Release Notes For GenBank Release 224

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2018

               NCBI-GenBank Flat File Release 224.0

                    Distribution Release Notes

 207040555 loci, 253630708098 bases, from 207040555 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 224.0
1.2 Cutoff Date
1.3 Important Changes in Release 224.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 224.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 224.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 224.0, incorporates data processed by the INSDC databases
as of Tuesday February 13 2018 at approximately 1:33AM EST. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 224.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 36 with this release:

  - the BCT division is now composed of 450 files (+22)
  - the CON division is now composed of 362 files (-1)
  - the ENV division is now composed of 101 files (+1)
  - the INV division is now composed of 161 files (+2)
  - the PAT division is now composed of 323 files (+3)
  - the PLN division is now composed of 168 files (+2)
  - the VRL division is now composed of  53 files (+2)
  - the VRT division is now composed of  85 files (+5)
  
  The decrease in the number of CON division files is due to re-assembled
  WGS sequence projects that did not include the submission of new
  scaffolds/CON-records.

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 224.0. Consider gbgss175.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        February 15 2018

                NCBI-GenBank Flat File Release 224.0

                           GSS Sequences (Part 1)

   87375 loci,    64103840 bases, from    87375 reported sequences
   
  Here, the filename and part number in the header is "1", though the file
has been renamed as "175" based on the number of files dumped from the other
system. Files gbgss175.seq.gz through gbgss304.seq.gz are affected. We hope
to resolve this discrepancy at some point, but the priority is certainly
much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 New source feature qualifier : /submitter_seqid

  Data submitters typically have their own identifiers for genomic contigs and
scaffolds of Whole Genome Shotgun (WGS) sequencing projects, the RNA sequences
of Transcriptome Shotgun Assembly (TSA) sequencing projects, and the genomic
loci of Targeted Locus Study (TLS) sequencing projects. These identifiers can
be very simple (contig01, contig02, etc.), or they can have a bit more
meaning/structure. Examples of the latter include:

   gcontig_1106166512749 (ABDU01000001)
   CCB157_001            (BDDQ01000001)
   Lo7_v2_contig_2306    (CCJQ010001199)

  The INSDC has decided that it would be helpful to provide these identifiers
in a formalized way, since they may be known to, or used by, parties other than
the submitters themselves. For example, if a submitter had made them public
in some sort of data products, or displayed in genome browsers, cited in an
analysis, or mentioned on websites. 

  These submitter identifiers will be provided via a new qualifier of the
source feature : /submitter_seqid . The value format for the qualifier will
be free text. 

  A complete definition of the qualifier will be provided when it becomes
available. The earliest implementation date is within the two month period
after GenBank Release 224.0 on February 15th 2018. But a more realistic
timeframe is April 15th of 2018.

1.4.2 New /gap_type value : "contamination"

  When contamination is discovered in a sequence record, removing the
bases from the sequence data can be problematic (especially at the 5' end)
because the length of the sequence changes. If there exist higher-level
scaffold/CON-division records (possibly chromosomes), the resulting change
in length requires an adjustment to the coordinate system of the scaffold/
chromosome, and the features annotated on it. The impact of such a change
on both data submitters and users can impose quite a burden.

  To address this, the INSDC has decided to introduce a new Gap Type for
the assembly_gap feature : contamination . When sequence contamination
is discovered, the submitter will have the option of replacing the affected
base pairs with Ns, via a terminal assembly_gap feature. For example:

     assembly_gap    1..2956
                     /estimated_length=2956
                     /gap_type="contamination"
                     /note="contamination masked with Ns"

