbcon151.seq
 249953786     gbcon152.seq
 249991271     gbcon153.seq
 249984215     gbcon154.seq
 249998099     gbcon155.seq
 249999517     gbcon156.seq
 249996338     gbcon157.seq
  50733734     gbcon158.seq
 249562806     gbcon159.seq
 241244195     gbcon16.seq
 250000176     gbcon160.seq
 249998570     gbcon161.seq
 249999817     gbcon162.seq
 131008351     gbcon163.seq
 249998777     gbcon164.seq
 249999227     gbcon165.seq
 249996522     gbcon166.seq
 250000231     gbcon167.seq
 250000179     gbcon168.seq
 249999841     gbcon169.seq
 249972400     gbcon17.seq
 249999335     gbcon170.seq
 163401104     gbcon171.seq
 249999170     gbcon172.seq
 250000067     gbcon173.seq
 249998022     gbcon174.seq
 249997221     gbcon175.seq
 168829507     gbcon176.seq
 250000153     gbcon177.seq
 249997963     gbcon178.seq
 249117591     gbcon179.seq
 249256227     gbcon18.seq
 249969131     gbcon180.seq
 249999719     gbcon181.seq
 249880088     gbcon182.seq
 249794164     gbcon183.seq
 249842269     gbcon184.seq
 249998535     gbcon185.seq
  66673812     gbcon186.seq
 250000186     gbcon187.seq
 249999748     gbcon188.seq
 249998058     gbcon189.seq
 249621162     gbcon19.seq
 249998837     gbcon190.seq
 249948963     gbcon191.seq
 249997761     gbcon192.seq
  15149027     gbcon193.seq
 249999760     gbcon194.seq
 249999061     gbcon195.seq
 249666980     gbcon196.seq
 249999304     gbcon197.seq
 222615012     gbcon198.seq
 249999007     gbcon199.seq
 249771117     gbcon2.seq
 248803733     gbcon20.seq
 249566208     gbcon200.seq
 249859705     gbcon201.seq
 249997139     gbcon202.seq
 250000201     gbcon203.seq
 249996770     gbcon204.seq
 249978577     gbcon205.seq
 186876138     gbcon206.seq
 249995329     gbcon207.seq
 249998874     gbcon208.seq
 249998513     gbcon209.seq
 234033264     gbcon21.seq
 249999827     gbcon210.seq
 198324129     gbcon211.seq
 249997291     gbcon212.seq
 249999410     gbcon213.seq
 249999214     gbcon214.seq
 249998643     gbcon215.seq
 156392473     gbcon216.seq
 249997360     gbcon217.seq
 249995783     gbcon218.seq
 249997727     gbcon219.seq
 248113426     gbcon22.seq
 249999285     gbcon220.seq
 249999172     gbcon221.seq
 235649214     gbcon222.seq
 249986231     gbcon223.seq
 249997856     gbcon224.seq
 249998592     gbcon225.seq
 249999631     gbcon226.seq
 249986919     gbcon227.seq
 249993864     gbcon228.seq
 168163636     gbcon229.seq
 217559515     gbcon23.seq
 249997803     gbcon230.seq
 249992491     gbcon231.seq
 249997847     gbcon232.seq
 249997197     gbcon233.seq
 216484831     gbcon234.seq
 249999114     gbcon235.seq
 249991115     gbcon236.seq
 249999065     gbcon237.seq
 249078482     gbcon238.seq
 101392183     gbcon239.seq
 249997270     gbcon24.seq
 249998892     gbcon240.seq
 249999815     gbcon241.seq
 249994172     gbcon242.seq
 250000259     gbcon243.seq
 249998992     gbcon244.seq
 167143510     gbcon245.seq
 249994035     gbcon246.seq
 249073811     gbcon247.seq
 249998129     gbcon248.seq
 249742667     gbcon249.seq
 249996301     gbcon25.seq
 249991105     gbcon250.seq
 246011029     gbcon251.seq
 249999437     gbcon252.seq
 249195438     gbcon253.seq
 249959685     gbcon254.seq
 249998222     gbcon255.seq
 249931874     gbcon256.seq
 250000023     gbcon257.seq
 249998946     gbcon258.seq
 114555125     gbcon259.seq
 249999417     gbcon26.seq
 249997409     gbcon260.seq
 249971319     gbcon261.seq
 249954513     gbcon262.seq
 249998978     gbcon263.seq
 249966342     gbcon264.seq
 249999622     gbcon265.seq
 170023714     gbcon266.seq
 249997854     gbcon267.seq
 249994942     gbcon268.seq
 250000007     gbcon269.seq
 249999251     gbcon27.seq
 249790283     gbcon270.seq
 249998855     gbcon271.seq
 249825620     gbcon272.seq
 249997672     gbcon273.seq
   8730675     gbcon274.seq
 249999844     gbcon275.seq
 249991507     gbcon276.seq
 249998784     gbcon277.seq
 249999924     gbcon278.seq
 249996597     gbcon279.seq
 249998831     gbcon28.seq
 104911921     gbcon280.seq
 250000006     gbcon281.seq
 249993928     gbcon282.seq
 250000212     gbcon283.seq
 249981030     gbcon284.seq
 249994604     gbcon285.seq
 104113954     gbcon286.seq
 249999855     gbcon287.seq
 249844717     gbcon288.seq
 249998488     gbcon289.seq
 249999393     gbcon29.seq
 249998569     gbcon290.seq
 249998118     gbcon291.seq
 109686111     gbcon292.seq
 250000025     gbcon293.seq
 249998630     gbcon294.seq
 249802308     gbcon295.seq
 249997831     gbcon296.seq
 249993757     gbcon297.seq
 249998471     gbcon298.seq
 129494379     gbcon299.seq
 249929057     gbcon3.seq
  80986649     gbcon30.seq
 249873034     gbcon300.seq
 249979533     gbcon301.seq
 249670066     gbcon302.seq
 249966235     gbcon303.seq
 249995747     gbcon304.seq
 249922946     gbcon305.seq
 249986320     gbcon306.seq
 216476163     gbcon307.seq
 249998940     gbcon308.seq
 249987801     gbcon309.seq
 249998890     gbcon31.seq
 249939952     gbcon310.seq
 249992035     gbcon311.seq
 249929859     gbcon312.seq
 249999037     gbcon313.seq
  55307593     gbcon314.seq
 249989790     gbcon315.seq
 249999707     gbcon316.seq
 249997458     gbcon317.seq
 249999711     gbcon318.seq
 249999304     gbcon319.seq
 249999804     gbcon32.seq
 249994197     gbcon320.seq
 249999105     gbcon321.seq
  25606629     gbcon322.seq
 250000253     gbcon323.seq
 250000174     gbcon324.seq
 250000096     gbcon325.seq
 249248548     gbcon326.seq
 249728950     gbcon327.seq
 249962249     gbcon328.seq
 249984503     gbcon329.seq
 249999148     gbcon33.seq
 249997295     gbcon330.seq
 165024350     gbcon331.seq
 249999347     gbcon332.seq
 249998453     gbcon333.seq
 249453596     gbcon334.seq
 249996447     gbcon335.seq
 125802579     gbcon336.seq
 249560188     gbcon337.seq
 249996377     gbcon338.seq
 249792492     gbcon339.seq
 249999869     gbcon34.seq
 249996699     gbcon340.seq
 249965894     gbcon341.seq
 249999366     gbcon342.seq
 249998941     gbcon343.seq
  31340750     gbcon344.seq
 250000041     gbcon345.seq
 249998616     gbcon346.seq
 249999761     gbcon347.seq
 249999436     gbcon348.seq
  37638463     gbcon349.seq
 247342310     gbcon35.seq
 249999246     gbcon350.seq
 249998030     gbcon351.seq
 249947742     gbcon352.seq
 249972136     gbcon353.seq
 249999351     gbcon354.seq
 249941792     gbcon355.seq
 249999512     gbcon356.seq
 249999867     gbcon357.seq
 240418938     gbcon358.seq
     18787     gbcon359.seq
 248844640     gbcon36.seq
 249981802     gbcon37.seq
  38588250     gbcon38.seq
 249997284     gbcon39.seq
 249994905     gbcon4.seq
 249483126     gbcon40.seq
 125744383     gbcon41.seq
 126402123     gbcon42.seq
 249991267     gbcon43.seq
 249954159     gbcon44.seq
 249996614     gbcon45.seq
 249998856     gbcon46.seq
 112466401     gbcon47.seq
 249999520     gbcon48.seq
 250000158     gbcon49.seq
 249996532     gbcon5.seq
 249997942     gbcon50.seq
 249996661     gbcon51.seq
 249999309     gbcon52.seq
 197802191     gbcon53.seq
 249995009     gbcon54.seq
 249998243     gbcon55.seq
 249997153     gbcon56.seq
 249998312     gbcon57.seq
 249999774     gbcon58.seq
 249998166     gbcon59.seq
 249997726     gbcon6.seq
  41929642     gbcon60.seq
 249997971     gbcon61.seq
 249998523     gbcon62.seq
 249994641     gbcon63.seq
 249997127     gbcon64.seq
 249999662     gbcon65.seq
  27021264     gbcon66.seq
 249996783     gbcon67.seq
 249999817     gbcon68.seq
 249998382     gbcon69.seq
 178915949     gbcon7.seq
 249995556     gbcon70.seq
 249997081     gbcon71.seq
  20620805     gbcon72.seq
 249994608     gbcon73.seq
 249995334     gbcon74.seq
 249996443     gbcon75.seq
 249996717     gbcon76.seq
 249997080     gbcon77.seq
 135388982     gbcon78.seq
 249999204     gbcon79.seq
 249992520     gbcon8.seq
 249998450     gbcon80.seq
 249998272     gbcon81.seq
 249997459     gbcon82.seq
 176584001     gbcon83.seq
 249996314     gbcon84.seq
 249999452     gbcon85.seq
 249994925     gbcon86.seq
 249997508     gbcon87.seq
 238783867     gbcon88.seq
 249999844     gbcon89.seq
 249909238     gbcon9.seq
 249998048     gbcon90.seq
 250000106     gbcon91.seq
 249995283     gbcon92.seq
 249993884     gbcon93.seq
  85705140     gbcon94.seq
 249995498     gbcon95.seq
 249995014     gbcon96.seq
 249999777     gbcon97.seq
 249995148     gbcon98.seq
 250000101     gbcon99.seq
    219486     gbdel.txt
 249998975     gbenv1.seq
 249999162     gbenv10.seq
 249999520     gbenv11.seq
 250000140     gbenv12.seq
  53551219     gbenv13.seq
 249999753     gbenv14.seq
 249999543     gbenv15.seq
 249998064     gbenv16.seq
 249998725     gbenv17.seq
 249998186     gbenv18.seq
 249999285     gbenv19.seq
 249998921     gbenv2.seq
 249999537     gbenv20.seq
 245122157     gbenv21.seq
 249999212     gbenv22.seq
 249999152     gbenv23.seq
 249998425     gbenv24.seq
 249999964     gbenv25.seq
 175016236     gbenv26.seq
 249997697     gbenv27.seq
 249878332     gbenv28.seq
 249998524     gbenv29.seq
 249998758     gbenv3.seq
 249999110     gbenv30.seq
 249998460     gbenv31.seq
 249998911     gbenv32.seq
  67174091     gbenv33.seq
 249997840     gbenv34.seq
 249998622     gbenv35.seq
 249999094     gbenv36.seq
 249999911     gbenv37.seq
 181640505     gbenv38.seq
 249998010     gbenv39.seq
 249998019     gbenv4.seq
 249999255     gbenv40.seq
 249999765     gbenv41.seq
 249999045     gbenv42.seq
 249999483     gbenv43.seq
 249999270     gbenv44.seq
  46227654     gbenv45.seq
 249999262     gbenv46.seq
 249998952     gbenv47.seq
 249999981     gbenv48.seq
 249999953     gbenv49.seq
 244637358     gbenv5.seq
 192008212     gbenv50.seq
 249998586     gbenv51.seq
 249996791     gbenv52.seq
 249998634     gbenv53.seq
 249998224     gbenv54.seq
 249998120     gbenv55.seq
  83029728     gbenv56.seq
 249999397     gbenv57.seq
 249997852     gbenv58.seq
 249949885     gbenv59.seq
 249998745     gbenv6.seq
 249998510     gbenv60.seq
 249999058     gbenv61.seq
 213091911     gbenv62.seq
 250000119     gbenv63.seq
 249999936     gbenv64.seq
 249998389     gbenv65.seq
 250000033     gbenv66.seq
 249997133     gbenv67.seq
  84586178     gbenv68.seq
 249997033     gbenv69.seq
 249999466     gbenv7.seq
 249999978     gbenv70.seq
 249945210     gbenv71.seq
 249998855     gbenv72.seq
 249931353     gbenv73.seq
 143500301     gbenv74.seq
 249999720     gbenv75.seq
 249999963     gbenv76.seq
 249998644     gbenv77.seq
 249999769     gbenv78.seq
 249997528     gbenv79.seq
 194128307     gbenv8.seq
  88903113     gbenv80.seq
 249999681     gbenv81.seq
 249999769     gbenv82.seq
 249998280     gbenv83.seq
 250000264     gbenv84.seq
 235218115     gbenv85.seq
 249998642     gbenv86.seq
 250000104     gbenv87.seq
 250000179     gbenv88.seq
 249996844     gbenv89.seq
 249998171     gbenv9.seq
 249998593     gbenv90.seq
  99897357     gbenv91.seq
 250000221     gbenv92.seq
 249966232     gbenv93.seq
 249965377     gbenv94.seq
 249998396     gbenv95.seq
 250000189     gbenv96.seq
 249998874     gbenv97.seq
 249999301     gbenv98.seq
   1766863     gbenv99.seq
 524291709     gbest1.seq
 524290277     gbest10.seq
 524289519     gbest100.seq
 524290928     gbest101.seq
 524290452     gbest102.seq
 524291269     gbest103.seq
 324612513     gbest104.seq
 524290182     gbest105.seq
 524290859     gbest106.seq
 524290670     gbest107.seq
 381846367     gbest108.seq
 385036642     gbest109.seq
 524289785     gbest11.seq
 379178955     gbest110.seq
 379762555     gbest111.seq
 376681647     gbest112.seq
 380970518     gbest113.seq
 385571277     gbest114.seq
 383979816     gbest115.seq
 383046098     gbest116.seq
 379514962     gbest117.seq
 402947158     gbest118.seq
 488301143     gbest119.seq
 524289962     gbest12.seq
 524290377     gbest120.seq
 524288866     gbest121.seq
 524292187     gbest122.seq
 524292072     gbest123.seq
 447677219     gbest124.seq
 524289155     gbest125.seq
 524289576     gbest126.seq
 524289408     gbest127.seq
 524290382     gbest128.seq
 524291061     gbest129.seq
 117721487     gbest13.seq
 524290715     gbest130.seq
 524290731     gbest131.seq
 524292419     gbest132.seq
 524288790     gbest133.seq
 524290792     gbest134.seq
 524291567     gbest135.seq
 524289019     gbest136.seq
 263324531     gbest137.seq
 524289559     gbest138.seq
 524289451     gbest139.seq
 524290111     gbest14.seq
 524289614     gbest140.seq
 524289116     gbest141.seq
 524293286     gbest142.seq
 524291528     gbest143.seq
 524289430     gbest144.seq
 524290752     gbest145.seq
 524292082     gbest146.seq
 524290188     gbest147.seq
 524289402     gbest148.seq
 524292581     gbest149.seq
 524290300     gbest15.seq
 524289527     gbest150.seq
 453922609     gbest151.seq
 524290037     gbest152.seq
 524291562     gbest153.seq
 524290377     gbest154.seq
 524290692     gbest155.seq
 524289108     gbest156.seq
 524289583     gbest157.seq
 524290283     gbest158.seq
 524296120     gbest159.seq
 524290173     gbest16.seq
 524291686     gbest160.seq
 524291116     gbest161.seq
 524290083     gbest162.seq
 524290179     gbest163.seq
 211665803     gbest164.seq
 524288901     gbest165.seq
 524290782     gbest166.seq
 524289913     gbest167.seq
 524292094     gbest168.seq
 524291315     gbest169.seq
 524290145     gbest17.seq
 524291729     gbest170.seq
 524290532     gbest171.seq
 524291774     gbest172.seq
 524289376     gbest173.seq
 524288829     gbest174.seq
 524289934     gbest175.seq
 524289569     gbest176.seq
 524290780     gbest177.seq
  65582199     gbest178.seq
 524290703     gbest179.seq
 524290570     gbest18.seq
 524290849     gbest180.seq
 524289166     gbest181.seq
 524289609     gbest182.seq
 524289672     gbest183.seq
 524289921     gbest184.seq
 524291149     gbest185.seq
 524288761     gbest186.seq
 524288894     gbest187.seq
 524290377     gbest188.seq
 524289811     gbest189.seq
 524289029     gbest19.seq
 524290830     gbest190.seq
 431558618     gbest191.seq
 524289597     gbest192.seq
 524291674     gbest193.seq
 524292530     gbest194.seq
 524291621     gbest195.seq
 524291368     gbest196.seq
 524291306     gbest197.seq
 524291545     gbest198.seq
 524289628     gbest199.seq
 524290111     gbest2.seq
 524290173     gbest20.seq
 524291321     gbest200.seq
 524288736     gbest201.seq
 524290668     gbest202.seq
 524289134     gbest203.seq
 524289436     gbest204.seq
  13987262     gbest205.seq
 524289211     gbest206.seq
 524289653     gbest207.seq
 524290915     gbest208.seq
 524289675     gbest209.seq
 524290005     gbest21.seq
 524291229     gbest210.seq
 524290700     gbest211.seq
 524291174     gbest212.seq
 524293104     gbest213.seq
 524290288     gbest214.seq
 524290109     gbest215.seq
 444562633     gbest216.seq
 524290389     gbest217.seq
 524289226     gbest218.seq
 524291079     gbest219.seq
 483861137     gbest22.seq
 524291749     gbest220.seq
 524291565     gbest221.seq
 524297328     gbest222.seq
 524291733     gbest223.seq
 524289798     gbest224.seq
 524290117     gbest225.seq
 524290043     gbest226.seq
 524290638     gbest227.seq
 524291794     gbest228.seq
 431825005     gbest229.seq
 491300859     gbest23.seq
 524292596     gbest230.seq
 524291128     gbest231.seq
 524290595     gbest232.seq
 524292438     gbest233.seq
 524289611     gbest234.seq
 524290671     gbest235.seq
 524289321     gbest236.seq
 524291883     gbest237.seq
 524290758     gbest238.seq
 524291786     gbest239.seq
 501207905     gbest24.seq
 524292619     gbest240.seq
 524291735     gbest241.seq
 524289614     gbest242.seq
 524289873     gbest243.seq
 222121567     gbest244.seq
 524291601     gbest245.seq
 524292355     gbest246.seq
 524288781     gbest247.seq
 524290256     gbest248.seq
 524289126     gbest249.seq
 308061824     gbest25.seq
 524289064     gbest250.seq
 524288922     gbest251.seq
 512209571     gbest252.seq
 524289480     gbest253.seq
 524292053     gbest254.seq
 524290288     gbest255.seq
 313661545     gbest256.seq
 524289314     gbest257.seq
 524291981     gbest258.seq
 524291351     gbest259.seq
 524289024     gbest26.seq
 524291700     gbest260.seq
 524289589     gbest261.seq
 524289443     gbest262.seq
 524289415     gbest263.seq
 524291806     gbest264.seq
 524289080     gbest265.seq
 524289203     gbest266.seq
 190438790     gbest267.seq
 524288976     gbest268.seq
 524289033     gbest269.seq
 524291216     gbest27.seq
 524289244     gbest270.seq
 524292403     gbest271.seq
 524290312     gbest272.seq
 524291309     gbest273.seq
 524288852     gbest274.seq
 524292357     gbest275.seq
 524291321     gbest276.seq
 524289879     gbest277.seq
 524289056     gbest278.seq
 342232612     gbest279.seq
 524292866     gbest28.seq
 524291412     gbest280.seq
 524289813     gbest281.seq
 524291282     gbest282.seq
 524290305     gbest283.seq
 524289704     gbest284.seq
 524288897     gbest285.seq
 524289270     gbest286.seq
 524291181     gbest287.seq
 524291449     gbest288.seq
 524290270     gbest289.seq
 524291040     gbest29.seq
 524289630     gbest290.seq
 260063130     gbest291.seq
 524293457     gbest292.seq
 524289414     gbest293.seq
 524291485     gbest294.seq
 524291162     gbest295.seq
 524290396     gbest296.seq
 524289050     gbest297.seq
 524290677     gbest298.seq
 524288831     gbest299.seq
 488711690     gbest3.seq
 524289390     gbest30.seq
 524290784     gbest300.seq
 524290007     gbest301.seq
 466911719     gbest302.seq
 299077842     gbest303.seq
 472922408     gbest304.seq
 470052480     gbest305.seq
 524290478     gbest306.seq
 524291137     gbest307.seq
 524291082     gbest308.seq
 524292570     gbest309.seq
 524290909     gbest31.seq
 524291840     gbest310.seq
 524291260     gbest311.seq
 524288844     gbest312.seq
 524291602     gbest313.seq
 524291431     gbest314.seq
 524288776     gbest315.seq
 354549235     gbest316.seq
 524290269     gbest317.seq
 524291097     gbest318.seq
 524290175     gbest319.seq
 524290819     gbest32.seq
 524291407     gbest320.seq
 524289695     gbest321.seq
 524288786     gbest322.seq
 524290408     gbest323.seq
 524291940     gbest324.seq
 524288759     gbest325.seq
 524291619     gbest326.seq
 524291109     gbest327.seq
 513990601     gbest328.seq
 514468410     gbest329.seq
 524290259     gbest33.seq
 202509203     gbest330.seq
 524288748     gbest331.seq
 524290597     gbest332.seq
 524292392     gbest333.seq
 524290362     gbest334.seq
 524288977     gbest335.seq
 524291376     gbest336.seq
 493814119     gbest337.seq
 524289153     gbest338.seq
 524289806     gbest339.seq
 503510490     gbest34.seq
 524292447     gbest340.seq
 524290198     gbest341.seq
 524288758     gbest342.seq
 524292529     gbest343.seq
 307333249     gbest344.seq
 524288954     gbest345.seq
 524290020     gbest346.seq
 524289554     gbest347.seq
 524291066     gbest348.seq
 524288736     gbest349.seq
 485111820     gbest35.seq
 524289946     gbest350.seq
 509073558     gbest351.seq
 524291612     gbest352.seq
 524294067     gbest353.seq
 524290620     gbest354.seq
 524292677     gbest355.seq
 524292569     gbest356.seq
 524290768     gbest357.seq
 524291023     gbest358.seq
 113281351     gbest359.seq
 486899315     gbest36.seq
 524289289     gbest360.seq
 524289795     gbest361.seq
 524289430     gbest362.seq
 524290615     gbest363.seq
 524290209     gbest364.seq
 524290322     gbest365.seq
 524290222     gbest366.seq
 524288748     gbest367.seq
 524288809     gbest368.seq
 524290777     gbest369.seq
 485900427     gbest37.seq
 524290634     gbest370.seq
  35401171     gbest371.seq
 524289164     gbest372.seq
 524289451     gbest373.seq
 524291816     gbest374.seq
 524289829     gbest375.seq
 524289880     gbest376.seq
 524290797     gbest377.seq
 484764145     gbest378.seq
 524292637     gbest379.seq
 480383842     gbest38.seq
 524290336     gbest380.seq
 524291534     gbest381.seq
 524289606     gbest382.seq
 243257693     gbest383.seq
 524289638     gbest384.seq
 524289705     gbest385.seq
 524289597     gbest386.seq
 524290882     gbest387.seq
 524289362     gbest388.seq
 524290204     gbest389.seq
 485066885     gbest39.seq
 524289421     gbest390.seq
 524290903     gbest391.seq
 524290107     gbest392.seq
 524289507     gbest393.seq
 132091690     gbest394.seq
 524289745     gbest395.seq
 524291123     gbest396.seq
 524291025     gbest397.seq
 524291602     gbest398.seq
 524290825     gbest399.seq
 524290877     gbest4.seq
 118055716     gbest40.seq
 524290011     gbest400.seq
 524292344     gbest401.seq
 524289586     gbest402.seq
 524291811     gbest403.seq
 524288753     gbest404.seq
 524290688     gbest405.seq
 524290729     gbest406.seq
 370264901     gbest407.seq
 524289046     gbest408.seq
 524289000     gbest409.seq
 524291523     gbest41.seq
 524291003     gbest410.seq
 524290382     gbest411.seq
 524289195     gbest412.seq
 524290143     gbest413.seq
 524290918     gbest414.seq
 524288820     gbest415.seq
 524291714     gbest416.seq
 524290463     gbest417.seq
 524288977     gbest418.seq
 524290964     gbest419.seq
 522434125     gbest42.seq
 494358186     gbest420.seq
 524289877     gbest421.seq
 524292061     gbest422.seq
 524289480     gbest423.seq
 524292719     gbest424.seq
 524290987     gbest425.seq
 524291020     gbest426.seq
 524292619     gbest427.seq
 524292474     gbest428.seq
 524290802     gbest429.seq
 524288847     gbest43.seq
 524291771     gbest430.seq
 524289312     gbest431.seq
 524288893     gbest432.seq
 524289526     gbest433.seq
 524290373     gbest434.seq
 161539793     gbest435.seq
 524290237     gbest436.seq
 524290869     gbest437.seq