  An updated definition of the /gap_type qualifier will be provided when
it becomes available. The earliest implementation date is within the two
month period after GenBank Release 224.0 on February 15th 2018. But a
more realistic timeframe is April 15th of 2018.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 3061 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct46.seq - Bacterial sequence entries, part 46.
393. gbbct47.seq - Bacterial sequence entries, part 47.
394. gbbct48.seq - Bacterial sequence entries, part 48.
395. gbbct49.seq - Bacterial sequence entries, part 49.
396. gbbct5.seq - Bacterial sequence entries, part 5.
397. gbbct50.seq - Bacterial sequence entries, part 50.
398. gbbct51.seq - Bacterial sequence entries, part 51.
399. gbbct52.seq - Bacterial sequence entries, part 52.
400. gbbct53.seq - Bacterial sequence entries, part 53.
401. gbbct54.seq - Bacterial sequence entries, part 54.
402. gbbct55.seq - Bacterial sequence entries, part 55.
403. gbbct56.seq - Bacterial sequence entries, part 56.
404. gbbct57.seq - Bacterial sequence entries, part 57.
405. gbbct58.seq - Bacterial sequence entries, part 58.
406. gbbct59.seq - Bacterial sequence entries, part 59.
407. gbbct6.seq - Bacterial sequence entries, part 6.
408. gbbct60.seq - Bacterial sequence entries, part 60.
409. gbbct61.seq - Bacterial sequence entries, part 61.
410. gbbct62.seq - Bacterial sequence entries, part 62.
411. gbbct63.seq - Bacterial sequence entries, part 63.
412. gbbct64.seq - Bacterial sequence entries, part 64.
413. gbbct65.seq - Bacterial sequence entries, part 65.
414. gbbct66.seq - Bacterial sequence entries, part 66.
415. gbbct67.seq - Bacterial sequence entries, part 67.
416. gbbct68.seq - Bacterial sequence entries, part 68.
417. gbbct69.seq - Bacterial sequence entries, part 69.
418. gbbct7.seq - Bacterial sequence entries, part 7.
419. gbbct70.seq - Bacterial sequence entries, part 70.
420. gbbct71.seq - Bacterial sequence entries, part 71.
421. gbbct72.seq - Bacterial sequence entries, part 72.
422. gbbct73.seq - Bacterial sequence entries, part 73.
423. gbbct74.seq - Bacterial sequence entries, part 74.
424. gbbct75.seq - Bacterial sequence entries, part 75.
425. gbbct76.seq - Bacterial sequence entries, part 76.
426. gbbct77.seq - Bacterial sequence entries, part 77.
427. gbbct78.seq - Bacterial sequence entries, part 78.
428. gbbct79.seq - Bacterial sequence entries, part 79.
429. gbbct8.seq - Bacterial sequence entries, part 8.
430. gbbct80.seq - Bacterial sequence entries, part 80.
431. gbbct81.seq - Bacterial sequence entries, part 81.
432. gbbct82.seq - Bacterial sequence entries, part 82.
433. gbbct83.seq - Bacterial sequence entries, part 83.
434. gbbct84.seq - Bacterial sequence entries, part 84.
435. gbbct85.seq - Bacterial sequence entries, part 85.
436. gbbct86.seq - Bacterial sequence entries, part 86.
437. gbbct87.seq - Bacterial sequence entries, part 87.
438. gbbct88.seq - Bacterial sequence entries, part 88.
439. gbbct89.seq - Bacterial sequence entries, part 89.
440. gbbct9.seq - Bacterial sequence entries, part 9.
441. gbbct90.seq - Bacterial sequence entries, part 90.
442. gbbct91.seq - Bacterial sequence entries, part 91.
443. gbbct92.seq - Bacterial sequence entries, part 92.
444. gbbct93.seq - Bacterial sequence entries, part 93.
445. gbbct94.seq - Bacterial sequence entries, part 94.
446. gbbct95.seq - Bacterial sequence entries, part 95.
447. gbbct96.seq - Bacterial sequence entries, part 96.
448. gbbct97.seq - Bacterial sequence entries, part 97.
449. gbbct98.seq - Bacterial sequence entries, part 98.