 524294050     gbest438.seq
 524290837     gbest439.seq
 524290099     gbest44.seq
 524289174     gbest440.seq
 524289480     gbest441.seq
 524289222     gbest442.seq
 524291767     gbest443.seq
 524291017     gbest444.seq
 524290310     gbest445.seq
 524289651     gbest446.seq
 524290594     gbest447.seq
  64587826     gbest448.seq
 524290160     gbest449.seq
 524290632     gbest45.seq
 524289943     gbest450.seq
 524289567     gbest451.seq
 524289281     gbest452.seq
 524290128     gbest453.seq
 524289517     gbest454.seq
 524289494     gbest455.seq
 524291067     gbest456.seq
 524290824     gbest457.seq
 524289195     gbest458.seq
 524291344     gbest459.seq
 524290429     gbest46.seq
  28446917     gbest460.seq
 524290500     gbest461.seq
 524289991     gbest462.seq
 524291677     gbest463.seq
 524289865     gbest464.seq
 524290839     gbest465.seq
 524290101     gbest466.seq
 524289504     gbest467.seq
 524290774     gbest468.seq
 524291927     gbest469.seq
 524290075     gbest47.seq
 524290182     gbest470.seq
 524290885     gbest471.seq
 364013679     gbest472.seq
 524289964     gbest473.seq
 524290478     gbest474.seq
 524291422     gbest475.seq
 524289765     gbest476.seq
 524291786     gbest477.seq
 524289524     gbest478.seq
 524289031     gbest479.seq
 524289327     gbest48.seq
 524288795     gbest480.seq
 524289243     gbest481.seq
  98704139     gbest482.seq
 524291828     gbest49.seq
 524290096     gbest5.seq
 524290760     gbest50.seq
 524291736     gbest51.seq
 524290186     gbest52.seq
 524290480     gbest53.seq
 210327507     gbest54.seq
 524289021     gbest55.seq
 524290246     gbest56.seq
 524291094     gbest57.seq
 524289936     gbest58.seq
 524291483     gbest59.seq
 524288934     gbest6.seq
 524290882     gbest60.seq
 524291197     gbest61.seq
 524290083     gbest62.seq
 524291699     gbest63.seq
 524290133     gbest64.seq
 524291045     gbest65.seq
 524291704     gbest66.seq
 418585559     gbest67.seq
 524293248     gbest68.seq
 524289575     gbest69.seq
 524289113     gbest7.seq
 524288900     gbest70.seq
 524289986     gbest71.seq
 524290260     gbest72.seq
 524288880     gbest73.seq
 524291436     gbest74.seq
 524288778     gbest75.seq
 524291148     gbest76.seq
 524292323     gbest77.seq
 524290920     gbest78.seq
 524289474     gbest79.seq
 524289238     gbest8.seq
 138626590     gbest80.seq
 524288901     gbest81.seq
 524291003     gbest82.seq
 524289021     gbest83.seq
 524289482     gbest84.seq
 524290754     gbest85.seq
 524290225     gbest86.seq
 524288748     gbest87.seq
 524291653     gbest88.seq
 524290421     gbest89.seq
 524289764     gbest9.seq
 524291552     gbest90.seq
 524289077     gbest91.seq
 420565761     gbest92.seq
 524291360     gbest93.seq
 524291021     gbest94.seq
 524291175     gbest95.seq
 524290051     gbest96.seq
 524291444     gbest97.seq
 524290568     gbest98.seq
 524289612     gbest99.seq
 524289548     gbgss1.seq
 524289774     gbgss10.seq
 524290287     gbgss100.seq
 524290771     gbgss101.seq
 524291791     gbgss102.seq
 524290101     gbgss103.seq
 385465867     gbgss104.seq
 524291879     gbgss105.seq
 524289376     gbgss106.seq
 524289871     gbgss107.seq
 524290242     gbgss108.seq
 524288816     gbgss109.seq
 524290990     gbgss11.seq
 524289936     gbgss110.seq
 524290516     gbgss111.seq
 524288853     gbgss112.seq
 524291249     gbgss113.seq
 524290527     gbgss114.seq
 524290177     gbgss115.seq
  20664736     gbgss116.seq
 524290572     gbgss117.seq
 524288891     gbgss118.seq
 524289027     gbgss119.seq
 524290376     gbgss12.seq
 524290356     gbgss120.seq
 524291116     gbgss121.seq
 524289117     gbgss122.seq
 524289120     gbgss123.seq
 524290796     gbgss124.seq
 524290276     gbgss125.seq
 524288958     gbgss126.seq
 524291912     gbgss127.seq
 524289421     gbgss128.seq
 168442206     gbgss129.seq
 524289800     gbgss13.seq
 524290211     gbgss130.seq
 524291326     gbgss131.seq
 524291290     gbgss132.seq
 524291077     gbgss133.seq
 524289322     gbgss134.seq
 524290361     gbgss135.seq
 524290299     gbgss136.seq
 524289985     gbgss137.seq
 524289349     gbgss138.seq
 496327803     gbgss139.seq
 524291246     gbgss14.seq
 494766060     gbgss140.seq
 160416303     gbgss141.seq
 524289637     gbgss142.seq
 524289281     gbgss143.seq
 524291150     gbgss144.seq
 524290512     gbgss145.seq
 524291270     gbgss146.seq
 524289338     gbgss147.seq
 524291525     gbgss148.seq
 524291086     gbgss149.seq
 524290940     gbgss15.seq
 524288822     gbgss150.seq
 524291381     gbgss151.seq
 294115814     gbgss152.seq
 524291696     gbgss153.seq
 524291252     gbgss154.seq
 524291031     gbgss155.seq
 524292508     gbgss156.seq
 524291184     gbgss157.seq
 524289720     gbgss158.seq
 524288730     gbgss159.seq
 524290142     gbgss16.seq
 524290230     gbgss160.seq
 524290309     gbgss161.seq
 524288911     gbgss162.seq
 524290145     gbgss163.seq
 524292203     gbgss164.seq
 100836569     gbgss165.seq
 524290236     gbgss166.seq
 524290617     gbgss167.seq
 524290402     gbgss168.seq
 524290835     gbgss169.seq
 524289331     gbgss17.seq
 524289872     gbgss170.seq
 524289461     gbgss171.seq
 524290401     gbgss172.seq
 524289931     gbgss173.seq
 340993080     gbgss174.seq
 249999307     gbgss175.seq
 249999803     gbgss176.seq
 249999034     gbgss177.seq
 250000188     gbgss178.seq
  27270082     gbgss179.seq
 524291157     gbgss18.seq
 250000220     gbgss180.seq
 249999312     gbgss181.seq
 249997128     gbgss182.seq
 249998262     gbgss183.seq
 219536183     gbgss184.seq
 250000046     gbgss185.seq
 249997736     gbgss186.seq
 249999841     gbgss187.seq
 249998432     gbgss188.seq
 189684925     gbgss189.seq
 272143299     gbgss19.seq
 249999911     gbgss190.seq
 249997779     gbgss191.seq
 249998992     gbgss192.seq
 249997543     gbgss193.seq
 249998328     gbgss194.seq
  66166938     gbgss195.seq
 249999740     gbgss196.seq
    537048     gbgss197.seq
  80022020     gbgss198.seq
 249998089     gbgss199.seq
 524289207     gbgss2.seq
 524290531     gbgss20.seq
 249998700     gbgss200.seq
  83350286     gbgss201.seq
 249998087     gbgss202.seq
 249999221     gbgss203.seq
 249998781     gbgss204.seq
 196741181     gbgss205.seq
 249999644     gbgss206.seq
 250000078     gbgss207.seq
 249998943     gbgss208.seq
 241194397     gbgss209.seq
 524289309     gbgss21.seq
 249998895     gbgss210.seq
 249998646     gbgss211.seq
 249999899     gbgss212.seq
 239478749     gbgss213.seq
 249999622     gbgss214.seq
 249999870     gbgss215.seq
 249996728     gbgss216.seq
 249997083     gbgss217.seq
 121251993     gbgss218.seq
 249999870     gbgss219.seq
 524289880     gbgss22.seq
 250000164     gbgss220.seq
 249998650     gbgss221.seq
 249998378     gbgss222.seq
  86638471     gbgss223.seq
 249999180     gbgss224.seq
 250000196     gbgss225.seq
 249998742     gbgss226.seq
 249998926     gbgss227.seq
 249999544     gbgss228.seq
 137711851     gbgss229.seq
 524292413     gbgss23.seq
 249999577     gbgss230.seq
 249999925     gbgss231.seq
 249999323     gbgss232.seq
 249997632     gbgss233.seq
  79228653     gbgss234.seq
 249997675     gbgss235.seq
 249998339     gbgss236.seq
 249999331     gbgss237.seq
 249999245     gbgss238.seq
 249997693     gbgss239.seq
 524291052     gbgss24.seq
 249997728     gbgss240.seq
  99502593     gbgss241.seq
 249998155     gbgss242.seq
 249999580     gbgss243.seq
 249999271     gbgss244.seq
  52447926     gbgss245.seq
  53076689     gbgss246.seq
 249998109     gbgss247.seq
 249998073     gbgss248.seq
 249999880     gbgss249.seq
 524291864     gbgss25.seq
 249999725     gbgss250.seq
 249998744     gbgss251.seq
 249997664     gbgss252.seq
 211852026     gbgss253.seq
 249997890     gbgss254.seq
 249999836     gbgss255.seq
 249998514     gbgss256.seq
 249998986     gbgss257.seq
  21316342     gbgss258.seq
 249997567     gbgss259.seq
 524291414     gbgss26.seq
 249999132     gbgss260.seq
 249996572     gbgss261.seq
 249998435     gbgss262.seq
 249997631     gbgss263.seq
 249998992     gbgss264.seq
 181964370     gbgss265.seq
 249998672     gbgss266.seq
 250000165     gbgss267.seq
 250000243     gbgss268.seq
 221699337     gbgss269.seq
 524289097     gbgss27.seq
 249999134     gbgss270.seq
 249998851     gbgss271.seq
 249998700     gbgss272.seq
 249999839     gbgss273.seq
 249999513     gbgss274.seq
 249999543     gbgss275.seq
 145308699     gbgss276.seq
 249997149     gbgss277.seq
 249998191     gbgss278.seq
 249999087     gbgss279.seq
 524292348     gbgss28.seq
 249998744     gbgss280.seq
 227218278     gbgss281.seq
 249997931     gbgss282.seq
 249997185     gbgss283.seq
 249999114     gbgss284.seq
 249999909     gbgss285.seq
 249998098     gbgss286.seq
 116181294     gbgss287.seq
 249999837     gbgss288.seq
 249998408     gbgss289.seq
 524289733     gbgss29.seq
 249998054     gbgss290.seq
 249997635     gbgss291.seq
 215534679     gbgss292.seq
 249998609     gbgss293.seq
 249998604     gbgss294.seq
 249999576     gbgss295.seq
 249998662     gbgss296.seq
  85129549     gbgss297.seq
 249999096     gbgss298.seq
 249998187     gbgss299.seq
 524289224     gbgss3.seq
 524289327     gbgss30.seq
 249997655     gbgss300.seq
 249997711     gbgss301.seq
 249998095     gbgss302.seq
 249998419     gbgss303.seq
 133314224     gbgss304.seq
  33624586     gbgss31.seq
 524290309     gbgss32.seq
 524288796     gbgss33.seq
 524290539     gbgss34.seq
 524289510     gbgss35.seq
 524290347     gbgss36.seq
 524290016     gbgss37.seq
 524290991     gbgss38.seq
 489386711     gbgss39.seq
 524289495     gbgss4.seq
 524292936     gbgss40.seq
 524289658     gbgss41.seq
 524289053     gbgss42.seq
  19128095     gbgss43.seq
 524291495     gbgss44.seq
 524290249     gbgss45.seq
 524291200     gbgss46.seq
 524288917     gbgss47.seq
 216278345     gbgss48.seq
 524291261     gbgss49.seq
 151331340     gbgss5.seq
 524289547     gbgss50.seq
 524290300     gbgss51.seq
 524288815     gbgss52.seq
 524289068     gbgss53.seq
 524288850     gbgss54.seq
 524288866     gbgss55.seq
 524291148     gbgss56.seq
 524290258     gbgss57.seq
 524289895     gbgss58.seq
 524289928     gbgss59.seq
 524291287     gbgss6.seq
  20723333     gbgss60.seq
 524291673     gbgss61.seq
 524289183     gbgss62.seq
 524291682     gbgss63.seq
 452337880     gbgss64.seq
 524290375     gbgss65.seq
 524291631     gbgss66.seq
 524289288     gbgss67.seq
 524291486     gbgss68.seq
 524290423     gbgss69.seq
 524288950     gbgss7.seq
 524290234     gbgss70.seq
 524292267     gbgss71.seq
 524291311     gbgss72.seq
 524290169     gbgss73.seq
 524288907     gbgss74.seq
 524290480     gbgss75.seq
 524289883     gbgss76.seq
  22119988     gbgss77.seq
 524290829     gbgss78.seq
 524289664     gbgss79.seq
 524288897     gbgss8.seq
 524290202     gbgss80.seq
 524290360     gbgss81.seq
 524290336     gbgss82.seq
 524289561     gbgss83.seq
 524292354     gbgss84.seq
 524291709     gbgss85.seq
 524288835     gbgss86.seq
 524290531     gbgss87.seq
 524290735     gbgss88.seq
 359893210     gbgss89.seq
 524291546     gbgss9.seq
 524290017     gbgss90.seq
 524292275     gbgss91.seq
 524291767     gbgss92.seq
 524289082     gbgss93.seq
 524288734     gbgss94.seq
 524291679     gbgss95.seq
 524289031     gbgss96.seq
 524291692     gbgss97.seq
 524291792     gbgss98.seq
 524291482     gbgss99.seq
 249997012     gbhtc1.seq
 249999312     gbhtc10.seq
 249999801     gbhtc11.seq
 132434658     gbhtc12.seq
 249999169     gbhtc13.seq
 249999049     gbhtc14.seq
 150851929     gbhtc15.seq
 249995478     gbhtc2.seq
 249991894     gbhtc3.seq
 249985970     gbhtc4.seq
 249999048     gbhtc5.seq
 249987440     gbhtc6.seq
 249996035     gbhtc7.seq
  80798178     gbhtc8.seq
 249998827     gbhtc9.seq
 249919103     gbhtg1.seq
 249935336     gbhtg10.seq
 249898506     gbhtg100.seq
 249852504     gbhtg101.seq
 249535042     gbhtg102.seq
 249888102     gbhtg103.seq
   3688130     gbhtg104.seq
 249799093     gbhtg105.seq
 249998294     gbhtg106.seq
 249949907     gbhtg107.seq
 249916550     gbhtg108.seq
 249978605     gbhtg109.seq
    799292     gbhtg11.seq
 249896015     gbhtg110.seq
 167432707     gbhtg111.seq
 249850870     gbhtg112.seq
 249939795     gbhtg113.seq
 249869598     gbhtg114.seq
 249906673     gbhtg115.seq
 249768916     gbhtg116.seq
 249967908     gbhtg117.seq
 249944117     gbhtg118.seq
 219057303     gbhtg119.seq
 249867576     gbhtg12.seq
 249986066     gbhtg120.seq
 249896587     gbhtg121.seq
 249935778     gbhtg122.seq
 249900357     gbhtg123.seq
 249891139     gbhtg124.seq
 249797886     gbhtg125.seq
 249847034     gbhtg126.seq
 249920794     gbhtg127.seq
 249935694     gbhtg128.seq
 249906567     gbhtg129.seq
 249953697     gbhtg13.seq
 249986849     gbhtg130.seq
    276847     gbhtg131.seq
 249872326     gbhtg132.seq
 249895390     gbhtg133.seq
 249844710     gbhtg134.seq
 249988579     gbhtg135.seq
 249862660     gbhtg136.seq
 135815749     gbhtg137.seq
 249905628     gbhtg138.seq
 249808330     gbhtg139.seq
 249995099     gbhtg14.seq
 249958007     gbhtg140.seq
 249697484     gbhtg141.seq
 249816953     gbhtg142.seq
 134304697     gbhtg143.seq
 249939319     gbhtg144.seq
 249796848     gbhtg145.seq
 249816843     gbhtg146.seq
 249887715     gbhtg147.seq
 249935004     gbhtg148.seq
 249922755     gbhtg149.seq
 249938964     gbhtg15.seq
 249831405     gbhtg150.seq
 249900380     gbhtg151.seq
 249955029     gbhtg152.seq
 249989105     gbhtg153.seq
 240323907     gbhtg154.seq
 249750336     gbhtg16.seq
 249774726     gbhtg17.seq
 249714731     gbhtg18.seq
 249957759     gbhtg19.seq
 249965174     gbhtg2.seq
 249931734     gbhtg20.seq
 235850971     gbhtg21.seq
 249743613     gbhtg22.seq
 249849760     gbhtg23.seq
 249968489     gbhtg24.seq
 249904378     gbhtg25.seq
 249743777     gbhtg26.seq
 249872278     gbhtg27.seq
 249943100     gbhtg28.seq
 249821972     gbhtg29.seq
 249990925     gbhtg3.seq
 249974297     gbhtg30.seq
 225307913     gbhtg31.seq
 249988250     gbhtg32.seq
 249721384     gbhtg33.seq
 249910646     gbhtg34.seq
 249900069     gbhtg35.seq
 249839995     gbhtg36.seq
 249796553     gbhtg37.seq
 249749194     gbhtg38.seq
 249608093     gbhtg39.seq
 249912663     gbhtg4.seq
 249819463     gbhtg40.seq
 224341330     gbhtg41.seq
 249988697     gbhtg42.seq
 249929499     gbhtg43.seq
 249878159     gbhtg44.seq
 249894493     gbhtg45.seq
 249780350     gbhtg46.seq
 249512030     gbhtg47.seq
 249848882     gbhtg48.seq
 249876862     gbhtg49.seq
 249892800     gbhtg5.seq
 249885096     gbhtg50.seq
 234805407     gbhtg51.seq
 249992060     gbhtg52.seq
 249969706     gbhtg53.seq
 249777162     gbhtg54.seq
 249928077     gbhtg55.seq
 249738038     gbhtg56.seq
  18488541     gbhtg57.seq
 249846209     gbhtg58.seq
 249813703     gbhtg59.seq
 249976698     gbhtg6.seq
 249982730     gbhtg60.seq
 249908507     gbhtg61.seq
 225116490     gbhtg62.seq
 249869194     gbhtg63.seq
 249892574     gbhtg64.seq
 249989957     gbhtg65.seq
 249828950     gbhtg66.seq
 249951490     gbhtg67.seq
  15793409     gbhtg68.seq
 249969504     gbhtg69.seq
 249792412     gbhtg7.seq
 249868114     gbhtg70.seq
 249949360     gbhtg71.seq
 249752681     gbhtg72.seq
 223399911     gbhtg73.seq
 249932036     gbhtg74.seq
 249871175     gbhtg75.seq
 249835275     gbhtg76.seq
 249935773     gbhtg77.seq
 235157893     gbhtg78.seq
 249863959     gbhtg79.seq
 249808933     gbhtg8.seq
 249962382     gbhtg80.seq
 249850658     gbhtg81.seq
 249876924     gbhtg82.seq
 202286158     gbhtg83.seq
 249854884     gbhtg84.seq
 249932273     gbhtg85.seq
 249851040     gbhtg86.seq
 249870703     gbhtg87.seq
 206005872     gbhtg88.seq
 249874212     gbhtg89.seq
 249937013     gbhtg9.seq
 249860356     gbhtg90.seq
 249764128     gbhtg91.seq
 249875964     gbhtg92.seq
 194399433     gbhtg93.seq
 249959164     gbhtg94.seq
 249968993     gbhtg95.seq
 249861046     gbhtg96.seq
 249785036     gbhtg97.seq
 161649769     gbhtg98.seq
 249859601     gbhtg99.seq
 249997506     gbinv1.seq
 249998443     gbinv10.seq
 249997696     gbinv100.seq
 249998148     gbinv101.seq
 249995586     gbinv102.seq
 249999464     gbinv103.seq
 249999737     gbinv104.seq
  75240537     gbinv105.seq
 249987806     gbinv106.seq
 249988271     gbinv107.seq
 249949268     gbinv108.seq
 249993955     gbinv109.seq
 246446725     gbinv11.seq
 249997413     gbinv110.seq
 249972564     gbinv111.seq
 249997588     gbinv112.seq
  86895465     gbinv113.seq
 249987638     gbinv114.seq
 249857442     gbinv115.seq
 249983786     gbinv116.seq
 249988437     gbinv117.seq
 249996082     gbinv118.seq
 249943990     gbinv119.seq
 249934189     gbinv12.seq
 249990310     gbinv120.seq
 249997926     gbinv121.seq
 249997812     gbinv122.seq
 147920656     gbinv123.seq
 250000225     gbinv124.seq
 249995035     gbinv125.seq
 249997553     gbinv126.seq
 249915287     gbinv127.seq
 249990767     gbinv128.seq
 249992342     gbinv129.seq
 249998414     gbinv13.seq
 247880203     gbinv130.seq
  44990217     gbinv131.seq
 249976624     gbinv132.seq
 249927190     gbinv133.seq
 249993435     gbinv134.seq
 249991798     gbinv135.seq
  26858693     gbinv136.seq
 249997218     gbinv137.seq
 249998241     gbinv138.seq
  58216986     gbinv139.seq
 249965269     gbinv14.seq
 249999169     gbinv140.seq
 249988413     gbinv141.seq
 249989803     gbinv142.seq
 249999700     gbinv143.seq
 144731450     gbinv144.seq
 249999293     gbinv145.seq
 249999529     gbinv146.seq
 249999498     gbinv147.seq
 249998461     gbinv148.seq
 249999152     gbinv149.seq
 215742016     gbinv15.seq
 249999955     gbinv150.seq
 248118893     gbinv151.seq
 249320156     gbinv152.seq
 247785060     gbinv153.seq
 249970239     gbinv154.seq
  82361702     gbinv155.seq
 249997315     gbinv16.seq
 249998334     gbinv17.seq
 250000078     gbinv18.seq
 153441034     gbinv19.seq
 249773794     gbinv2.seq
 249393698     gbinv20.seq
 247814048     gbinv21.seq
 249999813     gbinv22.seq
 249952476     gbinv23.seq
 238667470     gbinv24.seq
 228630633     gbinv25.seq
 175319053     gbinv26.seq
 249997967     gbinv27.seq
 249999698     gbinv28.seq
 218194534     gbinv29.seq
 249934008     gbinv3.seq
 249998010     gbinv30.seq
 250000176     gbinv31.seq
 249999207     gbinv32.seq
 250000008     gbinv33.seq
 165183089     gbinv34.seq
 249998786     gbinv35.seq
 249999823     gbinv36.seq
 249999323     gbinv37.seq
 249994224     gbinv38.seq
 172454409     gbinv39.seq
 199364306     gbinv4.seq
 249997680     gbinv40.seq
 249997958     gbinv41.seq
 249997051     gbinv42.seq
 249999054     gbinv43.seq
 109610152     gbinv44.seq
 249997776     gbinv45.seq
 249999676     gbinv46.seq
 249999406     gbinv47.seq
 249997537     gbinv48.seq
  86123041     gbinv49.seq
 249998261     gbinv5.seq
 249999240     gbinv50.seq
 249999937     gbinv51.seq
 249997367     gbinv52.seq
 249997089     gbinv53.seq
 249998374     gbinv54.seq
 250000127     gbinv55.seq
 249996915     gbinv56.seq
 249998135     gbinv57.seq
 249998350     gbinv58.seq
  18964653     gbinv59.seq
 249998636     gbinv6.seq
 249997699     gbinv60.seq
 249996956     gbinv61.seq
 249999885     gbinv62.seq
 249995084     gbinv63.seq
 187312086     gbinv64.seq
 249999323     gbinv65.seq
 249999741     gbinv66.seq
 249998893     gbinv67.seq
 249997735     gbinv68.seq
 249998100     gbinv69.seq
 249999300     gbinv7.seq
 146708855     gbinv70.seq
 249999804     gbinv71.seq
 249999334     gbinv72.seq
 249998579     gbinv73.seq
 195993243     gbinv74.seq
 249991369     gbinv75.seq
 249993034     gbinv76.seq
 249389122     gbinv77.seq
 249962220     gbinv78.seq
 249968289     gbinv79.seq
 249994693     gbinv8.seq
 249896214     gbinv80.seq
 249930162     gbinv81.seq
 217071619     gbinv82.seq
 249989875     gbinv83.seq
 249995216     gbinv84.seq
 249994945     gbinv85.seq
 249999207     gbinv86.seq
  49757515     gbinv87.seq
 249964309     gbinv88.seq
 249970247     gbinv89.seq
 131150272     gbinv9.seq
 249990524     gbinv90.seq
 249954734     gbinv91.seq
 249988030     gbinv92.seq
 249976719     gbinv93.seq
 249995127     gbinv94.seq
 249998096     gbinv95.seq
 250000264     gbinv96.seq
 220912859     gbinv97.seq
 249981398     gbinv98.seq
 249990982     gbinv99.seq
 249951632     gbmam1.seq
 338653931     gbmam10.seq
 315434407     gbmam11.seq
 162425847     gbmam12.seq
 150157334     gbmam13.seq
 159032538     gbmam14.seq
 136269230     gbmam15.seq
 122412955     gbmam16.seq
 248159396     gbmam17.seq
 202955071     gbmam18.seq
 208310866     gbmam19.seq
 249999409     gbmam2.seq
 209752346     gbmam20.seq
 197940543     gbmam21.seq
 230561841     gbmam22.seq
 220222444     gbmam23.seq
 123191120     gbmam24.seq
 191446156     gbmam25.seq
   9943428     gbmam26.seq
  43989127     gbmam27.seq
  91322474     gbmam28.seq
  88810719     gbmam29.seq
  84196583     gbmam3.seq
   6365585     gbmam30.seq
  20918349     gbmam31.seq
 249996700     gbmam32.seq
 199537698     gbmam33.seq
 249997357     gbmam34.seq
 249998641     gbmam35.seq
 249998970     gbmam36.seq
 249999562     gbmam37.seq
 249997801     gbmam38.seq
  15178935     gbmam39.seq
  82807677     gbmam4.seq
  71293586     gbmam5.seq
  22570875     gbmam6.seq
   1268605     gbmam7.seq
   2477678     gbmam8.seq
 375834657     gbmam9.seq
  24609895     gbnew.txt
 249999844     gbpat1.seq
 249999388     gbpat10.seq
 249998963     gbpat100.seq
 249999641     gbpat101.seq
 249999965     gbpat102.seq
 249999455     gbpat103.seq
 137267099     gbpat104.seq
 250000015     gbpat105.seq
 249999153     gbpat106.seq
 249888679     gbpat107.seq