450. gbbct99.seq - Bacterial sequence entries, part 99.
451. gbchg.txt - Accession numbers of entries updated since the previous release.
452. gbcon1.seq - Constructed sequence entries, part 1.
453. gbcon10.seq - Constructed sequence entries, part 10.
454. gbcon100.seq - Constructed sequence entries, part 100.
455. gbcon101.seq - Constructed sequence entries, part 101.
456. gbcon102.seq - Constructed sequence entries, part 102.
457. gbcon103.seq - Constructed sequence entries, part 103.
458. gbcon104.seq - Constructed sequence entries, part 104.
459. gbcon105.seq - Constructed sequence entries, part 105.
460. gbcon106.seq - Constructed sequence entries, part 106.
461. gbcon107.seq - Constructed sequence entries, part 107.
462. gbcon108.seq - Constructed sequence entries, part 108.
463. gbcon109.seq - Constructed sequence entries, part 109.
464. gbcon11.seq - Constructed sequence entries, part 11.
465. gbcon110.seq - Constructed sequence entries, part 110.
466. gbcon111.seq - Constructed sequence entries, part 111.
467. gbcon112.seq - Constructed sequence entries, part 112.
468. gbcon113.seq - Constructed sequence entries, part 113.
469. gbcon114.seq - Constructed sequence entries, part 114.
470. gbcon115.seq - Constructed sequence entries, part 115.
471. gbcon116.seq - Constructed sequence entries, part 116.
472. gbcon117.seq - Constructed sequence entries, part 117.
473. gbcon118.seq - Constructed sequence entries, part 118.
474. gbcon119.seq - Constructed sequence entries, part 119.
475. gbcon12.seq - Constructed sequence entries, part 12.
476. gbcon120.seq - Constructed sequence entries, part 120.
477. gbcon121.seq - Constructed sequence entries, part 121.
478. gbcon122.seq - Constructed sequence entries, part 122.
479. gbcon123.seq - Constructed sequence entries, part 123.
480. gbcon124.seq - Constructed sequence entries, part 124.
481. gbcon125.seq - Constructed sequence entries, part 125.
482. gbcon126.seq - Constructed sequence entries, part 126.
483. gbcon127.seq - Constructed sequence entries, part 127.
484. gbcon128.seq - Constructed sequence entries, part 128.
485. gbcon129.seq - Constructed sequence entries, part 129.
486. gbcon13.seq - Constructed sequence entries, part 13.
487. gbcon130.seq - Constructed sequence entries, part 130.
488. gbcon131.seq - Constructed sequence entries, part 131.
489. gbcon132.seq - Constructed sequence entries, part 132.
490. gbcon133.seq - Constructed sequence entries, part 133.
491. gbcon134.seq - Constructed sequence entries, part 134.
492. gbcon135.seq - Constructed sequence entries, part 135.
493. gbcon136.seq - Constructed sequence entries, part 136.
494. gbcon137.seq - Constructed sequence entries, part 137.
495. gbcon138.seq - Constructed sequence entries, part 138.
496. gbcon139.seq - Constructed sequence entries, part 139.
497. gbcon14.seq - Constructed sequence entries, part 14.
498. gbcon140.seq - Constructed sequence entries, part 140.
499. gbcon141.seq - Constructed sequence entries, part 141.
500. gbcon142.seq - Constructed sequence entries, part 142.
501. gbcon143.seq - Constructed sequence entries, part 143.
502. gbcon144.seq - Constructed sequence entries, part 144.
503. gbcon145.seq - Constructed sequence entries, part 145.
504. gbcon146.seq - Constructed sequence entries, part 146.
505. gbcon147.seq - Constructed sequence entries, part 147.
506. gbcon148.seq - Constructed sequence entries, part 148.
507. gbcon149.seq - Constructed sequence entries, part 149.
508. gbcon15.seq - Constructed sequence entries, part 15.
509. gbcon150.seq - Constructed sequence entries, part 150.