 249749771     gbpat108.seq
 250000144     gbpat109.seq
 168177618     gbpat11.seq
 179847103     gbpat110.seq
 250000003     gbpat111.seq
 249999494     gbpat112.seq
 249998379     gbpat113.seq
  70384551     gbpat114.seq
 250000217     gbpat115.seq
 249999573     gbpat116.seq
 249690376     gbpat117.seq
 249999993     gbpat118.seq
 249999110     gbpat119.seq
 249997499     gbpat12.seq
  55704446     gbpat120.seq
 249999350     gbpat121.seq
 249999805     gbpat122.seq
 249999831     gbpat123.seq
 249998300     gbpat124.seq
 144919044     gbpat125.seq
 249999927     gbpat126.seq
 249999834     gbpat127.seq
 226235203     gbpat128.seq
 249966117     gbpat129.seq
 249998887     gbpat13.seq
 249976912     gbpat130.seq
 249999729     gbpat131.seq
 249998903     gbpat132.seq
 249998034     gbpat133.seq
  59559800     gbpat134.seq
 249995969     gbpat135.seq
 249995285     gbpat136.seq
 249998740     gbpat137.seq
 249998430     gbpat138.seq
 249999159     gbpat139.seq
 249999244     gbpat14.seq
   9607227     gbpat140.seq
 249999998     gbpat141.seq
 249998686     gbpat142.seq
 249999576     gbpat143.seq
 249998604     gbpat144.seq
  36785302     gbpat145.seq
 249995259     gbpat146.seq
 249999971     gbpat147.seq
 249999853     gbpat148.seq
 224419737     gbpat149.seq
 249997131     gbpat15.seq
 249999338     gbpat150.seq
 249999887     gbpat151.seq
 249999570     gbpat152.seq
  75491672     gbpat153.seq
 249999318     gbpat154.seq
 250000256     gbpat155.seq
 249999196     gbpat156.seq
  55090875     gbpat157.seq
 249999637     gbpat158.seq
 249997492     gbpat159.seq
 249999345     gbpat16.seq
 249999644     gbpat160.seq
 249999789     gbpat161.seq
 249999449     gbpat162.seq
 249999795     gbpat163.seq
 202361027     gbpat164.seq
 250000181     gbpat165.seq
 249999529     gbpat166.seq
 249999529     gbpat167.seq
 205870569     gbpat168.seq
 249999373     gbpat169.seq
  66933105     gbpat17.seq
 249958823     gbpat170.seq
 249999946     gbpat171.seq
   2094359     gbpat172.seq
 249998770     gbpat173.seq
 249996187     gbpat174.seq
 249999804     gbpat175.seq
 249999132     gbpat176.seq
  81948799     gbpat177.seq
 249999232     gbpat178.seq
 249999933     gbpat179.seq
 249998753     gbpat18.seq
 249999839     gbpat180.seq
 248237643     gbpat181.seq
 249998773     gbpat182.seq
 249999109     gbpat183.seq
 249998937     gbpat184.seq
 250000075     gbpat185.seq
 248566246     gbpat186.seq
 249998056     gbpat187.seq
 230155279     gbpat188.seq
 250000241     gbpat189.seq
 249999427     gbpat19.seq
 249998973     gbpat190.seq
 249997114     gbpat191.seq
 250000182     gbpat192.seq
 249999162     gbpat193.seq
 249999322     gbpat194.seq
 249998762     gbpat195.seq
  85324625     gbpat196.seq
 249998867     gbpat197.seq
 249999576     gbpat198.seq
 250000160     gbpat199.seq
 249998973     gbpat2.seq
 250000082     gbpat20.seq
 250000125     gbpat200.seq
 207986666     gbpat201.seq
 249999056     gbpat202.seq
 249879078     gbpat203.seq
 249994588     gbpat204.seq
 249998079     gbpat205.seq
 174015085     gbpat206.seq
 249988465     gbpat207.seq
 249999819     gbpat208.seq
 249999546     gbpat209.seq
 249998200     gbpat21.seq
 249998597     gbpat210.seq
 249998595     gbpat211.seq
 249997073     gbpat212.seq
   8448545     gbpat213.seq
 249999880     gbpat214.seq
 249658067     gbpat215.seq
 249999951     gbpat216.seq
 132772118     gbpat217.seq
 249999627     gbpat218.seq
 249997972     gbpat219.seq
 177836710     gbpat22.seq
 249997509     gbpat220.seq
 249999208     gbpat221.seq
 249995993     gbpat222.seq
 249997662     gbpat223.seq
 249999949     gbpat224.seq
 249999978     gbpat225.seq
  56241469     gbpat226.seq
 249999673     gbpat227.seq
 249964291     gbpat228.seq
 249998921     gbpat229.seq
 249999851     gbpat23.seq
 249999334     gbpat230.seq
 208421430     gbpat231.seq
 249999406     gbpat232.seq
 250000208     gbpat233.seq
 249998056     gbpat234.seq
 249999760     gbpat235.seq
  57206027     gbpat236.seq
 250000138     gbpat237.seq
 249999790     gbpat238.seq
 249999745     gbpat239.seq
 249990993     gbpat24.seq
 249997616     gbpat240.seq
 249997564     gbpat241.seq
 237291341     gbpat242.seq
 249999484     gbpat243.seq
 249996968     gbpat244.seq
 249998807     gbpat245.seq
 249999119     gbpat246.seq
  25799234     gbpat247.seq
 249999137     gbpat248.seq
 249996011     gbpat249.seq
 249999804     gbpat25.seq
 250000118     gbpat250.seq
 135116688     gbpat251.seq
 249980943     gbpat252.seq
 249999989     gbpat253.seq
 250000225     gbpat254.seq
 250000225     gbpat255.seq
 148497149     gbpat256.seq
 249996585     gbpat257.seq
 250000114     gbpat258.seq
 249999574     gbpat259.seq
 249999532     gbpat26.seq
 250000238     gbpat260.seq
 249998119     gbpat261.seq
 249961219     gbpat262.seq
 212810643     gbpat263.seq
 249998964     gbpat264.seq
 249990860     gbpat265.seq
 249997428     gbpat266.seq
 249996372     gbpat267.seq
 249997766     gbpat268.seq
 249996061     gbpat269.seq
  62266891     gbpat27.seq
 249998866     gbpat270.seq
 249999129     gbpat271.seq
 169812806     gbpat272.seq
 250000149     gbpat273.seq
 249999466     gbpat274.seq
 249998834     gbpat275.seq
 175267562     gbpat276.seq
 249999689     gbpat277.seq
 249999521     gbpat278.seq
 250000079     gbpat279.seq
 249998456     gbpat28.seq
 249775361     gbpat280.seq
 205015109     gbpat281.seq
 249998614     gbpat282.seq
 249998654     gbpat283.seq
 250000055     gbpat284.seq
 249999451     gbpat285.seq
  83912811     gbpat286.seq
 249997533     gbpat287.seq
 249999129     gbpat288.seq
 249998868     gbpat289.seq
 249998194     gbpat29.seq
 249998625     gbpat290.seq
 250000073     gbpat291.seq
 249998572     gbpat292.seq
 249998858     gbpat293.seq
 118988702     gbpat294.seq
 250000047     gbpat3.seq
 249998594     gbpat30.seq
 249999647     gbpat31.seq
 249999939     gbpat32.seq
 171734797     gbpat33.seq
 250000030     gbpat34.seq
 249746691     gbpat35.seq
 249999757     gbpat36.seq
 249998590     gbpat37.seq
 249999373     gbpat38.seq
 249994706     gbpat39.seq
 249999549     gbpat4.seq
 249883786     gbpat40.seq
  91529381     gbpat41.seq
 249999955     gbpat42.seq
 249907803     gbpat43.seq
 249999930     gbpat44.seq
 249999564     gbpat45.seq
 249999563     gbpat46.seq
 249764801     gbpat47.seq
 249999760     gbpat48.seq
 246849274     gbpat49.seq
  61168666     gbpat5.seq
 161792179     gbpat50.seq
 249999512     gbpat51.seq
 249999804     gbpat52.seq
 249999700     gbpat53.seq
 249999646     gbpat54.seq
 213206429     gbpat55.seq
 250000030     gbpat56.seq
 250000009     gbpat57.seq
 249999551     gbpat58.seq
 155999804     gbpat59.seq
 249999674     gbpat6.seq
 249999799     gbpat60.seq
 249997675     gbpat61.seq
 249999743     gbpat62.seq
 249999691     gbpat63.seq
 125158548     gbpat64.seq
 249996525     gbpat65.seq
 249999556     gbpat66.seq
 249998622     gbpat67.seq
 249997829     gbpat68.seq
 249998957     gbpat69.seq
 249999153     gbpat7.seq
 249999694     gbpat70.seq
 135705288     gbpat71.seq
 249998906     gbpat72.seq
 249999313     gbpat73.seq
 250000176     gbpat74.seq
 248923207     gbpat75.seq
 248123146     gbpat76.seq
 249394834     gbpat77.seq
 248798213     gbpat78.seq
 250000122     gbpat79.seq
 249995844     gbpat8.seq
 141050219     gbpat80.seq
 250000182     gbpat81.seq
 249999208     gbpat82.seq
 250000165     gbpat83.seq
 249999811     gbpat84.seq
 249999664     gbpat85.seq
 249998983     gbpat86.seq
  87741306     gbpat87.seq
 249925550     gbpat88.seq
 250000078     gbpat89.seq
 249999459     gbpat9.seq
 249999892     gbpat90.seq
 250000210     gbpat91.seq
 250000095     gbpat92.seq
 250000146     gbpat93.seq
 130989890     gbpat94.seq
 249999160     gbpat95.seq
 249999366     gbpat96.seq
 249999447     gbpat97.seq
 249999901     gbpat98.seq
 184979714     gbpat99.seq
 249959454     gbphg1.seq
 249893025     gbphg2.seq
 249759632     gbphg3.seq
  42757476     gbphg4.seq
 249998121     gbpln1.seq
 147922422     gbpln10.seq
 188705204     gbpln100.seq
 249998961     gbpln101.seq
 250000020     gbpln102.seq
  56810396     gbpln103.seq
 249969382     gbpln104.seq
 249997828     gbpln105.seq
 249931985     gbpln106.seq
 249999926     gbpln107.seq
 249998381     gbpln108.seq
  13336815     gbpln109.seq
 249996748     gbpln11.seq
 249997720     gbpln110.seq
 247888088     gbpln111.seq
 249998035     gbpln112.seq
 249999438     gbpln113.seq
  84069394     gbpln114.seq
 249999208     gbpln115.seq
 249997527     gbpln116.seq
 249918767     gbpln117.seq
 210224657     gbpln118.seq
 249999588     gbpln119.seq
 249999649     gbpln12.seq
 249999269     gbpln120.seq
 249998225     gbpln121.seq
 159130052     gbpln122.seq
 249999294     gbpln123.seq
 249998627     gbpln124.seq
 250000187     gbpln125.seq
 122285303     gbpln126.seq
 249996799     gbpln127.seq
 249999992     gbpln128.seq
 249998263     gbpln129.seq
 249999117     gbpln13.seq
 249998576     gbpln130.seq
 249997200     gbpln131.seq
 231624924     gbpln132.seq
 249733638     gbpln133.seq
 249998462     gbpln134.seq
 249998071     gbpln135.seq
 248993126     gbpln136.seq
 249998178     gbpln137.seq
 249172945     gbpln138.seq
 246540516     gbpln139.seq
 249935782     gbpln14.seq
 246906266     gbpln140.seq
 115279628     gbpln141.seq
 220745640     gbpln142.seq
 224206313     gbpln143.seq
 206267314     gbpln144.seq
 236598142     gbpln145.seq
 247384347     gbpln146.seq
 249842480     gbpln147.seq
 249943315     gbpln148.seq
 249998916     gbpln149.seq
 222892886     gbpln15.seq
 187405222     gbpln150.seq
 249999890     gbpln16.seq
 249990442     gbpln17.seq
 249965339     gbpln18.seq
  18729995     gbpln19.seq
 249998724     gbpln2.seq
 241005532     gbpln20.seq
 249890126     gbpln21.seq
 248162352     gbpln22.seq
 249625764     gbpln23.seq
 240030564     gbpln24.seq
 231415812     gbpln25.seq
 232512418     gbpln26.seq
 235239775     gbpln27.seq
 199014935     gbpln28.seq
 196497475     gbpln29.seq
 249943075     gbpln3.seq
 249999195     gbpln30.seq
  95316830     gbpln31.seq
 249998564     gbpln32.seq
 133147612     gbpln33.seq
 203982059     gbpln34.seq
  84488595     gbpln35.seq
 191574858     gbpln36.seq
 228663904     gbpln37.seq
 243276497     gbpln38.seq
 249608485     gbpln39.seq
 249882625     gbpln4.seq
 249676853     gbpln40.seq
 249998559     gbpln41.seq
 249590406     gbpln42.seq
 137796452     gbpln43.seq
 249130516     gbpln44.seq
 249951075     gbpln45.seq
 248595782     gbpln46.seq
 248796588     gbpln47.seq
 249414934     gbpln48.seq
 249604556     gbpln49.seq
 249914143     gbpln5.seq
 103698915     gbpln50.seq
 249349086     gbpln51.seq
 248028958     gbpln52.seq
 225616247     gbpln53.seq
 219791144     gbpln54.seq
 249020201     gbpln55.seq
 248425205     gbpln56.seq
 228677760     gbpln57.seq
 239291156     gbpln58.seq
 221448759     gbpln59.seq
 249959256     gbpln6.seq
 247119471     gbpln60.seq
 247173925     gbpln61.seq
  24455426     gbpln62.seq
 164935257     gbpln63.seq
  40081560     gbpln64.seq
  74904969     gbpln65.seq
 249999128     gbpln66.seq
 249998081     gbpln67.seq
 249997335     gbpln68.seq
 106085056     gbpln69.seq
 249953670     gbpln7.seq
 249996451     gbpln70.seq
 249997765     gbpln71.seq
 249999819     gbpln72.seq
 249998348     gbpln73.seq
 138180155     gbpln74.seq
 249996161     gbpln75.seq
 249870958     gbpln76.seq
 249996641     gbpln77.seq
 249846660     gbpln78.seq
 249336722     gbpln79.seq
 249889450     gbpln8.seq
 249998811     gbpln80.seq
 249999829     gbpln81.seq
  32106692     gbpln82.seq
 249999257     gbpln83.seq
  47365284     gbpln84.seq
 210386499     gbpln85.seq
 246753049     gbpln86.seq
 185599907     gbpln87.seq
 997331397     gbpln88.seq
  56468624     gbpln89.seq
 250000107     gbpln9.seq
 217279464     gbpln90.seq
 171793646     gbpln91.seq
 197391132     gbpln92.seq
 177950616     gbpln93.seq
 196456251     gbpln94.seq
 189037038     gbpln95.seq
 220764605     gbpln96.seq
 227204478     gbpln97.seq
 224027155     gbpln98.seq
 248372204     gbpln99.seq
 147960527     gbpri1.seq
 249829449     gbpri10.seq
 143951048     gbpri11.seq
 249938389     gbpri12.seq
 249864786     gbpri13.seq
 249870085     gbpri14.seq
 249923234     gbpri15.seq
 249847949     gbpri16.seq
 249851601     gbpri17.seq
 249741155     gbpri18.seq
 249904267     gbpri19.seq
 249949740     gbpri2.seq
 249931437     gbpri20.seq
 249975812     gbpri21.seq
 249893085     gbpri22.seq
 249997593     gbpri23.seq
  78903793     gbpri24.seq
 162644577     gbpri25.seq
 249995115     gbpri26.seq
 244711168     gbpri27.seq
 249973486     gbpri28.seq
 249983047     gbpri29.seq
 249829494     gbpri3.seq
 249946931     gbpri30.seq
 249783882     gbpri31.seq
 249750397     gbpri32.seq
 249840243     gbpri33.seq
 249989809     gbpri34.seq
 249970165     gbpri35.seq
  18804857     gbpri36.seq
 249993718     gbpri37.seq
 249951153     gbpri38.seq
 249410873     gbpri39.seq
 249974358     gbpri4.seq
 249968746     gbpri40.seq
 249956813     gbpri41.seq
 178522966     gbpri42.seq
 249999215     gbpri43.seq
 249972313     gbpri44.seq
 249972470     gbpri45.seq
 249997465     gbpri46.seq
 249987422     gbpri47.seq
  66313137     gbpri48.seq
 249968303     gbpri49.seq
 249917258     gbpri5.seq
 249996830     gbpri50.seq
 230430278     gbpri51.seq
 314294173     gbpri52.seq
 258775295     gbpri53.seq
 268666434     gbpri54.seq
 249967899     gbpri55.seq
 249999287     gbpri56.seq
  59376931     gbpri57.seq
 249854087     gbpri6.seq
 249754123     gbpri7.seq
 249904898     gbpri8.seq
 249824141     gbpri9.seq
    459345     gbrel.txt
 249963416     gbrod1.seq
 249869153     gbrod10.seq
  80603868     gbrod11.seq
 249853719     gbrod12.seq
 249993397     gbrod13.seq
 249952018     gbrod14.seq
 249790966     gbrod15.seq
 249791212     gbrod16.seq
 249877726     gbrod17.seq
 249887975     gbrod18.seq
 249004691     gbrod19.seq
 249878749     gbrod2.seq
 249733680     gbrod20.seq
 249777714     gbrod21.seq
 204220110     gbrod22.seq
 249997590     gbrod23.seq
 249993835     gbrod24.seq
 249981217     gbrod25.seq
 249997510     gbrod26.seq
 249984428     gbrod27.seq
 249998610     gbrod28.seq
 249985037     gbrod29.seq
 249846336     gbrod3.seq
 215474937     gbrod30.seq
 249956268     gbrod4.seq
 249723115     gbrod5.seq
 249894551     gbrod6.seq
 249813115     gbrod7.seq
 249947122     gbrod8.seq
 249984733     gbrod9.seq
 249997508     gbsts1.seq
 249997088     gbsts10.seq
 206741382     gbsts11.seq
 249998430     gbsts12.seq
 249999169     gbsts13.seq
 250000011     gbsts14.seq
 249998492     gbsts15.seq
  21531082     gbsts16.seq
 249999089     gbsts17.seq
 249999734     gbsts18.seq
 249999294     gbsts19.seq
 249999681     gbsts2.seq
 183106294     gbsts20.seq
 249998754     gbsts3.seq
 249996346     gbsts4.seq
  37833138     gbsts5.seq
 249998732     gbsts6.seq
 249995639     gbsts7.seq
 249996228     gbsts8.seq
 249996787     gbsts9.seq
 249994633     gbsyn1.seq
 111623603     gbsyn10.seq
 249999596     gbsyn2.seq
 249996806     gbsyn3.seq
 249948734     gbsyn4.seq
 249948494     gbsyn5.seq
 249961019     gbsyn6.seq
 249997599     gbsyn7.seq
 249995589     gbsyn8.seq
 249993884     gbsyn9.seq
 249999675     gbtsa1.seq
  50318331     gbtsa10.seq
 249998031     gbtsa100.seq
 249999022     gbtsa101.seq
 249994258     gbtsa102.seq
 250000145     gbtsa103.seq
 249999147     gbtsa104.seq
  99482523     gbtsa105.seq
 249998116     gbtsa106.seq
 249999006     gbtsa107.seq
 249999406     gbtsa108.seq
 249999176     gbtsa109.seq
 249995943     gbtsa11.seq
 249996873     gbtsa110.seq
 249998837     gbtsa111.seq
 220464221     gbtsa112.seq
 250000072     gbtsa113.seq
 250000158     gbtsa114.seq
 250000198     gbtsa115.seq
 249999986     gbtsa116.seq
 250000096     gbtsa117.seq
   9941672     gbtsa118.seq
 249997842     gbtsa119.seq
 249997183     gbtsa12.seq
 249998997     gbtsa120.seq
 249999686     gbtsa121.seq
 215399396     gbtsa122.seq
 249996167     gbtsa123.seq
 249996876     gbtsa124.seq
 249996570     gbtsa125.seq
 249999914     gbtsa126.seq
 249999386     gbtsa127.seq
 249999962     gbtsa128.seq
 164804265     gbtsa129.seq
 249994887     gbtsa13.seq
 249997163     gbtsa130.seq
 249996135     gbtsa131.seq
 249997577     gbtsa132.seq
 250000175     gbtsa133.seq
 249999451     gbtsa134.seq
 250000157     gbtsa135.seq
   2518352     gbtsa136.seq
 249997865     gbtsa137.seq
 249996502     gbtsa138.seq
 249997490     gbtsa139.seq
 249998618     gbtsa14.seq
 249999799     gbtsa140.seq
 131360517     gbtsa141.seq
 249994731     gbtsa142.seq
 249998059     gbtsa143.seq
 249999383     gbtsa144.seq
 249999200     gbtsa145.seq
  30978866     gbtsa146.seq
 249998453     gbtsa147.seq
 249998596     gbtsa148.seq
 249998496     gbtsa149.seq
 249998003     gbtsa15.seq
 249996461     gbtsa150.seq
 249998524     gbtsa151.seq
 249995978     gbtsa152.seq
 249999139     gbtsa153.seq
 249999266     gbtsa154.seq
  45676156     gbtsa155.seq
 249998921     gbtsa156.seq
 249999118     gbtsa157.seq
 249998545     gbtsa158.seq
 250000026     gbtsa159.seq
  16855572     gbtsa16.seq
 249997741     gbtsa160.seq
 249999330     gbtsa161.seq
  84607457     gbtsa162.seq
 249999313     gbtsa163.seq
 249998187     gbtsa164.seq
 249998633     gbtsa165.seq
 139220115     gbtsa166.seq
 249996774     gbtsa167.seq
 249996438     gbtsa168.seq
 249999007     gbtsa169.seq
 249998023     gbtsa17.seq
 249994445     gbtsa170.seq
 249992518     gbtsa171.seq
 249999858     gbtsa172.seq
 208363603     gbtsa173.seq
 249998828     gbtsa174.seq
 249996630     gbtsa175.seq
 249993564     gbtsa176.seq
 249994891     gbtsa177.seq
 250000106     gbtsa178.seq
 249997818     gbtsa179.seq
 249996915     gbtsa18.seq
 230583152     gbtsa180.seq
 249998515     gbtsa181.seq
 249999189     gbtsa182.seq
 249997207     gbtsa183.seq
 249996939     gbtsa184.seq
 249994703     gbtsa185.seq
 249995475     gbtsa186.seq
 249996599     gbtsa187.seq
 154687296     gbtsa188.seq
 249999558     gbtsa189.seq
 249997721     gbtsa19.seq
 249997141     gbtsa190.seq
 249999121     gbtsa191.seq
 249999588     gbtsa192.seq
 249997398     gbtsa193.seq
 249995404     gbtsa194.seq
 249999599     gbtsa195.seq
 222049284     gbtsa196.seq
 249999907     gbtsa197.seq
 249998022     gbtsa198.seq
 249999831     gbtsa199.seq
 249999875     gbtsa2.seq
 249996846     gbtsa20.seq
 249998525     gbtsa200.seq
 231476173     gbtsa201.seq
 249997536     gbtsa202.seq
 249996694     gbtsa203.seq
 249998981     gbtsa204.seq
 249997945     gbtsa205.seq
 249996879     gbtsa206.seq
 249997044     gbtsa207.seq
 249998226     gbtsa208.seq
 249998918     gbtsa209.seq
 179291287     gbtsa21.seq
  32621095     gbtsa210.seq
 249998497     gbtsa211.seq
 249998243     gbtsa212.seq
 249999255     gbtsa213.seq
 249995777     gbtsa214.seq
 249998092     gbtsa215.seq
 249998480     gbtsa216.seq
 249998398     gbtsa217.seq
 219125607     gbtsa218.seq
 249998478     gbtsa219.seq
 250000051     gbtsa22.seq
 249998905     gbtsa220.seq
 249995180     gbtsa221.seq
 249996675     gbtsa222.seq
 249994729     gbtsa223.seq
 249999027     gbtsa224.seq
 249999088     gbtsa225.seq
  28750338     gbtsa226.seq
 249999639     gbtsa227.seq
 249999892     gbtsa228.seq
 249996250     gbtsa229.seq
 249996448     gbtsa23.seq
 249995951     gbtsa230.seq
 249997802     gbtsa231.seq
 249999056     gbtsa232.seq
 249998509     gbtsa233.seq
 171540916     gbtsa234.seq
 249999942     gbtsa24.seq
 249999996     gbtsa25.seq
 144146681     gbtsa26.seq
 249999039     gbtsa27.seq
 249999075     gbtsa28.seq
 249999518     gbtsa29.seq
 249999971     gbtsa3.seq
 249998261     gbtsa30.seq
 249998844     gbtsa31.seq
   8360330     gbtsa32.seq
 249999396     gbtsa33.seq
 249998120     gbtsa34.seq
 249999803     gbtsa35.seq
 249998636     gbtsa36.seq
 249998533     gbtsa37.seq
 249998139     gbtsa38.seq
  67400599     gbtsa39.seq
 250000153     gbtsa4.seq
 249997527     gbtsa40.seq
 249999512     gbtsa41.seq
 249997467     gbtsa42.seq
 249999834     gbtsa43.seq
 249999596     gbtsa44.seq
 249998999     gbtsa45.seq
 249999361     gbtsa46.seq
  25962503     gbtsa47.seq
 249998180     gbtsa48.seq
 249999478     gbtsa49.seq
 146773925     gbtsa5.seq
 249999517     gbtsa50.seq
 249998366     gbtsa51.seq
  71315757     gbtsa52.seq
 250000188     gbtsa53.seq
 249998272     gbtsa54.seq
 249998401     gbtsa55.seq
 249995458     gbtsa56.seq
 153223993     gbtsa57.seq
 249999559     gbtsa58.seq
 249999540     gbtsa59.seq
 249998177     gbtsa6.seq
 249998090     gbtsa60.seq
 250000055     gbtsa61.seq
 250000068     gbtsa62.seq
 249999836     gbtsa63.seq
 249999294     gbtsa64.seq
 236772522     gbtsa65.seq
 249999479     gbtsa66.seq
 249996321     gbtsa67.seq
 249999966     gbtsa68.seq
 249997101     gbtsa69.seq
 249998374     gbtsa7.seq
 249997780     gbtsa70.seq
 249997375     gbtsa71.seq
 226152268     gbtsa72.seq
 249999425     gbtsa73.seq
 249997754     gbtsa74.seq
 249999723     gbtsa75.seq
 249997236     gbtsa76.seq
 249999596     gbtsa77.seq
 249997131     gbtsa78.seq
 174846214     gbtsa79.seq
 249998957     gbtsa8.seq
 249998462     gbtsa80.seq
 249997782     gbtsa81.seq
 250000080     gbtsa82.seq
 250000037     gbtsa83.seq
 249995888     gbtsa84.seq
 104827980     gbtsa85.seq
 249998728     gbtsa86.seq
 249998717     gbtsa87.seq
 249999018     gbtsa88.seq
 249996808     gbtsa89.seq
 249999330     gbtsa9.seq
 249999442     gbtsa90.seq
  39336488     gbtsa91.seq
 249999197     gbtsa92.seq
 249998374     gbtsa93.seq