510. gbcon151.seq - Constructed sequence entries, part 151.
511. gbcon152.seq - Constructed sequence entries, part 152.
512. gbcon153.seq - Constructed sequence entries, part 153.
513. gbcon154.seq - Constructed sequence entries, part 154.
514. gbcon155.seq - Constructed sequence entries, part 155.
515. gbcon156.seq - Constructed sequence entries, part 156.
516. gbcon157.seq - Constructed sequence entries, part 157.
517. gbcon158.seq - Constructed sequence entries, part 158.
518. gbcon159.seq - Constructed sequence entries, part 159.
519. gbcon16.seq - Constructed sequence entries, part 16.
520. gbcon160.seq - Constructed sequence entries, part 160.
521. gbcon161.seq - Constructed sequence entries, part 161.
522. gbcon162.seq - Constructed sequence entries, part 162.
523. gbcon163.seq - Constructed sequence entries, part 163.
524. gbcon164.seq - Constructed sequence entries, part 164.
525. gbcon165.seq - Constructed sequence entries, part 165.
526. gbcon166.seq - Constructed sequence entries, part 166.
527. gbcon167.seq - Constructed sequence entries, part 167.
528. gbcon168.seq - Constructed sequence entries, part 168.
529. gbcon169.seq - Constructed sequence entries, part 169.
530. gbcon17.seq - Constructed sequence entries, part 17.
531. gbcon170.seq - Constructed sequence entries, part 170.
532. gbcon171.seq - Constructed sequence entries, part 171.
533. gbcon172.seq - Constructed sequence entries, part 172.
534. gbcon173.seq - Constructed sequence entries, part 173.
535. gbcon174.seq - Constructed sequence entries, part 174.
536. gbcon175.seq - Constructed sequence entries, part 175.
537. gbcon176.seq - Constructed sequence entries, part 176.
538. gbcon177.seq - Constructed sequence entries, part 177.
539. gbcon178.seq - Constructed sequence entries, part 178.
540. gbcon179.seq - Constructed sequence entries, part 179.
541. gbcon18.seq - Constructed sequence entries, part 18.
542. gbcon180.seq - Constructed sequence entries, part 180.
543. gbcon181.seq - Constructed sequence entries, part 181.
544. gbcon182.seq - Constructed sequence entries, part 182.
545. gbcon183.seq - Constructed sequence entries, part 183.
546. gbcon184.seq - Constructed sequence entries, part 184.
547. gbcon185.seq - Constructed sequence entries, part 185.
548. gbcon186.seq - Constructed sequence entries, part 186.
549. gbcon187.seq - Constructed sequence entries, part 187.
550. gbcon188.seq - Constructed sequence entries, part 188.
551. gbcon189.seq - Constructed sequence entries, part 189.
552. gbcon19.seq - Constructed sequence entries, part 19.
553. gbcon190.seq - Constructed sequence entries, part 190.
554. gbcon191.seq - Constructed sequence entries, part 191.
555. gbcon192.seq - Constructed sequence entries, part 192.
556. gbcon193.seq - Constructed sequence entries, part 193.
557. gbcon194.seq - Constructed sequence entries, part 194.
558. gbcon195.seq - Constructed sequence entries, part 195.
559. gbcon196.seq - Constructed sequence entries, part 196.
560. gbcon197.seq - Constructed sequence entries, part 197.
561. gbcon198.seq - Constructed sequence entries, part 198.
562. gbcon199.seq - Constructed sequence entries, part 199.
563. gbcon2.seq - Constructed sequence entries, part 2.
564. gbcon20.seq - Constructed sequence entries, part 20.
565. gbcon200.seq - Constructed sequence entries, part 200.
566. gbcon201.seq - Constructed sequence entries, part 201.
567. gbcon202.seq - Constructed sequence entries, part 202.
568. gbcon203.seq - Constructed sequence entries, part 203.
569. gbcon204.seq - Constructed sequence entries, part 204.
570. gbcon205.seq - Constructed sequence entries, part 205.
571. gbcon206.seq - Constructed sequence entries, part 206.
572. gbcon207.seq - Constructed sequence entries, part 207.
573. gbcon208.seq - Constructed sequence entries, part 208.
574. gbcon209.seq - Constructed sequence entries, part 209.
575. gbcon21.seq - Constructed sequence entries, part 21.
576. gbcon210.seq - Constructed sequence entries, part 210.
577. gbcon211.seq - Constructed sequence entries, part 211.
578. gbcon212.seq - Constructed sequence entries, part 212.
579. gbcon213.seq - Constructed sequence entries, part 213.
580. gbcon214.seq - Constructed sequence entries, part 214.
581. gbcon215.seq - Constructed sequence entries, part 215.
582. gbcon216.seq - Constructed sequence entries, part 216.
583. gbcon217.seq - Constructed sequence entries, part 217.
584. gbcon218.seq - Constructed sequence entries, part 218.
585. gbcon219.seq - Constructed sequence entries, part 219.
586. gbcon22.seq - Constructed sequence entries, part 22.
587. gbcon220.seq - Constructed sequence entries, part 220.
588. gbcon221.seq - Constructed sequence entries, part 221.
589. gbcon222.seq - Constructed sequence entries, part 222.
590. gbcon223.seq - Constructed sequence entries, part 223.
591. gbcon224.seq - Constructed sequence entries, part 224.
592. gbcon225.seq - Constructed sequence entries, part 225.
593. gbcon226.seq - Constructed sequence entries, part 226.
594. gbcon227.seq - Constructed sequence entries, part 227.
595. gbcon228.seq - Constructed sequence entries, part 228.
596. gbcon229.seq - Constructed sequence entries, part 229.
597. gbcon23.seq - Constructed sequence entries, part 23.
598. gbcon230.seq - Constructed sequence entries, part 230.
599. gbcon231.seq - Constructed sequence entries, part 231.
600. gbcon232.seq - Constructed sequence entries, part 232.
601. gbcon233.seq - Constructed sequence entries, part 233.
602. gbcon234.seq - Constructed sequence entries, part 234.
603. gbcon235.seq - Constructed sequence entries, part 235.
604. gbcon236.seq - Constructed sequence entries, part 236.
605. gbcon237.seq - Constructed sequence entries, part 237.
606. gbcon238.seq - Constructed sequence entries, part 238.
607. gbcon239.seq - Constructed sequence entries, part 239.
608. gbcon24.seq - Constructed sequence entries, part 24.
609. gbcon240.seq - Constructed sequence entries, part 240.
610. gbcon241.seq - Constructed sequence entries, part 241.
611. gbcon242.seq - Constructed sequence entries, part 242.
612. gbcon243.seq - Constructed sequence entries, part 243.
613. gbcon244.seq - Constructed sequence entries, part 244.
614. gbcon245.seq - Constructed sequence entries, part 245.
615. gbcon246.seq - Constructed sequence entries, part 246.
616. gbcon247.seq - Constructed sequence entries, part 247.
617. gbcon248.seq - Constructed sequence entries, part 248.
618. gbcon249.seq - Constructed sequence entries, part 249.
619. gbcon25.seq - Constructed sequence entries, part 25.
620. gbcon250.seq - Constructed sequence entries, part 250.
621. gbcon251.seq - Constructed sequence entries, part 251.
622. gbcon252.seq - Constructed sequence entries, part 252.
623. gbcon253.seq - Constructed sequence entries, part 253.
624. gbcon254.seq - Constructed sequence entries, part 254.
625. gbcon255.seq - Constructed sequence entries, part 255.
626. gbcon256.seq - Constructed sequence entries, part 256.
627. gbcon257.seq - Constructed sequence entries, part 257.
628. gbcon258.seq - Constructed sequence entries, part 258.
629. gbcon259.seq - Constructed sequence entries, part 259.
630. gbcon26.seq - Constructed sequence entries, part 26.