 249997757     gbtsa94.seq
 249998081     gbtsa95.seq
 249999059     gbtsa96.seq
 144311861     gbtsa97.seq
 249992015     gbtsa98.seq
 249997674     gbtsa99.seq
    785182     gbuna1.seq
 249997113     gbvrl1.seq
 249994205     gbvrl10.seq
 249998968     gbvrl11.seq
 249981373     gbvrl12.seq
 249996531     gbvrl13.seq
 249996339     gbvrl14.seq
 120964422     gbvrl15.seq
 249998805     gbvrl16.seq
 249998619     gbvrl17.seq
 249995249     gbvrl18.seq
 249998898     gbvrl19.seq
 249999006     gbvrl2.seq
 209426145     gbvrl20.seq
 249998038     gbvrl21.seq
 249998871     gbvrl22.seq
 249995246     gbvrl23.seq
 249996231     gbvrl24.seq
 126565334     gbvrl25.seq
 249997485     gbvrl26.seq
 249997151     gbvrl27.seq
 249998262     gbvrl28.seq
 249999273     gbvrl29.seq
 249997035     gbvrl3.seq
 249999761     gbvrl30.seq
  55535155     gbvrl31.seq
 249982719     gbvrl32.seq
 249999262     gbvrl33.seq
 249999998     gbvrl34.seq
 249997744     gbvrl35.seq
 249999023     gbvrl36.seq
  78117981     gbvrl37.seq
 249998130     gbvrl38.seq
 249998289     gbvrl39.seq
 249997834     gbvrl4.seq
 249998990     gbvrl40.seq
 249998867     gbvrl41.seq
 249998736     gbvrl42.seq
  51562792     gbvrl43.seq
 249997769     gbvrl44.seq
 249997605     gbvrl45.seq
 249995775     gbvrl46.seq
 249997030     gbvrl47.seq
 249986281     gbvrl48.seq
 249999706     gbvrl49.seq
 249994503     gbvrl5.seq
   7864509     gbvrl50.seq
  69222230     gbvrl6.seq
 249997190     gbvrl7.seq
 249998013     gbvrl8.seq
 249998582     gbvrl9.seq
 249959176     gbvrt1.seq
  87345134     gbvrt10.seq
 249748867     gbvrt11.seq
 249836066     gbvrt12.seq
 249995333     gbvrt13.seq
  34843259     gbvrt14.seq
 245584491     gbvrt15.seq
 246940585     gbvrt16.seq
 238220155     gbvrt17.seq
 225838100     gbvrt18.seq
 230692563     gbvrt19.seq
 249787717     gbvrt2.seq
 241819223     gbvrt20.seq
 236411971     gbvrt21.seq
 220753809     gbvrt22.seq
 217846760     gbvrt23.seq
 225175051     gbvrt24.seq
 217087050     gbvrt25.seq
 232264818     gbvrt26.seq
 158256912     gbvrt27.seq
 249980624     gbvrt28.seq
 249935599     gbvrt29.seq
 249999737     gbvrt3.seq
 249988735     gbvrt30.seq
 249998808     gbvrt31.seq
 249998919     gbvrt32.seq
 249999196     gbvrt33.seq
  52788535     gbvrt34.seq
 249996939     gbvrt35.seq
 249995819     gbvrt36.seq
 249999998     gbvrt37.seq
 250000182     gbvrt38.seq
 249997004     gbvrt39.seq
 249953069     gbvrt4.seq
  93618431     gbvrt40.seq
 249998177     gbvrt41.seq
 250000063     gbvrt42.seq
 249998323     gbvrt43.seq
 188142232     gbvrt44.seq
 249999738     gbvrt45.seq
 249998888     gbvrt46.seq
  24534782     gbvrt47.seq
 249999210     gbvrt48.seq
 186935173     gbvrt49.seq
 227980916     gbvrt5.seq
 250000005     gbvrt50.seq
 249997965     gbvrt51.seq
 249999224     gbvrt52.seq
 116289979     gbvrt53.seq
 249998999     gbvrt54.seq
 249999118     gbvrt55.seq
 249996680     gbvrt56.seq
   6697288     gbvrt57.seq
 249997882     gbvrt58.seq
 249999234     gbvrt59.seq
 249994295     gbvrt6.seq
 233363921     gbvrt60.seq
 236339468     gbvrt61.seq
 234100397     gbvrt62.seq
 248773605     gbvrt63.seq
 247438412     gbvrt64.seq
 249933914     gbvrt65.seq
 249991250     gbvrt66.seq
 249996634     gbvrt67.seq
  91910607     gbvrt68.seq
 250000168     gbvrt69.seq
  13135497     gbvrt7.seq
 177272282     gbvrt70.seq
 246247381     gbvrt71.seq
 227142979     gbvrt72.seq
 249608551     gbvrt73.seq
 234447370     gbvrt74.seq
 249646941     gbvrt75.seq
 249734588     gbvrt76.seq
 249987855     gbvrt77.seq
 249966137     gbvrt78.seq
 249771451     gbvrt79.seq
 249996475     gbvrt8.seq
 163042551     gbvrt80.seq
  39873647     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64581      87275901
BCT10        12635      75804323
BCT100       57         116195274
BCT101       62         112828725
BCT102       39         111714912
BCT103       59         113329247
BCT104       44         107581822
BCT105       45         109907791
BCT106       62         109658814
BCT107       41         113948196
BCT108       42         110914351
BCT109       11         27206151
BCT11        2600       37759883
BCT110       29         106059433
BCT111       24         104995446
BCT112       22         102815134
BCT113       22         103205502
BCT114       22         103088809
BCT115       22         103089218
BCT116       22         103633799
BCT117       22         104408660
BCT118       24         108509216
BCT119       48         111802019
BCT12        1296       115524731
BCT120       38         108034988
BCT121       7          18864471
BCT122       50         111764861
BCT123       60         109369965
BCT124       60         114865324
BCT125       68         113315118
BCT126       44         114294823
BCT127       51         122368703
BCT128       58         118921695
BCT129       30         105449038
BCT13        83         113781080
BCT130       26         110619128
BCT131       35         85165722
BCT132       44         114207420
BCT133       48         116972150
BCT134       62         113378131
BCT135       39         107930220
BCT136       37         114880270
BCT137       25         110288300
BCT138       54         113797732
BCT139       10         26709327
BCT14        107        115703645
BCT140       28         113584725
BCT141       60         113829391
BCT142       48         109240533
BCT143       37         114909137
BCT144       32         119507326
BCT145       47         116435589
BCT146       53         113960364
BCT147       10         7202171
BCT148       78         113214393
BCT149       41         111552967
BCT15        68         115481838
BCT150       52         114895149
BCT151       71         110624995
BCT152       68         116214816
BCT153       57         118516540
BCT154       55         105437416
BCT155       4          9972982
BCT156       53         103990173
BCT157       60         104041780
BCT158       29         106052559
BCT159       45         111334518
BCT16        57         117543920
BCT160       61         114359757
BCT161       48         109302441
BCT162       64         106530026
BCT163       54         113478789
BCT164       12         9404870
BCT165       48         109450542
BCT166       55         109787120
BCT167       47         110027303
BCT168       43         107117265
BCT169       52         110547814
BCT17        68         124670645
BCT170       32         111477531
BCT171       47         110078868
BCT172       16         65697931
BCT173       35         105782148
BCT174       31         113194330
BCT175       45         111272915
BCT176       42         111094392
BCT177       44         110531285
BCT178       44         113013263
BCT179       48         113454228
BCT18        42         122144565
BCT180       36         112556881
BCT181       12         28297617
BCT182       94         107567012
BCT183       30         110366632
BCT184       26         106790034
BCT185       26         106809724
BCT186       32         109523551
BCT187       55         111390068
BCT188       41         108953811
BCT189       59         110912261
BCT19        87         120309182
BCT190       31         112078149
BCT191       41         109403519
BCT192       31         110697152
BCT193       50         107306618
BCT194       57         111332423
BCT195       44         115114458
BCT196       16         16267383
BCT197       99         108381810
BCT198       51         106146784
BCT199       44         108052927
BCT2         31212      98905004
BCT20        59         119196182
BCT200       62         113802879
BCT201       33         108653262
BCT202       58         111292805
BCT203       72         108345069
BCT204       56         112021258
BCT205       58         112132443
BCT206       32         109601666
BCT207       38         110465185
BCT208       78         112673391
BCT209       44         113874739
BCT21        84         136100460
BCT210       7          6933132
BCT211       70         112593200
BCT212       43         110525413
BCT213       43         110990329
BCT214       49         111793797
BCT215       71         106813745
BCT216       90         102779316
BCT217       37         107329358
BCT218       34         79247714
BCT219       92         109381196
BCT22        80         120254017
BCT220       41         107950172
BCT221       26         106778322
BCT222       47         110315600
BCT223       47         104243616
BCT224       35         108829167
BCT225       65         109693548
BCT226       41         110515345
BCT227       44         110560139
BCT228       2          6141078
BCT229       67         110772768
BCT23        75         113256316
BCT230       105        103957203
BCT231       61         110261401
BCT232       64         111657791
BCT233       56         105925901
BCT234       52         110893742
BCT235       76         107400761
BCT236       86         107960836
BCT237       36         104434144
BCT238       9          29834418
BCT239       50         113958402
BCT24        82         116813733
BCT240       53         108011335
BCT241       68         109924774
BCT242       53         111336770
BCT243       79         109395863
BCT244       56         108466136
BCT245       46         109773304
BCT246       55         112640675
BCT247       50         111417171
BCT248       71         114438724
BCT249       47         41793332
BCT25        417        41441820
BCT250       45         111169375
BCT251       48         112304661
BCT252       47         108169953
BCT253       56         110442296
BCT254       59         114186683
BCT255       39         99574876
BCT256       60         112493559
BCT257       48         109407126
BCT258       48         108314405
BCT259       54         111268721
BCT26        5200       7533877
BCT260       77         109102210
BCT261       39         108826242
BCT262       12         31245419
BCT263       45         114574544
BCT264       38         116565752
BCT265       52         114050661
BCT266       73         111425164
BCT267       52         109264071
BCT268       52         112295076
BCT269       55         110521615
BCT27        10401      13140323
BCT270       57         110855300
BCT271       99         116067659
BCT272       30         105557838
BCT273       33         104769474
BCT274       77         105772469
BCT275       64         105999418
BCT276       76         109033010
BCT277       80         120022012
BCT278       69         114090475
BCT279       60         114982068
BCT28        53817      84837648
BCT280       80         110733097
BCT281       66         112309602
BCT282       62         104679862
BCT283       54         107235471
BCT284       37         105784763
BCT285       37         71858617
BCT286       48         109227235
BCT287       45         110539692
BCT288       79         107708967
BCT289       56         111292679
BCT29        86         109498452
BCT290       73         115746712
BCT291       67         124200221
BCT292       59         112164050
BCT293       25         76543615
BCT294       63         109325026
BCT295       62         117063726
BCT296       58         108982065
BCT297       59         109955788
BCT298       56         108645655
BCT299       44         112623870
BCT3         47         113004732
BCT30        137        95492678
BCT300       81         116574557
BCT301       53         122800107
BCT302       55         110399286
BCT303       37         100562351
BCT304       43         83708607
BCT305       204        94545960
BCT306       324        21043424
BCT307       1589       2511957
BCT308       3172       5268484
BCT309       6338       7796395
BCT31        58         113456579
BCT310       12613      14997742
BCT311       25523      27672627
BCT312       50567      54076291
BCT313       76727      78743326
BCT314       72579      78143532
BCT315       8199       93040725
BCT316       5442       100112786
BCT317       3164       103164360
BCT318       131        99758696
BCT319       37         107005463
BCT32        52         112579647
BCT320       1175       101441039
BCT321       6177       100116803
BCT322       35607      90502530
BCT323       6626       5180961
BCT324       71367      76385903
BCT325       3728       103841551
BCT326       4392       102170073
BCT327       6614       100689969
BCT328       3479       101194101
BCT329       21559      101044849
BCT33        48         116997605
BCT330       76018      80400032
BCT331       66075      72374173
BCT332       76458      79303497
BCT333       73041      77678972
BCT334       73640      75269061
BCT335       10017      12396828
BCT336       71945      76242086
BCT337       72982      75186068
BCT338       24690      23992204
BCT339       67789      82528733
BCT34        59         116528153
BCT340       65396      85228942
BCT341       27212      38044901
BCT342       59603      85544722
BCT343       30644      54282305
BCT344       23390      105460805
BCT345       3613       161822117
BCT346       1177       171298795
BCT347       5714       100369767
BCT348       1876       110438186
BCT349       3943       116786494
BCT35        67         111716379
BCT350       605        108014551
BCT351       2978       116704278
BCT352       579        120301954
BCT353       630        40284139
BCT354       433        122245203
BCT355       643        135334354
BCT356       24         121141932
BCT357       23         119448234
BCT358       23         121728168
BCT359       28         120478210
BCT36        30         80349661
BCT360       1804       131743249
BCT361       1236       126375562
BCT362       683        118374144
BCT363       152        184368192
BCT364       46040      102776608
BCT365       50         97949032
BCT366       50         106335547
BCT367       50         1561655
BCT368       50         101258277
BCT369       50         94513130
BCT37        44         112327765
BCT370       50         95489948
BCT371       50         102139896
BCT372       50         105656139
BCT373       50         106415423
BCT374       50         108321086
BCT375       50         62125691
BCT376       50         85111581
BCT377       50         119404284
BCT378       50         107709881
BCT379       50         94706065
BCT38        59         108549640
BCT380       50         79983165
BCT381       50         88794851
BCT382       50         115328517
BCT383       50         85184710
BCT384       50         94454744
BCT385       50         60419023
BCT386       50         66105648
BCT387       50         86430055
BCT388       50         79069558
BCT389       50         88182899
BCT39        72         113152419
BCT390       50         87739549
BCT391       45         34489766
BCT4         58         114249094
BCT40        59         112109297
BCT41        60         105492134
BCT42        58         112573463
BCT43        51         106493710
BCT44        50         111687232
BCT45        94         111458496
BCT46        58         111561411
BCT47        84         112644694
BCT48        108        108953601
BCT49        30         51546888
BCT5         27521      104244516
BCT50        201        112694419
BCT51        53         109969331
BCT52        35         108859141
BCT53        60         109966555
BCT54        58         109966357
BCT55        46         113084021
BCT56        77         110161336
BCT57        62         109092488
BCT58        46         111286269
BCT59        60         112027245
BCT6         10015      14329967
BCT60        78         112427817
BCT61        84         111007733
BCT62        67         109336234
BCT63        61         108350042
BCT64        59         109790210
BCT65        55         108616273
BCT66        55         110914781
BCT67        65         113580356
BCT68        62         106974023
BCT69        69         106881048
BCT7         39660      85261853
BCT70        62         115998031
BCT71        44         116898024
BCT72        73         109295595
BCT73        55         114736382
BCT74        66         113765735
BCT75        9          1978793
BCT76        43         109853786
BCT77        51         118673819
BCT78        68         113547030
BCT79        48         110288002
BCT8         1634       53993214
BCT80        55         116500783
BCT81        104        116324895
BCT82        70         111645516
BCT83        85         109846187
BCT84        64         113994836
BCT85        62         118631327
BCT86        51         119558294
BCT87        57         114381603
BCT88        58         119532886
BCT89        4          10793059
BCT9         8013       93844117
BCT90        48         118002347
BCT91        135        118620434
BCT92        182        117074069
BCT93        66         111220207
BCT94        300        116964215
BCT95        60         109500882
BCT96        68         108099612
BCT97        45         112926461
BCT98        62         111891716
BCT99        62         108342624
ENV1         93358      72333323
ENV10        86894      70993003
ENV11        93913      73214561
ENV12        82532      86709410
ENV13        19470      17012007
ENV14        85265      81189699
ENV15        119466     43018577
ENV16        89276      78082707
ENV17        97040      68007262
ENV18        96513      63825868
ENV19        113338     67179214
ENV2         96273      69693278
ENV20        118296     65720479
ENV21        58554      79061329
ENV22        64374      80737775
ENV23        91129      75798069
ENV24        126088     39520982
ENV25        123699     29162441
ENV26        87593      20175108
ENV27        123670     50556778
ENV28        97296      68217006
ENV29        117676     55892510
ENV3         94718      67994029
ENV30        138240     52915200
ENV31        106657     62329495
ENV32        96134      65252759
ENV33        21172      20691644
ENV34        62756      85293276
ENV35        89613      73495914
ENV36        103473     44259462
ENV37        96570      57681749
ENV38        69282      52750850
ENV39        111939     47573882
ENV4         72780      83594925
ENV40        101607     61407750
ENV41        107080     62865821
ENV42        63768      91044010
ENV43        72790      79084539
ENV44        62246      84555933
ENV45        11500      15668393
ENV46        71119      78555562
ENV47        108843     49752000
ENV48        113081     56887755
ENV49        105032     61484594
ENV5         40073      98320054
ENV50        78188      41635857
ENV51        101430     44617254
ENV52        42567      53404691
ENV53        42078      54694499
ENV54        58590      57604765
ENV55        97242      61438006
ENV56        32711      18455617
ENV57        92511      67352399
ENV58        81442      71525286
ENV59        78899      68374355
ENV6         66476      92881938
ENV60        86531      70199413
ENV61        97036      59979090
ENV62        79999      52198919
ENV63        110426     46323885
ENV64        90531      60933106
ENV65        101844     52169130
ENV66        94533      57428474
ENV67        80353      75383379
ENV68        29760      21720629
ENV69        74406      83178393
ENV7         90048      86396734
ENV70        83690      51662658
ENV71        86651      60199605
ENV72        58517      76575688
ENV73        106177     31841034
ENV74        62534      15798090
ENV75        79276      74763402
ENV76        92969      58340270
ENV77        102131     60379155
ENV78        109355     39338754
ENV79        108703     38402783
ENV8         82448      46991053
ENV80        30792      23000201
ENV81        99402      54592574
ENV82        117115     29632068
ENV83        108172     42085316
ENV84        104516     50523875
ENV85        107172     42682598
ENV86        103081     51226307
ENV87        121814     47524037
ENV88        120176     39401270
ENV89        102644     53234479
ENV9         132108     31605894
ENV90        100620     55016890
ENV91        28528      29543038
ENV92        97140      55388012
ENV93        97520      56552597
ENV94        77789      45992796
ENV95        101223     59366710
ENV96        91944      67123645
ENV97        124447     47280640
ENV98        124214     46174412
ENV99        755        410347
EST1         160147     62055496
EST10        169952     73460692
EST100       231467     141034041
EST101       239302     125377034
EST102       194702     104546771
EST103       182390     102756230
EST104       93676      66316239
EST105       161408     120611065
EST106       175080     106821755
EST107       134235     84331809
EST108       63884      23749865
EST109       63412      22288910
EST11        168586     72947808
EST110       63854      23122662
EST111       63916      26929608
EST112       64401      22911933
EST113       64607      24630352
EST114       63537      27083983
EST115       63849      26181805
EST116       64075      27278891
EST117       63912      25159791
EST118       61292      34058859
EST119       129465     64374313
EST12        172601     74138666
EST120       161381     86187352
EST121       184500     93030982
EST122       149303     95971061
EST123       158292     93247176
EST124       125571     81782695
EST125       189329     90796862
EST126       157056     83452617
EST127       158257     84994895
EST128       158541     85468321
EST129       151341     84885576
EST13        56802      27080034
EST130       174570     93803717
EST131       184747     117855423
EST132       202239     102156891
EST133       161242     88509706
EST134       162126     81443164
EST135       144253     85120597
EST136       144327     90731565
EST137       91846      47762292
EST138       173608     98196766
EST139       244890     113054960
EST14        218895     109883726
EST140       155950     84221852
EST141       168113     92696340
EST142       150609     87915788
EST143       135833     83841619
EST144       155974     96188339
EST145       155066     85664926
EST146       124018     63573618
EST147       121156     65083576
EST148       127875     57369355
EST149       127025     51016825
EST15        169755     106514026
EST150       128320     51159464
EST151       111557     41543391
EST152       164718     83016142
EST153       177835     74484978
EST154       162637     111157878
EST155       201803     123525139
EST156       214137     121574464
EST157       175720     96916367
EST158       155860     108342852
EST159       140168     95323614
EST16        183761     113817553
EST160       157881     96788004
EST161       156709     82479089
EST162       139390     78566667
EST163       172464     95509156
EST164       60611      38718634
EST165       151294     92666129
EST166       193520     111110208
EST167       146575     84280592
EST168       142424     72159558
EST169       152817     88511742
EST17        195553     117851861
EST170       190078     105264325
EST171       156987     96391869
EST172       168561     83488004
EST173       130230     87260998
EST174       173553     101809169
EST175       173671     100169628
EST176       119220     67655763
EST177       159851     91252991
EST178       21162      13017627
EST179       171661     103705274
EST18        195686     119611845
EST180       182535     120344935
EST181       144523     116575465
EST182       195086     100059024
EST183       153518     105316008
EST184       153546     99036742
EST185       142348     82799443
EST186       179090     73130023
EST187       150401     83236889
EST188       157507     100798354
EST189       160824     98390126
EST19        160172     113594769
EST190       141675     86065445
EST191       149184     89028683
EST192       147352     94376905
EST193       132174     91879327
EST194       142344     87476663
EST195       138322     90275699
EST196       133567     93949260
EST197       164879     88034958
EST198       175502     96471761
EST199       174857     97279330
EST2         162886     61826800
EST20        190578     100880305
EST200       172548     96905113
EST201       169976     95253890
EST202       173439     96374625
EST203       174883     95832116
EST204       175407     96455587
EST205       4743       2477962
EST206       190346     105932551
EST207       207615     105884500
EST208       172756     103038308
EST209       181827     103024656
EST21        221396     107287800
EST210       201946     122678856
EST211       198533     114015988
EST212       194118     125093798
EST213       137598     92197682
EST214       221002     141080417
EST215       237982     119308438
EST216       149114     101361890
EST217       183390     101249253
EST218       203514     99789075
EST219       132275     95254621
EST22        184955     59854910
EST220       147764     87094550
EST221       211166     117041693
EST222       160618     104269498
EST223       105055     110341348
EST224       155111     103390592
EST225       162753     97821844
EST226       142146     101636857
EST227       223685     106885671
EST228       137162     99224246
EST229       115361     82157219
EST23        137189     39299163
EST230       138523     98358366
EST231       123251     88291525
EST232       144460     90212907
EST233       130137     88896080
EST234       140886     105536040
EST235       132399     93271628
EST236       125284     84806555
EST237       142639     88354075
EST238       160221     121972361
EST239       124212     118263838
EST24        102669     27765924
EST240       139885     103644921
EST241       178428     107974649
EST242       164398     102200056
EST243       159443     100700313
EST244       75824      44337431
EST245       167493     126123545
EST246       144069     106400874
EST247       157002     100609225
EST248       215112     97853316
EST249       184835     113212203
EST25        119100     50117663
EST250       156547     84361761
EST251       219287     30220793
EST252       218175     87936370
EST253       163712     122152690
EST254       174603     102452238
EST255       163662     108622282
EST256       108117     67073765
EST257       156111     114047682
EST258       185604     112469741
EST259       189789     98484217
EST26        215597     98196770
EST260       177166     111129514
EST261       163782     111632405
EST262       233563     109786444
EST263       279466     121768400
EST264       189024     113911896
EST265       188672     37198993
EST266       260686     125130081
EST267       56108      36727751
EST268       153853     98124293
EST269       166625     102596812
EST27        220492     110846129
EST270       167449     114854190
EST271       197930     103295217
EST272       159066     107916501
EST273       195622     114558964
EST274       199145     46972093
EST275       204883     45134375
EST276       183726     103090243
EST277       177273     119118612
EST278       182041     115065000
EST279       116998     66656061
EST28        190466     88175343
EST280       176217     114708471
EST281       172195     75100832
EST282       132663     82986174
EST283       132773     86102821
EST284       157008     101434759
EST285       262659     27693871
EST286       266657     24517606
EST287       145337     107847166
EST288       170010     111141988
EST289       160932     101310118
EST29        158680     69288682
EST290       163191     89630117
EST291       138801     12694771
EST292       210501     74869326
EST293       166662     107911009
EST294       177574     107016795
EST295       154640     100182934
EST296       202013     108759466
EST297       153418     110782949
EST298       168059     101810996
EST299       187994     115321548
EST3         152205     54001983
EST30        172610     69767365
EST300       180716     104179745
EST301       188061     98062394
EST302       184124     64334000
EST303       117551     41443935
EST304       183963     71375244
EST305       184618     69637582
EST306       186536     96911878
EST307       183246     131704566
EST308       145965     84869416
EST309       153086     92925668
EST31        152091     64370071
EST310       132113     100758998
EST311       162237     97338420
EST312       173139     99093326
EST313       150430     97326809
EST314       167789     94919746
EST315       161110     107773219
EST316       95339      67618516
EST317       165803     108821995
EST318       158176     109514559
EST319       179779     152479576
EST32        167654     76279613
EST320       171142     111560463
EST321       142636     76713511
EST322       143983     98171339
EST323       147340     100921125
EST324       135645     91410751
EST325       149938     100207096
EST326       150961     101537017
EST327       178610     109566038
EST328       148866     84413930
EST329       149383     85201034
EST33        179342     70572819
EST330       57738      35903309
EST331       151264     108835887
EST332       162152     97447449
EST333       144247     91767002
EST334       142549     89682937
EST335       206368     111977400
EST336       136391     74610436
EST337       91279      54622989
EST338       131551     86733934
EST339       137990     87633080
EST34        113584     37347505
EST340       125499     80142761
EST341       162869     86553495
EST342       217595     84797806
EST343       169066     88392482
EST344       100433     59082767
EST345       166183     104019135
EST346       147235     90048541
EST347       133515     88935987
EST348       136754     89158866
EST349       187975     122731074
EST35        96454      29606959
EST350       160498     97231524
EST351       155702     78610158
EST352       188268     129032617
EST353       115570     79787107
EST354       73587      44052528
EST355       139384     77042839
EST356       131086     78405670
EST357       149598     56396393
EST358       159291     32706708
EST359       34461      6960429
EST36        96819      30305623
EST360       156187     43024119
EST361       191763     121728611
EST362       240593     114305215
EST363       249181     113808961
EST364       186254     103313994
EST365       141532     91301328
EST366       137345     86967076
EST367       155359     91525728
EST368       194163     119915732
EST369       227296     62373154
EST37        95746      29047849
EST370       182955     111644815
EST371       16464      8974124
EST372       215642     118405823
EST373       205664     122189970
EST374       204384     116385172
EST375       144884     69973987
EST376       197246     121779596
EST377       163472     103508868
EST378       163249     125626949
EST379       182851     147570301
EST38        97638      29503072
EST380       158158     91280256
EST381       164857     106434120
EST382       186658     106365569
EST383       89136      52217751
EST384       206160     112270920
EST385       196701     109558496
EST386       193945     119410256
EST387       190613     124821324
EST388       202848     133490023
EST389       221578     133902451
EST39        98185      30985777
EST390       208001     133301544
EST391       198711     150772546
EST392       213387     164769098
EST393       200954     121617880
EST394       45674      27993077
EST395       181603     95534559
EST396       173733     69537175
EST397       168600     13121674
EST398       155912     15755245
EST399       159240     32813502
EST4         172169     67671492
EST40        24642      6286733
EST400       159352     32545667
EST401       157868     41066338
EST402       150510     94590265
EST403       186106     115958373
EST404       164998     107385765
EST405       166352     107067380
EST406       146074     98141756
EST407       101423     70996587
EST408       145449     94975411
EST409       173025     118632652
EST41        101644     53117804
EST410       142767     99315020
EST411       177797     105111062
EST412       173198     36316155
EST413       166534     59324959
EST414       156482     110523373
EST415       163157     104443087
EST416       162225     100611229
EST417       159395     92271919
EST418       189675     124590747
EST419       145085     95827710
EST42        119850     50999334
EST420       125123     85910814
EST421       154606     95682650
EST422       156773     94053096
EST423       175989     94204527
EST424       160098     96712148
EST425       168382     97039009
EST426       172937     106168875
EST427       139376     88074496
EST428       101988     72866796
EST429       80525      61911443
EST43        167628     92700573
EST430       106645     70203563
EST431       156972     86124404
EST432       127069     77344610
EST433       139425     91449977
EST434       141983     83475789
EST435       43020      29150245
EST436       168039     97975397
EST437       179737     93690931
EST438       164436     105744898
EST439       156128     96921491
EST44        170958     72058651
EST440       172775     77542481
EST441       195438     107842904
EST442       153893     83615987
EST443       170083     99359516
EST444       221076     129213542
EST445       157092     107678953
EST446       168825     103321650
EST447       140279     91220781
EST448       17004      11144123
EST449       136217     91222369
EST45        167918     85558292
EST450       199228     74832704
EST451       181648     86230195
EST452       207398     88820029
EST453       201356     81778212
EST454       182737     107382304
EST455       184094     112264564
EST456       191005     109973278
EST457       196150     116630499
EST458       200236     127474324
EST459       189595     88455787
EST46        169839     87309406
EST460       10040      4779416
EST461       188164     115026673
EST462       204993     121455105
EST463       202413     120610310
EST464       171509     104714253
EST465       200400     126101226
EST466       154883     90952694
EST467       149745     112563154
EST468       159975     87321048
EST469       191184     98210871
EST47        164138     88254874
EST470       144702     77831931
EST471       155214     84863213
EST472       128503     64855343
EST473       182506     113196773
EST474       172137     103536735
EST475       181227     122649413
EST476       183464     122579003
EST477       188360     115459244
EST478       176154     101785783
EST479       188601     100251137
EST48        163278     83088436
EST480       168151     59530445
EST481       161828     62409951
EST482       35026      11864154
EST49        160383     91747250
EST5         170274     66706241
EST50        163023     90617850
EST51        158737     97332743
EST52        159952     71235567
EST53        149283     83476774
EST54        63369      43122119
EST55        168245     70344184
EST56        165800     75339984
EST57        166080     91732740
EST58        159227     96899031
EST59        157542     103351009
EST6         172387     67094668
EST60        165691     99692388
EST61        161244     109143492
EST62        172969     78932876
EST63        174733     94959811
EST64        155680     84615648
EST65        149018     82982473
EST66        160924     97883267
EST67        122846     70616208
EST68        150502     92247281
EST69        197248     109655294
EST7         171645     73631196
EST70        182802     95391295
EST71        223277     122528758
EST72        187783     112781248
EST73        203233     120228301
EST74        164882     90230246
EST75        132642     61027641
EST76        136202     67086237
EST77        161029     103059257
EST78        157797     94063310
EST79        143927     79273076
EST8         181630     73732762
EST80        38661      17988472
EST81        164990     100912511
EST82        213947     115981599
EST83        226435     124844688
EST84        201693     95139207
EST85        213087     93823593
EST86        159919     92074537
EST87        145149     88667417
EST88        164669     80708786
EST89        160945     81095810
EST9         168699     69394213
EST90        153050     102327291
EST91        152424     91799937
EST92        123637     77991402
EST93        156662     113328317
EST94        141747     103763614
EST95        142590     101967148
EST96        141874     98039482
EST97        148160     81652750
EST98        179766     111991817
EST99        227664     137797165
GSS1         201766     88393856
GSS10        133597     61508119
GSS100       145752     114882991
GSS101       142374     116384778
GSS102       144253     117845900
GSS103       170446     129093145
GSS104       137456     74721011
GSS105       192290     121402485
GSS106       169510     113264079
GSS107       200404     117639849
GSS108       206385     135350340
GSS109       210698     139056866
GSS11        137308     73395094
GSS110       209780     139919217
GSS111       205663     145147197
GSS112       206482     144071047
GSS113       205586     145388557
GSS114       203091     147406629
GSS115       181516     137765512
GSS116       7079       3528638
GSS117       133693     84580020
GSS118       171024     80543081
GSS119       184853     80317336
GSS12        148972     76163539
GSS120       171265     149231516
GSS121       178609     120900679
GSS122       179757     146317241
GSS123       188837     121943143
GSS124       188257     138764645
GSS125       192853     128024154
GSS126       192160     95527689
GSS127       167089     153827896
GSS128       164916     116276994
GSS129       52118      29729233
GSS13        146064     69710590
GSS130       171707     156104957
GSS131       173053     155053669
GSS132       173062     155788815
GSS133       174513     154746450
GSS134       172801     155172413
GSS135       180860     139411917
GSS136       179838     146147488
GSS137       164915     119078062
GSS138       195645     96165596
GSS139       258703     40811533
GSS14        173150     86526823
GSS140       258653     39866758
GSS141       83883      12897561
GSS142       256944     59254341
GSS143       266389     55283745
GSS144       191915     88032131
GSS145       197995     66798009
GSS146       185657     147614485
GSS147       182068     150420567
GSS148       168208     155391890
GSS149       171791     158498945
GSS15        163032     97556699
GSS150       238052     73457744
GSS151       229182     82172993
GSS152       120032     51399360
GSS153       214489     54789313
GSS154       158718     98268775
GSS155       182695     113505883
GSS156       136355     87245102
GSS157       166455     132071803
GSS158       185089     162317826
GSS159       195022     160336808
GSS16        173394     88684185
GSS160       191961     125532496
GSS161       218404     139096798
GSS162       222682     133649914
GSS163       158875     97281235
GSS164       149733     87235971
GSS165       29487      22408242
GSS166       212912     158797598
GSS167       193250     101963779
GSS168       173558     69993786
GSS169       207351     160785410
GSS17        186109     116615710
GSS170       209371     162937228
GSS171       207954     164751088
GSS172       206675     132792364
GSS173       204167     148031350
GSS174       145637     88761785
GSS175       87375      64103840
GSS176       83926      63074443
GSS177       103736     48659056
GSS178       68877      58698888
GSS179       7313       6756990
GSS18        192111     112001243
GSS180       68904      58160721
GSS181       69534      56898519
GSS182       69772      56433485
GSS183       71622      56290743
GSS184       67206      50842980
GSS185       76238      58461130
GSS186       86639      74399035
GSS187       81831      44658448
GSS188       92745      45157551
GSS189       63716      47844181
GSS19        99203      44390134
GSS190       78081      61893846
GSS191       70457      59382827
GSS192       68395      63565679
GSS193       63332      52838738
GSS194       94982      42020100
GSS195       18216      4260634
GSS196       113556     71281274
GSS197       204        155559
GSS198       23226      28867035
GSS199       109864     71191275
GSS2         183363     92903519
GSS20        182134     102018573
GSS200       85115      35044717
GSS201       34412      21307549
GSS202       103993     62903048
GSS203       102976     64217927
GSS204       105147     68151070
GSS205       79884      39912713
GSS206       83527      54888563
GSS207       96136      61753164
GSS208       108044     78945540
GSS209       104766     75631871
GSS21        167232     114859942
GSS210       106686     80430314
GSS211       104248     80117974
GSS212       76721      51115479
GSS213       103345     62631542
GSS214       110548     66826634
GSS215       106064     59217010
GSS216       68303      37406677
GSS217       69501      38676711
GSS218       36754      17559162
GSS219       86142      46401696
GSS22        170202     97916777
GSS220       98449      56764845
GSS221       94892      49440300
GSS222       97262      56462367
GSS223       39255      21997076
GSS224       114855     43716251
GSS225       117293     39460437
GSS226       109075     53490846
GSS227       108949     67746338
GSS228       101533     78141049
GSS229       54628      32302240
GSS23        187607     128076472
GSS230       97424      37123873
GSS231       96927      37873906
GSS232       98284      35637304
GSS233       95520      40185769
GSS234       31845      14945615
GSS235       104191     66442509
GSS236       95150      61604354
GSS237       95766      60724103
GSS238       95367      61293700
GSS239       75595      70600991
GSS24        194112     129263191
GSS240       81979      69067111
GSS241       33571      32440711
GSS242       82831      27918196
GSS243       83303      27045179
GSS244       83897      25794921
GSS245       17701      5153013
GSS246       16547      7508221
GSS247       94605      60908245
GSS248       96103      64610709
GSS249       95270      65040443
GSS25        177441     104584455
GSS250       106528     70066025
GSS251       92475      46091116
GSS252       91780      49886764
GSS253       76121      41539409
GSS254       91399      57345117
GSS255       90265      62185096
GSS256       88936      64255670
GSS257       89858      62824607
GSS258       7578       5429987
GSS259       88518      64189595
GSS26        186610     108911114
GSS260       91219      63097213
GSS261       94711      59499098
GSS262       75614      65245817
GSS263       84994      78968925
GSS264       83445      81047461
GSS265       66441      49326047
GSS266       115710     63345042
GSS267       109508     55806767
GSS268       107863     52276734
GSS269       97634      43692152
GSS27        169596     151636730
GSS270       110146     49201977
GSS271       98861      46183314
GSS272       81078      63156364
GSS273       73131      73078884
GSS274       64591      55602017
GSS275       60949      47151330
GSS276       35630      26902277
GSS277       61051      46897110
GSS278       62318      49766268
GSS279       84463      87124836
GSS28        189649     144752617
GSS280       82870      89025174