631. gbcon260.seq - Constructed sequence entries, part 260.
632. gbcon261.seq - Constructed sequence entries, part 261.
633. gbcon262.seq - Constructed sequence entries, part 262.
634. gbcon263.seq - Constructed sequence entries, part 263.
635. gbcon264.seq - Constructed sequence entries, part 264.
636. gbcon265.seq - Constructed sequence entries, part 265.
637. gbcon266.seq - Constructed sequence entries, part 266.
638. gbcon267.seq - Constructed sequence entries, part 267.
639. gbcon268.seq - Constructed sequence entries, part 268.
640. gbcon269.seq - Constructed sequence entries, part 269.
641. gbcon27.seq - Constructed sequence entries, part 27.
642. gbcon270.seq - Constructed sequence entries, part 270.
643. gbcon271.seq - Constructed sequence entries, part 271.
644. gbcon272.seq - Constructed sequence entries, part 272.
645. gbcon273.seq - Constructed sequence entries, part 273.
646. gbcon274.seq - Constructed sequence entries, part 274.
647. gbcon275.seq - Constructed sequence entries, part 275.
648. gbcon276.seq - Constructed sequence entries, part 276.
649. gbcon277.seq - Constructed sequence entries, part 277.
650. gbcon278.seq - Constructed sequence entries, part 278.
651. gbcon279.seq - Constructed sequence entries, part 279.
652. gbcon28.seq - Constructed sequence entries, part 28.
653. gbcon280.seq - Constructed sequence entries, part 280.
654. gbcon281.seq - Constructed sequence entries, part 281.
655. gbcon282.seq - Constructed sequence entries, part 282.
656. gbcon283.seq - Constructed sequence entries, part 283.
657. gbcon284.seq - Constructed sequence entries, part 284.
658. gbcon285.seq - Constructed sequence entries, part 285.
659. gbcon286.seq - Constructed sequence entries, part 286.
660. gbcon287.seq - Constructed sequence entries, part 287.
661. gbcon288.seq - Constructed sequence entries, part 288.
662. gbcon289.seq - Constructed sequence entries, part 289.
663. gbcon29.seq - Constructed sequence entries, part 29.
664. gbcon290.seq - Constructed sequence entries, part 290.
665. gbcon291.seq - Constructed sequence entries, part 291.
666. gbcon292.seq - Constructed sequence entries, part 292.
667. gbcon293.seq - Constructed sequence entries, part 293.
668. gbcon294.seq - Constructed sequence entries, part 294.
669. gbcon295.seq - Constructed sequence entries, part 295.
670. gbcon296.seq - Constructed sequence entries, part 296.
671. gbcon297.seq - Constructed sequence entries, part 297.
672. gbcon298.seq - Constructed sequence entries, part 298.
673. gbcon299.seq - Constructed sequence entries, part 299.
674. gbcon3.seq - Constructed sequence entries, part 3.
675. gbcon30.seq - Constructed sequence entries, part 30.
676. gbcon300.seq - Constructed sequence entries, part 300.
677. gbcon301.seq - Constructed sequence entries, part 301.
678. gbcon302.seq - Constructed sequence entries, part 302.
679. gbcon303.seq - Constructed sequence entries, part 303.
680. gbcon304.seq - Constructed sequence entries, part 304.
681. gbcon305.seq - Constructed sequence entries, part 305.
682. gbcon306.seq - Constructed sequence entries, part 306.
683. gbcon307.seq - Constructed sequence entries, part 307.
684. gbcon308.seq - Constructed sequence entries, part 308.
685. gbcon309.seq - Constructed sequence entries, part 309.
686. gbcon31.seq - Constructed sequence entries, part 31.
687. gbcon310.seq - Constructed sequence entries, part 310.
688. gbcon311.seq - Constructed sequence entries, part 311.
689. gbcon312.seq - Constructed sequence entries, part 312.
690. gbcon313.seq - Constructed sequence entries, part 313.