GSS281       76621      72751886
GSS282       84728      65179968
GSS283       60336      48552561
GSS284       60281      48723318
GSS285       80187      51874172
GSS286       82184      61367380
GSS287       44416      26577232
GSS288       95284      57518679
GSS289       94047      59336854
GSS29        152614     107633448
GSS290       94416      58789547
GSS291       95209      57626971
GSS292       81805      50093018
GSS293       104332     69608616
GSS294       104890     74782057
GSS295       110042     68759043
GSS296       107586     71626914
GSS297       36263      24826247
GSS298       112024     66445708
GSS299       98068      61328228
GSS3         176506     88394950
GSS30        191222     130927043
GSS300       107603     56999080
GSS301       93293      73291771
GSS302       82737      88820842
GSS303       78908      94250347
GSS304       50490      28148542
GSS31        12106      7890148
GSS32        196439     127533969
GSS33        218981     117362130
GSS34        220852     114831387
GSS35        221963     113324105
GSS36        214667     124302089
GSS37        197225     155397680
GSS38        193935     145875400
GSS39        191369     68974205
GSS4         167759     85518632
GSS40        185160     97600580
GSS41        189761     125955498
GSS42        173642     160888425
GSS43        5987       3927599
GSS44        183966     100311532
GSS45        173274     121807446
GSS46        184128     124082945
GSS47        189635     121468909
GSS48        72701      63946125
GSS49        170766     101351050
GSS5         48508      29143102
GSS50        166917     102544217
GSS51        167103     101960328
GSS52        182672     120780882
GSS53        185111     116752809
GSS54        181953     122997714
GSS55        187100     113038211
GSS56        189343     135272415
GSS57        179005     104600319
GSS58        194201     119694328
GSS59        180383     132168671
GSS6         162428     84847761
GSS60        6752       6136544
GSS61        172439     138674275
GSS62        162915     112375740
GSS63        162938     112418280
GSS64        156424     106001592
GSS65        156671     129033606
GSS66        170936     143092732
GSS67        176931     115277478
GSS68        203418     127438263
GSS69        194390     110914837
GSS7         166528     79923105
GSS70        245897     127170207
GSS71        160707     106725670
GSS72        159977     120171210
GSS73        163425     125119417
GSS74        163390     125179961
GSS75        176014     109446063
GSS76        191299     140385795
GSS77        9287       5457779
GSS78        197587     125566180
GSS79        169882     110987161
GSS8         166565     89352425
GSS80        200252     131233072
GSS81        213078     87883995
GSS82        189425     98967539
GSS83        132405     92512465
GSS84        147250     118257640
GSS85        140219     117487940
GSS86        143489     114780353
GSS87        144607     120323535
GSS88        142692     116459835
GSS89        102514     85346116
GSS9         138313     67423895
GSS90        150146     122846863
GSS91        148368     118148342
GSS92        144647     113644015
GSS93        143499     116030340
GSS94        144993     120382598
GSS95        149051     121555980
GSS96        148092     118941829
GSS97        146794     121586586
GSS98        146798     121584467
GSS99        147331     120524208
HTC1         25101      27117411
HTC10        72060      72858919
HTC11        74167      71637494
HTC12        35257      38610901
HTC13        67768      60782734
HTC14        69854      69983544
HTC15        52070      40593047
HTC2         16105      36288852
HTC3         16046      36677221
HTC4         16271      35595400
HTC5         15996      40356923
HTC6         16084      37533163
HTC7         54286      32155873
HTC8         30551      18495385
HTC9         60910      77896619
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1053       190176019
HTG107       1392       191740916
HTG108       1294       191609595
HTG109       1641       191150380
HTG11        4          606452
HTG110       1331       192003621
HTG111       886        128541061
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1591       179505523
HTG121       1587       179611588
HTG122       1580       179575648
HTG123       1598       179580959
HTG124       1603       179513131
HTG125       1581       180746555
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1477       185749970
HTG129       1134       190249540
HTG13        875        191786413
HTG130       1105       184776025
HTG131       2          213995
HTG132       1558       186647331
HTG133       1862       178854359
HTG134       987        187982440
HTG135       1085       193367281
HTG136       1091       193164785
HTG137       578        105203883
HTG138       1032       189666580
HTG139       1055       192668594
HTG14        754        192249622
HTG140       1164       191966294
HTG141       1079       192247965
HTG142       1083       192977959
HTG143       588        103686357
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2127       191603389
HTG149       1096       192456765
HTG15        746        192098155
HTG150       1077       192049291
HTG151       1088       192458469
HTG152       1037       190364444
HTG153       1986       182780268
HTG154       1796       183271927
HTG16        785        191953105
HTG17        796        191820344
HTG18        776        191918138
HTG19        2070       170867394
HTG2         2464       186026155
HTG20        1105       187256821
HTG21        874        179202862
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2516       185249883
HTG30        911        190941779
HTG31        841        171449145
HTG32        876        191233060
HTG33        967        189366255
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2553       188400147
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1257       188207454
HTG43        1169       188143648
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1268       190550291
HTG47        1175       190762525
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        969        190260546
HTG53        1105       190197636
HTG54        1046       190176357
HTG55        1014       189806472
HTG56        968        189013700
HTG57        80         14074619
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1169       188886612
HTG66        1179       187436132
HTG67        1283       184477002
HTG68        90         11586390
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         94370      48954229
INV10        81163      72350122
INV100       29550      160266502
INV101       67580      129992426
INV102       37742      163849195
INV103       37941      155798158
INV104       48583      147979160
INV105       30062      33600034
INV106       41268      162665496
INV107       8696       189081319
INV108       14504      181734293
INV109       5314       188812993
INV11        47984      93504320
INV110       18728      176915367
INV111       34148      159145860
INV112       14531      172156000
INV113       23343      44749451
INV114       16801      180532346
INV115       21024      172709352
INV116       4912       191085678
INV117       26085      174313163
INV118       14653      181087786
INV119       44296      155953604
INV12        36         176944197
INV120       27164      171837019
INV121       19661      174103032
INV122       49402      139095230
INV123       28651      82719755
INV124       96941      109016144
INV125       35406      167752675
INV126       23689      177133477
INV127       21926      171277525
INV128       4820       190701562
INV129       29469      152201061
INV13        3777       181280103
INV130       55399      123739171
INV131       565        34477095
INV132       7360       190715808
INV133       51899      153647552
INV134       5654       188079557
INV135       35203      162586890
INV136       3198       18041487
INV137       39923      160004572
INV138       62778      141980869
INV139       19018      29478718
INV14        83629      66195691
INV140       105390     107166795
INV141       73947      121461718
INV142       12195      167796087
INV143       18372      163847824
INV144       13545      92747660
INV145       29318      156008826
INV146       38723      149357093
INV147       51920      140051234
INV148       71367      126811786
INV149       98260      108390168
INV15        65838      54819623
INV150       127433     86666622
INV151       26213      144286725
INV152       15139      139613180
INV153       257        150286120
INV154       36294      118613112
INV155       9180       47868821
INV16        85667      66960932
INV17        81739      67558512
INV18        79219      68611848
INV19        47196      43376927
INV2         59208      93061224
INV20        36854      122809002
INV21        283        150449073
INV22        51754      102165931
INV23        78071      57535406
INV24        69646      59182640
INV25        23154      127363355
INV26        6          133712559
INV27        57409      102368891
INV28        75307      50954890
INV29        68514      49820824
INV3         1370       188427351
INV30        77842      55704167
INV31        76395      57778536
INV32        77674      59849395
INV33        74683      52836737
INV34        51121      33865342
INV35        79755      57415742
INV36        75619      56258930
INV37        75145      61714583
INV38        78730      58703633
INV39        52243      35022831
INV4         855        123355476
INV40        78759      56868173
INV41        74674      52838199
INV42        75666      57790633
INV43        78236      58060858
INV44        34553      30162669
INV45        76874      49088210
INV46        74282      45425862
INV47        76685      46659449
INV48        77182      54889839
INV49        25229      17620092
INV5         26939      110547639
INV50        77380      54864495
INV51        75397      45078955
INV52        74776      43861425
INV53        75040      43288398
INV54        70629      42785238
INV55        70027      41333662
INV56        69680      42105526
INV57        69885      41016425
INV58        70107      45962925
INV59        5657       3126591
INV6         78679      72104506
INV60        70220      40982895
INV61        71677      44238748
INV62        66936      49907357
INV63        69438      49679424
INV64        56172      44507169
INV65        70632      52589663
INV66        75600      54902568
INV67        71138      63913186
INV68        77612      56050217
INV69        42838      119783544
INV7         53879      96394635
INV70        35330      85356710
INV71        81899      126749699
INV72        101136     110191760
INV73        116939     96644568
INV74        99289      69232818
INV75        35246      167082089
INV76        30784      171928044
INV77        27689      171878890
INV78        2670       191216364
INV79        6193       191203895
INV8         8133       172165814
INV80        17813      180380779
INV81        15388      184897353
INV82        6812       164358105
INV83        8880       189597154
INV84        15686      184336589
INV85        30825      171780128
INV86        66120      142501460
INV87        20986      21881179
INV88        50231      154102086
INV89        4106       191144025
INV9         33451      39587820
INV90        11236      184725560
INV91        29087      169091322
INV92        3330       189370323
INV93        6354       186214262
INV94        12432      180552662
INV95        40321      157085197
INV96        61631      142103282
INV97        66269      109992870
INV98        93107      113729954
INV99        14323      174104346
MAM1         21065      155372374
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         14504      164541126
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         19909      31669572
MAM30        1706       2411269
MAM31        6836       6159435
MAM32        80286      75309909
MAM33        30239      118090157
MAM34        76918      63014744
MAM35        69557      73044586
MAM36        66265      78686187
MAM37        54535      88671348
MAM38        9279       182861404
MAM39        4217       4774969
MAM4         26813      24993672
MAM5         13731      20581346
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         225426     70993955
PAT10        126650     101608710
PAT100       180490     3429310
PAT101       180135     3422565
PAT102       179993     3419867
PAT103       179981     3419639
PAT104       125419     2711863
PAT105       349650     8741250
PAT106       186050     91875274
PAT107       107513     135541957
PAT108       3843       194691476
PAT109       137991     108090545
PAT11        90439      62784009
PAT110       151783     50730134
PAT111       227882     34313993
PAT112       253630     16070281
PAT113       177600     67409226
PAT114       48026      21887625
PAT115       115737     110547338
PAT116       139353     84265875
PAT117       161024     103163220
PAT118       167185     100849156
PAT119       134737     117530952
PAT12        142880     63395362
PAT120       36618      23041490
PAT121       194814     83178152
PAT122       155047     107550529
PAT123       364428     11160383
PAT124       248176     64617758
PAT125       132887     40797313
PAT126       328269     22915988
PAT127       155764     104210281
PAT128       126354     109119371
PAT129       128479     122630735
PAT13        104574     59133164
PAT130       21689      184619586
PAT131       149967     111615722
PAT132       168658     100093679
PAT133       43844      172281111
PAT134       8038       42566337
PAT135       33730      178662375
PAT136       155435     110345001
PAT137       180818     91511668
PAT138       137025     116369121
PAT139       119019     125218305
PAT14        103239     50080053
PAT140       4849       4475753
PAT141       158424     101541724
PAT142       184327     90868267
PAT143       185136     85636854
PAT144       177480     94577577
PAT145       20467      17346132
PAT146       149543     109199294
PAT147       161593     103400312
PAT148       186330     92436086
PAT149       228368     45729382
PAT15        121140     53107703
PAT150       205276     48281754
PAT151       283466     9264744
PAT152       224633     46570735
PAT153       95243      2594242
PAT154       274370     21772171
PAT155       186799     63026714
PAT156       111649     105352203
PAT157       41636      8368539
PAT158       88149      89410030
PAT159       79147      97084139
PAT16        113081     61313692
PAT160       152813     75257161
PAT161       163972     75813792
PAT162       125685     90270056
PAT163       98233      89706875
PAT164       160473     39715945
PAT165       274167     5209173
PAT166       274122     5208318
PAT167       274122     5208318
PAT168       225455     4283645
PAT169       273522     5196918
PAT17        40104      16656638
PAT170       235900     27314616
PAT171       209160     45687253
PAT172       2061       71829
PAT173       165888     75954920
PAT174       91807      127288620
PAT175       177924     70072761
PAT176       210424     71389553
PAT177       39405      44063916
PAT178       236689     61271332
PAT179       125083     125590832
PAT18        147938     53119339
PAT180       217679     68931191
PAT181       197384     85491224
PAT182       192799     86183567
PAT183       160052     103142924
PAT184       158485     104252941
PAT185       152376     102303293
PAT186       153284     104821004
PAT187       108066     120931232
PAT188       131010     97456392
PAT189       129357     120521145
PAT19        156198     77748072
PAT190       175044     97302491
PAT191       144298     115604482
PAT192       132490     120416967
PAT193       99092      135657342
PAT194       156484     107532837
PAT195       187757     62538940
PAT196       31550      29445733
PAT197       93826      87469183
PAT198       91784      80783259
PAT199       85389      91256512
PAT2         194676     86398557
PAT20        105064     119277426
PAT200       109494     54259504
PAT201       97905      55962097
PAT202       151406     25025002
PAT203       92604      85288661
PAT204       27031      161947013
PAT205       116076     64442611
PAT206       78456      27182019
PAT207       3632       191904545
PAT208       84660      79944730
PAT209       147804     24785633
PAT21        131153     98542671
PAT210       77114      100107326
PAT211       95461      72396394
PAT212       130091     32533490
PAT213       1386       4384298
PAT214       107202     62296760
PAT215       140563     13376529
PAT216       152488     23320938
PAT217       78288      10420708
PAT218       53299      70147281
PAT219       41588      53257148
PAT22        83266      74943590
PAT220       60912      55078171
PAT221       37663      64678945
PAT222       41773      60415230
PAT223       40163      55397856
PAT224       87860      55688969
PAT225       115385     52030013
PAT226       26005      9048623
PAT227       105881     53605089
PAT228       97872      46919625
PAT229       86046      71865688
PAT23        124775     103848067
PAT230       97456      8893306
PAT231       117394     19496337
PAT232       87918      130066340
PAT233       161762     78738382
PAT234       211965     49799560
PAT235       174307     64860645
PAT236       52277      7524866
PAT237       162448     79722768
PAT238       121564     100429455
PAT239       85467      130881005
PAT24        118220     108124229
PAT240       38100      167516171
PAT241       35868      169133023
PAT242       74292      134041199
PAT243       256650     29271966
PAT244       136543     93162338
PAT245       150104     82887201
PAT246       140944     76153760
PAT247       12260      8251363
PAT248       142939     87445786
PAT249       144203     95212885
PAT25        150175     84692661
PAT250       264977     9686438
PAT251       144382     4340696
PAT252       240761     24361869
PAT253       256037     8953305
PAT254       262605     3939075
PAT255       262605     3939075
PAT256       153472     3896783
PAT257       225731     30138510
PAT258       151701     93683972
PAT259       172305     96419302
PAT26        178517     63567420
PAT260       166435     58052041
PAT261       90082      2900123
PAT262       77619      88246225
PAT263       10552      155302229
PAT264       76636      105127353
PAT265       101249     76175895
PAT266       37393      112049357
PAT267       34156      73068233
PAT268       37959      57714870
PAT269       37837      58070712
PAT27        63313      1582825
PAT270       37921      57726864
PAT271       37833      58048870
PAT272       46229      38674255
PAT273       129930     18053589
PAT274       115666     50591110
PAT275       124999     25115634
PAT276       76618      37964168
PAT277       133960     31130366
PAT278       139211     85056025
PAT279       261688     3925320
PAT28        102489     77951993
PAT280       245377     16389387
PAT281       114190     80066496
PAT282       202591     51164728
PAT283       144303     69701943
PAT284       133040     3992595
PAT285       132977     3990074
PAT286       44634      1339134
PAT287       133140     6548394
PAT288       96159      70667857
PAT289       103123     49989409
PAT29        95014      87382724
PAT290       125140     22774974
PAT291       144928     3764734
PAT292       136103     15294700
PAT293       194109     27990239
PAT294       80627      34987747
PAT3         173714     96696797
PAT30        120009     62059315
PAT31        97921      79760122
PAT32        129215     55155080
PAT33        88487      49386376
PAT34        118747     69220772
PAT35        120170     36360207
PAT36        122826     44471256
PAT37        94730      87320632
PAT38        150578     21220142
PAT39        147082     34845298
PAT4         156010     106306269
PAT40        110910     55386930
PAT41        33841      36793621
PAT42        96351      83600457
PAT43        99709      72323829
PAT44        138998     37627662
PAT45        143760     37193283
PAT46        125073     64720407
PAT47        100399     86321912
PAT48        99428      68548842
PAT49        111862     67345341
PAT5         50111      20254509
PAT50        60374      52824381
PAT51        136399     108802801
PAT52        168265     98178509
PAT53        119298     126920074
PAT54        201754     75944942
PAT55        69600      127456544
PAT56        27795      181082835
PAT57        189418     92960765
PAT58        277142     6928550
PAT59        122390     31451008
PAT6         171986     92903236
PAT60        162935     78473973
PAT61        92868      90601571
PAT62        109253     73716009
PAT63        123341     64227958
PAT64        62038      29214913
PAT65        70923      110313258
PAT66        88692      82810627
PAT67        93124      79739812
PAT68        94118      72274536
PAT69        94231      74769308
PAT7         157691     87492076
PAT70        118843     59763989
PAT71        96798      9793333
PAT72        177632     10656303
PAT73        173172     10978125
PAT74        173161     10971235
PAT75        94835      96316767
PAT76        101        195797548
PAT77        66         196768687
PAT78        104        196327400
PAT79        12309      182633014
PAT8         127556     101553182
PAT80        86423      5090841
PAT81        152298     9718010
PAT82        152308     9704500
PAT83        152313     9703390
PAT84        152308     9704292
PAT85        95141      89656500
PAT86        93068      93878198
PAT87        31086      33386746
PAT88        83471      94698793
PAT89        16516      179586411
PAT9         134763     98530663
PAT90        167160     18621902
PAT91        180755     3434345
PAT92        179225     3405275
PAT93        177411     3370809
PAT94        92463      1756797
PAT95        170988     12446769
PAT96        180501     3429519
PAT97        180495     3429405
PAT98        180484     3429196
PAT99        133550     2537450
PHG1         5921       107225927
PHG2         3060       109199405
PHG3         2157       109949702
PHG4         1295       18204353
PLN1         60425      94049291
PLN10        45324      44992027
PLN100       12431      129466187
PLN101       82862      66207586
PLN102       94019      58012759
PLN103       20269      14648233
PLN104       78043      71772622
PLN105       70898      84896694
PLN106       77833      68040696
PLN107       71839      77247498
PLN108       80706      67030926
PLN109       3984       3709721
PLN11        72072      77523894
PLN110       78827      64038925
PLN111       75340      68527933
PLN112       82660      59011047
PLN113       81735      59651570
PLN114       22046      25252902
PLN115       74552      63580911
PLN116       72656      71547344
PLN117       63276      85410402
PLN118       57111      64770909
PLN119       92688      52789458
PLN12        39646      50606825
PLN120       75070      68650340
PLN121       72060      68836190
PLN122       40969      49486052
PLN123       70962      71917416
PLN124       62416      79188408
PLN125       62912      82281784
PLN126       35810      33888900
PLN127       70450      73427158
PLN128       64161      77578110
PLN129       66973      78645239
PLN13        39366      63985580
PLN130       59401      86282644
PLN131       61113      83470492
PLN132       56972      74262488
PLN133       59024      85665644
PLN134       62699      79921866
PLN135       51417      91006627
PLN136       50783      93168689
PLN137       48944      93480798
PLN138       31374      101890679
PLN139       11147      164630816
PLN14        24727      121013073
PLN140       77         193883786
PLN141       18830      62283336
PLN142       12512      154597097
PLN143       6          176139136
PLN144       20504      112744907
PLN145       5          186225412
PLN146       2482       183095082
PLN147       31         190984103
PLN148       5427       185032276
PLN149       25463      124860289
PLN15        21159      106162909
PLN150       40395      68603290
PLN16        17587      144956899
PLN17        17646      146317509
PLN18        17565      146440300
PLN19        1356       10854690
PLN2         75201      78727819
PLN20        23259      121287391
PLN21        6083       151149287
PLN22        1184       166859751
PLN23        1484       166774036
PLN24        33         165555096
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21967      108091997
PLN3         35392      107286540
PLN30        67657      70408187
PLN31        28870      30899554
PLN32        77510      76709460
PLN33        35612      40573957
PLN34        57312      72147476
PLN35        28689      28923384
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        282        133858659
PLN4         1363       179471034
PLN40        99         129632256
PLN41        285        131701927
PLN42        157        130226554
PLN43        90         71965224
PLN44        157        128672551
PLN45        141        130200994
PLN46        173        129439941
PLN47        166        136053947
PLN48        211        155822577
PLN49        273        194773389
PLN5         1866       186369184
PLN50        113        80920130
PLN51        273        194661068
PLN52        186        194300255
PLN53        117        174426088
PLN54        5          168777512
PLN55        24         192004664
PLN56        114        165565131
PLN57        51         153076952
PLN58        5          188904320
PLN59        6          174816511
PLN6         1853       194353148
PLN60        33         193402397
PLN61        232        183612521
PLN62        213        19014218
PLN63        2469       93786416
PLN64        7181       18795412
PLN65        14346      29953091
PLN66        19351      134332086
PLN67        78624      75203750
PLN68        98954      57604272
PLN69        30209      32266494
PLN7         1688       194276922
PLN70        81018      72162372
PLN71        78276      76491240
PLN72        80736      70933502
PLN73        82115      76012184
PLN74        57091      30525785
PLN75        99621      56068164
PLN76        81995      69950460
PLN77        46546      98332202
PLN78        3039       158066901
PLN79        11879      166061017
PLN8         1850       193328296
PLN80        29885      120807760
PLN81        59209      98674174
PLN82        11529      7921174
PLN83        81764      72869494
PLN84        16703      12426382
PLN85        49499      72634826
PLN86        25061      110565816
PLN87        13564      89766260
PLN88        1          774434471
PLN89        8305       28494018
PLN9         51318      104914015
PLN90        1858       148969943
PLN91        2          135217911
PLN92        2          155188403
PLN93        2          140023111
PLN94        2          154604167
PLN95        2          148753627
PLN96        3          173772618
PLN97        3          178836778
PLN98        3          176344173
PLN99        3          195539469
PRI1         23034      59762327
PRI10        1253       178780857
PRI11        860        104346432
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22392      144960164
PRI20        1737       191814810
PRI21        2631       189865971
PRI22        2080       192719836
PRI23        2776       191056892
PRI24        14261      35779740
PRI25        27930      79134981
PRI26        59941      84371465
PRI27        36109      81894692
PRI28        8761       172362823
PRI29        2264       191585097
PRI3         1438       174353221
PRI30        1666       190931151
PRI31        2074       192118866
PRI32        2196       191069594
PRI33        13104      162575570
PRI34        2098       170891945
PRI35        57042      89265821
PRI36        3822       7514956
PRI37        33761      66545857
PRI38        19381      127312791
PRI39        20385      148361481
PRI4         1278       185868863
PRI40        67566      84523120
PRI41        51509      91984771
PRI42        38438      73315960
PRI43        47896      96566360
PRI44        26428      103373869
PRI45        29287      110638629
PRI46        25143      104923782
PRI47        29526      101888259
PRI48        5090       42436304
PRI49        39419      104772749
PRI5         1335       184501516
PRI50        35074      106092202
PRI51        30418      91871369
PRI52        1          229594237
PRI53        1          190673448
PRI54        1          197221778
PRI55        10077      168633569
PRI56        49696      91747174
PRI57        5521       38446186
PRI6         1179       179994692
PRI7         1229       180208989
PRI8         1221       179042773
PRI9         1372       174851936
ROD1         37508      133642525
ROD10        989        182010602
ROD11        307        58052732
ROD12        1034       185475616
ROD13        941        182878681
ROD14        1040       189304693
ROD15        950        180388993
ROD16        967        181966557
ROD17        991        185834465
ROD18        1190       190611728
ROD19        15160      158964430
ROD2         908        176070435
ROD20        20997      153967703
ROD21        1216       193771265
ROD22        1003       157974000
ROD23        15427      168556614
ROD24        38056      70211304
ROD25        19424      118490288
ROD26        2253       191869099
ROD27        152518     18055041
ROD28        75935      79162602
ROD29        84552      53173238
ROD3         910        173108361
ROD30        56203      69120223
ROD4         900        173849398
ROD5         919        174488736
ROD6         965        177341176
ROD7         974        179555511
ROD8         969        181372318
ROD9         1001       181665338
STS1         85559      36896329
STS10        58083      44552041
STS11        48085      36873197
STS12        58099      43769473
STS13        64422      42856172
STS14        93857      34186170
STS15        104888     26688384
STS16        8950       2430284
STS17        104293     27679407
STS18        97854      33659726
STS19        97350      34711104
STS2         85035      49980125
STS20        69630      24719701
STS3         66345      26281661
STS4         77125      37068775
STS5         8191       4810172
STS6         54412      31740785
STS7         54312      31932091
STS8         54469      32048894
STS9         55909      37990705
SYN1         53374      71687234
SYN10        14506      43286598
SYN2         43611      81487738
SYN3         23536      126648997
SYN4         4594       176471685
SYN5         4588       176370389
SYN6         4594       176441445
SYN7         11379      161065808
SYN8         57202      74499496
SYN9         51055      85259093
TSA1         119867     38078881
TSA10        15758      19457445
TSA100       84628      38647321
TSA101       76860      53168945
TSA102       66230      68312035
TSA103       64656      75546157
TSA104       88788      55755865
TSA105       48310      25539654
TSA106       74550      86726411
TSA107       80730      75604381
TSA108       85476      72848266
TSA109       77478      84240678
TSA11        134601     34776357
TSA110       95998      51845228
TSA111       98404      70808887
TSA112       57282      94203955
TSA113       109914     49593061
TSA114       63991      68743855
TSA115       81365      89245306
TSA116       70500      72924301
TSA117       57286      120848369
TSA118       3694       3387893
TSA119       107244     68283732
TSA12        59950      20118999
TSA120       93864      83831193
TSA121       99424      76800693
TSA122       86215      66900549
TSA123       85151      59462891
TSA124       78375      62323129
TSA125       82309      77796077
TSA126       99831      59566185
TSA127       94854      42432041
TSA128       75820      55296063
TSA129       40565      38073071
TSA13        64437      60230317
TSA130       59842      61355677
TSA131       59222      61956330
TSA132       59447      62201688
TSA133       72514      79237539
TSA134       88241      50637266
TSA135       63416      65296736
TSA136       832        252551
TSA137       78109      34727398
TSA138       74879      67607515
TSA139       81463      78932809
TSA14        93892      60774882
TSA140       75039      64606512
TSA141       40597      33646913
TSA142       87917      70744689
TSA143       89637      68264227
TSA144       84723      77981171
TSA145       77299      81247994
TSA146       10512      8596527
TSA147       104870     53942459
TSA148       80798      61849074
TSA149       70761      78288377
TSA15        91383      65106730
TSA150       72668      69649300
TSA151       88477      74130296
TSA152       89281      71320562
TSA153       63447      101767938
TSA154       95795      75263071
TSA155       16998      11858365
TSA156       83362      63896652
TSA157       83862      64153636
TSA158       79385      73616320
TSA159       77070      76639823
TSA16        6713       3516114
TSA160       93994      58998624
TSA161       101042     66808521
TSA162       33299      23300565
TSA163       102259     63715273
TSA164       94026      74723592
TSA165       80955      64132522
TSA166       32032      49058197
TSA167       51993      98573117
TSA168       46992      108059536
TSA169       45060      111729686
TSA17        76328      86345063
TSA170       42052      117437639
TSA171       39600      122092043
TSA172       37741      125627862
TSA173       30097      107288374
TSA174       79278      65831927
TSA175       61766      78801121
TSA176       65943      56757743
TSA177       40135      19854948
TSA178       38520      26931630
TSA179       35906      38483420
TSA18        79571      72873999
TSA180       33719      32835987
TSA181       31723      56974521
TSA182       31529      57827756
TSA183       39360      23153642
TSA184       40480      18197417
TSA185       41160      15188692
TSA186       41560      13420160
TSA187       41798      12369266
TSA188       25925      7379156
TSA189       41988      11531997
TSA19        87122      45676818
TSA190       42033      11331256
TSA191       42081      11121330
TSA192       42155      10791502
TSA193       42199      10594518
TSA194       42246      10386471
TSA195       44469      10970414
TSA196       89574      35651580
TSA197       85248      64327814
TSA198       71514      85727361
TSA199       104370     34591482
TSA2         113513     41575102
TSA20        74112      88789066
TSA200       79480      68069082
TSA201       46133      105547678
TSA202       89741      47774789
TSA203       47189      118699045
TSA204       87176      55356978
TSA205       79486      69671475
TSA206       52801      112476082
TSA207       44638      125583658
TSA208       38073      136130006
TSA209       61544      98133552
TSA21        65190      48723008
TSA210       12102      5800279
TSA211       58652      100603319
TSA212       75646      71894803
TSA213       50457      112947945
TSA214       77365      67441564
TSA215       53726      106980439
TSA216       75926      70339630
TSA217       59610      97707887
TSA218       61369      69985665
TSA219       74428      72821943
TSA22        81439      82281132
TSA220       87323      50951603
TSA221       50899      111127179
TSA222       71562      76448065
TSA223       62951      91534461
TSA224       85139      53774514
TSA225       83387      56083879
TSA226       10763      4953843
TSA227       64419      91116089
TSA228       71926      77423316
TSA229       70933      78656816
TSA23        63006      84596593
TSA230       88398      46498714
TSA231       63160      89037236
TSA232       93507      36784395
TSA233       65147      85307235
TSA234       57907      35845393
TSA24        85122      73285996
TSA25        100185     52955079
TSA26        60478      18672749
TSA27        86234      70407370
TSA28        121324     38862791
TSA29        135063     35310894
TSA3         110421     41064860
TSA30        51855      68718843
TSA31        47829      62910692
TSA32        1549       2253596
TSA33        61314      82147786
TSA34        93472      67491932
TSA35        110655     50015529
TSA36        106345     50201806
TSA37        102307     54388700
TSA38        103560     49787675
TSA39        22637      12494687
TSA4         112137     47720377
TSA40        66642      59388549
TSA41        92820      68251805
TSA42        93446      62442749
TSA43        79794      86536802
TSA44        100835     49268702
TSA45        114271     34482783
TSA46        94903      69055916
TSA47        10363      5895735
TSA48        94696      35577587
TSA49        78213      36138263
TSA5         74536      22525878
TSA50        106962     43690670
TSA51        114967     46107338
TSA52        26890      19148939
TSA53        104334     51655152
TSA54        101776     54365987
TSA55        97582      60662772
TSA56        82228      86008299
TSA57        67802      29059764
TSA58        90828      71678131
TSA59        97915      54906712
TSA6         112164     59299839
TSA60        60403      105707789
TSA61        86807      66091831
TSA62        79380      70604487
TSA63        83881      71955670
TSA64        82692      73138164
TSA65        66480      87984245
TSA66        91172      67099618
TSA67        76182      84986777
TSA68        72161      72968018
TSA69        69193      61162967
TSA7         87942      58097196
TSA70        85674      78551372
TSA71        85110      79390602
TSA72        68164      94940592
TSA73        86359      70218089
TSA74        85532      52029253
TSA75        103092     68803181
TSA76        87069      60219812
TSA77        103531     57122474
TSA78        75996      72532642
TSA79        74667      42478724
TSA8         105281     73053535
TSA80        88020      79406904
TSA81        91816      69554168
TSA82        78643      53628715
TSA83        78975      56799054
TSA84        97227      61708495
TSA85        37388      33674257
TSA86        89459      77100280
TSA87        95713      55692877
TSA88        111286     45169055
TSA89        97261      59108231
TSA9         110108     61261039
TSA90        65736      96651952
TSA91        13245      13080610
TSA92        101868     55796774
TSA93        91582      53917306
TSA94        94202      43888098
TSA95        85593      75399941
TSA96        73247      71810899
TSA97        38585      45011146
TSA98        77356      80756171
TSA99        77829      55237291
UNA1         323        208576
VRL1         65900      72157044
VRL10        43874      73776665
VRL11        42989      73676318
VRL12        62912      74205382
VRL13        70685      66649437
VRL14        62004      74323525
VRL15        25781      35735314
VRL16        63258      72352860
VRL17        58745      73095332
VRL18        64071      65689877
VRL19        57723      74244470
VRL2         67718      67371624
VRL20        49011      61712133
VRL21        55437      73606369
VRL22        59314      72313905
VRL23        56529      74682996
VRL24        57036      73708389
VRL25        24610      42745055
VRL26        52846      76224761
VRL27        38606      83192308
VRL28        48780      75733981
VRL29        49296      74904787
VRL3         71671      63907313
VRL30        47980      79733710
VRL31        10906      17936958
VRL32        50157      79060966
VRL33        43164      87852683
VRL34        42056      84295330
VRL35        49062      80591425
VRL36        37687      88675039
VRL37        13576      27933222
VRL38        36923      91016020
VRL39        46509      83302185
VRL4         67954      68201696
VRL40        47519      77464876
VRL41        45378      85896643
VRL42        43916      83685818
VRL43        9918       16362149
VRL44        42942      82793235
VRL45        37836      89979851
VRL46        43483      79666181
VRL47        28455      97910765
VRL48        48219      86432259
VRL49        55183      82887802
VRL5         69994      69190273
VRL50        3154       1487730
VRL6         14817      20741782
VRL7         48737      77996724
VRL8         47021      72860703
VRL9         44228      72177451
VRT1         68543      78989483
VRT10        18698      27611399
VRT11        4665       186998276
VRT12        1320       193372782
VRT13        1392       193166295
VRT14        1972       24043127
VRT15        6178       183306713
VRT16        6          194932281
VRT17        6          188047704
VRT18        6          178272280
VRT19        6          182099228
VRT2         1260       194106767
VRT20        6          190882518
VRT21        6          186613478
VRT22        6          174251486
VRT23        6          171948183
VRT24        6          177736655
VRT25        6          171348580
VRT26        7          183326153
VRT27        3104       119066739
VRT28        13371      172470823
VRT29        5827       185181355
VRT3         49093      120735994
VRT30        3801       188841871
VRT31        50373      115912114
VRT32        80369      70110754
VRT33        78374      67292266
VRT34        17062      12655872
VRT35        71643      78576841
VRT36        46290      121998201
VRT37        78079      64133747
VRT38        80346      62687517
VRT39        82626      58573765
VRT4         23747      151099269
VRT40        31164      21778108
VRT41        103619     66611542
VRT42        82283      57043627
VRT43        86487      59167667
VRT44        60069      44943784
VRT45        91660      54471956
VRT46        76828      58883874
VRT47        7189       6090843
VRT48        75700      59238208
VRT49        55412      44503466
VRT5         39332      101293929
VRT50        81792      57622640
VRT51        76268      59982748
VRT52        78979      60873358
VRT53        55181      21217983
VRT54        110451     53380879
VRT55        77709      66868110
VRT56        95040      53453515
VRT57        2160       1363540
VRT58        87009      52020034
VRT59        82054      62707819
VRT6         73212      67162400
VRT60        36073      122368599
VRT61        42         184527474
VRT62        102        182751359
VRT63        130        193761317
VRT64        296        192673693
VRT65        591        194013929
VRT66        1884       192119838
VRT67        34145      162025537
VRT68        58561      17275932
VRT69        178678     28868627
VRT7         1579       3355394
VRT70        52344      90005269
VRT71        3242       189215331
VRT72        9          178794778
VRT73        10         196480447
VRT74        11         184541365
VRT75        28         196498040
VRT76        389        196385145
VRT77        1316       195772248
VRT78        2570       194675382
VRT79        3375       193874588
VRT8         32099      64276408
VRT80        27410      83395976
VRT9         5297       9768582