691. gbcon314.seq - Constructed sequence entries, part 314.
692. gbcon315.seq - Constructed sequence entries, part 315.
693. gbcon316.seq - Constructed sequence entries, part 316.
694. gbcon317.seq - Constructed sequence entries, part 317.
695. gbcon318.seq - Constructed sequence entries, part 318.
696. gbcon319.seq - Constructed sequence entries, part 319.
697. gbcon32.seq - Constructed sequence entries, part 32.
698. gbcon320.seq - Constructed sequence entries, part 320.
699. gbcon321.seq - Constructed sequence entries, part 321.
700. gbcon322.seq - Constructed sequence entries, part 322.
701. gbcon323.seq - Constructed sequence entries, part 323.
702. gbcon324.seq - Constructed sequence entries, part 324.
703. gbcon325.seq - Constructed sequence entries, part 325.
704. gbcon326.seq - Constructed sequence entries, part 326.
705. gbcon327.seq - Constructed sequence entries, part 327.
706. gbcon328.seq - Constructed sequence entries, part 328.
707. gbcon329.seq - Constructed sequence entries, part 329.
708. gbcon33.seq - Constructed sequence entries, part 33.
709. gbcon330.seq - Constructed sequence entries, part 330.
710. gbcon331.seq - Constructed sequence entries, part 331.
711. gbcon332.seq - Constructed sequence entries, part 332.
712. gbcon333.seq - Constructed sequence entries, part 333.
713. gbcon334.seq - Constructed sequence entries, part 334.
714. gbcon335.seq - Constructed sequence entries, part 335.
715. gbcon336.seq - Constructed sequence entries, part 336.
716. gbcon337.seq - Constructed sequence entries, part 337.
717. gbcon338.seq - Constructed sequence entries, part 338.
718. gbcon339.seq - Constructed sequence entries, part 339.
719. gbcon34.seq - Constructed sequence entries, part 34.
720. gbcon340.seq - Constructed sequence entries, part 340.
721. gbcon341.seq - Constructed sequence entries, part 341.
722. gbcon342.seq - Constructed sequence entries, part 342.
723. gbcon343.seq - Constructed sequence entries, part 343.
724. gbcon344.seq - Constructed sequence entries, part 344.
725. gbcon345.seq - Constructed sequence entries, part 345.
726. gbcon346.seq - Constructed sequence entries, part 346.
727. gbcon347.seq - Constructed sequence entries, part 347.
728. gbcon348.seq - Constructed sequence entries, part 348.
729. gbcon349.seq - Constructed sequence entries, part 349.
730. gbcon35.seq - Constructed sequence entries, part 35.
731. gbcon350.seq - Constructed sequence entries, part 350.
732. gbcon351.seq - Constructed sequence entries, part 351.
733. gbcon352.seq - Constructed sequence entries, part 352.
734. gbcon353.seq - Constructed sequence entries, part 353.
735. gbcon354.seq - Constructed sequence entries, part 354.
736. gbcon355.seq - Constructed sequence entries, part 355.
737. gbcon356.seq - Constructed sequence entries, part 356.
738. gbcon357.seq - Constructed sequence entries, part 357.
739. gbcon358.seq - Constructed sequence entries, part 358.
740. gbcon359.seq - Constructed sequence entries, part 359.
741. gbcon36.seq - Constructed sequence entries, part 36.
742. gbcon360.seq - Constructed sequence entries, part 360.
743. gbcon361.seq - Constructed sequence entries, part 361.
744. gbcon362.seq - Constructed sequence entries, part 362.
745. gbcon37.seq - Constructed sequence entries, part 37.
746. gbcon38.seq - Constructed sequence entries, part 38.
747. gbcon39.seq - Constructed sequence entries, part 39.
748. gbcon4.seq - Constructed sequence entries, part 4.
749. gbcon40.seq - Constructed sequence entries, part 40.
750. gbcon41.seq - Constructed sequence entries, part 41.