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 221.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

24878365 19065856381   Homo sapiens
9885932  10233714809   Mus musculus
2198056   6529312672   Rattus norvegicus
2229560   5429768145   Bos taurus
4198616   5228306576   Zea mays
3299657   5072476333   Sus scrofa
1346802   3235943623   Hordeum vulgare subsp. vulgare
1729079   3191032985   Danio rerio
1239025   2836475665   Oryzias latipes
72        2590574434   Ovis canadensis canadensis
1813419   1944658425   Triticum aestivum
205405    1836551064   Cyprinus carpio
119912    1803951183   Escherichia coli
746023    1746806294   Solanum lycopersicum
1378383   1642593575   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
258058    1436165842   Strongylocentrotus purpuratus
463627    1337270420   Macaca mulatta
490332    1264448364   Spirometra erinaceieuropaei
1588069   1250011608   Xenopus tropicalis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          August 15 2017

                NCBI-GenBank Flat File Release 221.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the EMBL Nucleotide Sequence Data Library,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by
GenBank, the EMBL Nucleotide Sequence Data Library, and the DNA Data
Bank of Japan. This format is in use by all three databases. The
most complete and accurate Feature Table documentation can be found
on the Web at:

	http://www.insdc.org/documents/feature-table

  Any discrepancy between the abbreviated feature table description
of these release notes and the complete documentation on the Web
should be resolved in favor of the version at the above URL.

  The Feature Table specification is also available as a printed
document: `The DDBJ/EMBL/GenBank Feature Table: Definition'. Contact
GenBank at the address shown on the first page of these Release Notes
if you would like a copy.

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is shown below.

  Remember, the most definitive documentation for the feature table can
be found at:

	http://www.insdc.org/documents/feature-table

allele		Obsolete; see variation feature key
attenuator	Sequence related to transcription termination
C_region	Span of the C immunological feature
CAAT_signal	`CAAT box' in eukaryotic promoters
CDS		Sequence coding for amino acids in protein (includes
		stop codon)
conflict	Independent sequence determinations differ
D-loop      	Displacement loop
D_segment	Span of the D immunological feature
enhancer	Cis-acting enhancer of promoter function
exon		Region that codes for part of spliced mRNA
gene            Region that defines a functional gene, possibly
                including upstream (promotor, enhancer, etc)
		and downstream control elements, and for which
		a name has been assigned.
GC_signal	`GC box' in eukaryotic promoters
iDNA		Intervening DNA eliminated by recombination
intron		Transcribed region excised by mRNA splicing
J_region	Span of the J immunological feature
LTR		Long terminal repeat
mat_peptide	Mature peptide coding region (does not include stop codon)
misc_binding	Miscellaneous binding site
misc_difference	Miscellaneous difference feature
misc_feature	Region of biological significance that cannot be described
		by any other feature
misc_recomb	Miscellaneous recombination feature
misc_RNA	Miscellaneous transcript feature not defined by other RNA keys
misc_signal	Miscellaneous signal
misc_structure	Miscellaneous DNA or RNA structure
modified_base	The indicated base is a modified nucleotide
mRNA		Messenger RNA
mutation 	Obsolete: see variation feature key
N_region	Span of the N immunological feature
old_sequence	Presented sequence revises a previous version
polyA_signal	Signal for cleavage & polyadenylation
polyA_site	Site at which polyadenine is added to mRNA
precursor_RNA	Any RNA species that is not yet the mature RNA product
prim_transcript	Primary (unprocessed) transcript
primer		Primer binding region used with PCR
primer_bind	Non-covalent primer binding site
promoter	A region involved in transcription initiation
protein_bind	Non-covalent protein binding site on DNA or RNA
RBS		Ribosome binding site
rep_origin	Replication origin for duplex DNA
repeat_region	Sequence containing repeated subsequences
repeat_unit	One repeated unit of a repeat_region
rRNA		Ribosomal RNA
S_region	Span of the S immunological feature
satellite	Satellite repeated sequence
scRNA		Small cytoplasmic RNA
sig_peptide	Signal peptide coding region
snRNA		Small nuclear RNA
source		Biological source of the sequence data represented by
		a GenBank record. Mandatory feature, one or more per record.
		For organisms that have been incorporated within the
		NCBI taxonomy database, an associated /db_xref="taxon:NNNN"
		qualifier will be present (where NNNNN is the numeric
		identifier assigned to the organism within the NCBI taxonomy
		database).
stem_loop	Hair-pin loop structure in DNA or RNA
STS		Sequence Tagged Site; operationally unique sequence that
		identifies the combination of primer spans used in a PCR assay
TATA_signal	`TATA box' in eukaryotic promoters
terminator	Sequence causing transcription termination
transit_peptide	Transit peptide coding region
transposon	Transposable element (TN)
tRNA 		Transfer RNA
unsure		Authors are unsure about the sequence in this region
V_region	Span of the V immunological feature
variation 	A related population contains stable mutation
- (hyphen)	Placeholder
-10_signal	`Pribnow box' in prokaryotic promoters
-35_signal	`-35 box' in prokaryotic promoters
3'clip		3'-most region of a precursor transcript removed in processing
3'UTR		3' untranslated region (trailer)
5'clip		5'-most region of a precursor transcript removed in processing
5'UTR		5' untranslated region (leader)


3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

The following is a partial list of feature qualifiers.

/anticodon	Location of the anticodon of tRNA and the amino acid
		for which it codes

/bound_moiety	Moiety bound

/citation	Reference to a citation providing the claim of or
		evidence for a feature

/codon		Specifies a codon that is different from any found in the
		reference genetic code

/codon_start	Indicates the first base of the first complete codon
		in a CDS (as 1 or 2 or 3)

/cons_splice	Identifies intron splice sites that do not conform to
		the 5'-GT... AG-3' splice site consensus

/db_xref	A database cross-reference; pointer to related information
		in another database. A description of all cross-references
		can be found at:

		http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/collab/db_xref.html

/direction	Direction of DNA replication

/EC_number	Enzyme Commission number for the enzyme product of the
		sequence

/evidence	Value indicating the nature of supporting evidence

/frequency	Frequency of the occurrence of a feature

/function	Function attributed to a sequence

/gene		Symbol of the gene corresponding to a sequence region (usable
		with all features)

/label		A label used to permanently identify a feature

/map		Map position of the feature in free-format text

/mod_base	Abbreviation for a modified nucleotide base

/note		Any comment or additional information

/number		A number indicating the order of genetic elements
		(e.g., exons or introns) in the 5 to 3 direction

/organism	Name of the organism that is the source of the
		sequence data in the record. 

/partial	Differentiates between complete regions and partial ones

/phenotype	Phenotype conferred by the feature

/product	Name of a product encoded by a coding region (CDS)
		feature

/pseudo		Indicates that this feature is a non-functional
		version of the element named by the feature key

/rpt_family	Type of repeated sequence; Alu or Kpn, for example

/rpt_type	Organization of repeated sequence

/rpt_unit	Identity of repeat unit that constitutes a repeat_region

/standard_name	Accepted standard name for this feature

/transl_except	Translational exception: single codon, the translation
		of which does not conform to the reference genetic code

/translation	Amino acid translation of a coding region

/type		Name of a strain if different from that in the SOURCE field

/usedin		Indicates that feature is used in a compound feature
		in another entry

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS that spans more
than one entry.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       HUMPGAMM1    3688 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M)
            gene, 5' end.
ACCESSION   M55673 M25818 M27095
KEYWORDS    phosphoglycerate mutase.
SEGMENT     1 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     CAAT_signal     1751..1755
                     /gene="PGAM-M"
     TATA_signal     1791..1799
                     /gene="PGAM-M"
     exon            1820..2274
                     /number=1
                     /EC_number="5.4.2.1"
                     /gene="PGAM-M"
     intron          2275..2377
                     /number=1
                     /gene="PGAM2"
     exon            2378..2558
                     /number=2
                     /gene="PGAM-M"
  .
  .
  .
//
LOCUS       HUMPGAMM2     677 bp ds-DNA             PRI       15-OCT-1990
DEFINITION  Human phosphoglycerate mutase (muscle specific isozyme) (PGAM-M),
            exon 3.
ACCESSION   M55674 M25818 M27096
KEYWORDS    phosphoglycerate mutase.
SEGMENT     2 of 2
  .
  .
  .
FEATURES             Location/Qualifiers
     exon            255..457
                     /number=3
                     /gene="PGAM-M"
     intron          order(M55673:2559..>3688,<1..254)
                     /number=2
                     /gene="PGAM-M"
     mRNA            join(M55673:1820..2274,M55673:2378..2558,255..457)
                     /gene="PGAM-M"
     CDS             join(M55673:1861..2274,M55673:2378..2558,255..421)
                     /note="muscle-specific isozyme"
                     /gene="PGAM2"
                     /product="phosphoglycerate mutase"
                     /codon_start=1
                     /translation="MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKA
                     IKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAE
                     TAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTI
                     ARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVY
                     ELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK"
  .
  .
  .
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Joining Sequences


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.  You may call NCBI
at (301)496-2475, or subscribe to a developers' electronic newsgroup by
sending your name, address, affiliation, and e-mail address to:

              bits-request@ncbi.nlm.nih.gov

  The Software Developer's Toolkit and PostScript documentation for UNIX,
VMS, Ultrix, AIX, MacOS, DOS, and Microsoft Windows systems is available
in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov',
in the toolbox/ncbi_tools directory. The file is 'ncbi.tar.Z'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address:  info@ncbi.nlm.nih.gov  or by phone: 301-496-2475.

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Clark, K. et al, Nucleic Acids Res. 44(D1), D67-72 (2016)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

  A mirror of the GenBank FTP site at the NCBI is available at the
University of Indiana:

	ftp://bio-mirror.net/biomirror/genbank/

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Michael DiCuccio, Ilya Dondoshansky, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Michael Kornbluh, Jim Ostell, Vasuki Palanigobu,
	Denis Sinyakov, Karl Sirotkin, Vladimir Soussov, Elena Starchenko,
	Hanzhen Sun, Tatiana Tatusova, Kamen Todorov, Eugene Yaschenko,
	Sergey Zhdanov, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
  FAX: (301) 480-9241
Support Center