751. gbcon42.seq - Constructed sequence entries, part 42.
752. gbcon43.seq - Constructed sequence entries, part 43.
753. gbcon44.seq - Constructed sequence entries, part 44.
754. gbcon45.seq - Constructed sequence entries, part 45.
755. gbcon46.seq - Constructed sequence entries, part 46.
756. gbcon47.seq - Constructed sequence entries, part 47.
757. gbcon48.seq - Constructed sequence entries, part 48.
758. gbcon49.seq - Constructed sequence entries, part 49.
759. gbcon5.seq - Constructed sequence entries, part 5.
760. gbcon50.seq - Constructed sequence entries, part 50.
761. gbcon51.seq - Constructed sequence entries, part 51.
762. gbcon52.seq - Constructed sequence entries, part 52.
763. gbcon53.seq - Constructed sequence entries, part 53.
764. gbcon54.seq - Constructed sequence entries, part 54.
765. gbcon55.seq - Constructed sequence entries, part 55.
766. gbcon56.seq - Constructed sequence entries, part 56.
767. gbcon57.seq - Constructed sequence entries, part 57.
768. gbcon58.seq - Constructed sequence entries, part 58.
769. gbcon59.seq - Constructed sequence entries, part 59.
770. gbcon6.seq - Constructed sequence entries, part 6.
771. gbcon60.seq - Constructed sequence entries, part 60.
772. gbcon61.seq - Constructed sequence entries, part 61.
773. gbcon62.seq - Constructed sequence entries, part 62.
774. gbcon63.seq - Constructed sequence entries, part 63.
775. gbcon64.seq - Constructed sequence entries, part 64.
776. gbcon65.seq - Constructed sequence entries, part 65.
777. gbcon66.seq - Constructed sequence entries, part 66.
778. gbcon67.seq - Constructed sequence entries, part 67.
779. gbcon68.seq - Constructed sequence entries, part 68.
780. gbcon69.seq - Constructed sequence entries, part 69.
781. gbcon7.seq - Constructed sequence entries, part 7.
782. gbcon70.seq - Constructed sequence entries, part 70.
783. gbcon71.seq - Constructed sequence entries, part 71.
784. gbcon72.seq - Constructed sequence entries, part 72.
785. gbcon73.seq - Constructed sequence entries, part 73.
786. gbcon74.seq - Constructed sequence entries, part 74.
787. gbcon75.seq - Constructed sequence entries, part 75.
788. gbcon76.seq - Constructed sequence entries, part 76.
789. gbcon77.seq - Constructed sequence entries, part 77.
790. gbcon78.seq - Constructed sequence entries, part 78.
791. gbcon79.seq - Constructed sequence entries, part 79.
792. gbcon8.seq - Constructed sequence entries, part 8.
793. gbcon80.seq - Constructed sequence entries, part 80.
794. gbcon81.seq - Constructed sequence entries, part 81.
795. gbcon82.seq - Constructed sequence entries, part 82.
796. gbcon83.seq - Constructed sequence entries, part 83.
797. gbcon84.seq - Constructed sequence entries, part 84.
798. gbcon85.seq - Constructed sequence entries, part 85.
799. gbcon86.seq - Constructed sequence entries, part 86.
800. gbcon87.seq - Constructed sequence entries, part 87.
801. gbcon88.seq - Constructed sequence entries, part 88.
802. gbcon89.seq - Constructed sequence entries, part 89.
803. gbcon9.seq - Constructed sequence entries, part 9.
804. gbcon90.seq - Constructed sequence entries, part 90.
805. gbcon91.seq - Constructed sequence entries, part 91.
806. gbcon92.seq - Constructed sequence entries, part 92.
807. gbcon93.seq - Constructed sequence entries, part 93.
808. gbcon94.seq - Constructed sequence entries, part 94.
809. gbcon95.seq - Constructed sequence entries, part 95.
810. gbcon96.seq - Constructed sequence entries, part 96.
811. gbcon97.seq - Constructed sequence entries, part 97.
812. gbcon98.seq - Constructed sequence entries, part 98.
813. gbcon99.seq - Constructed sequence entries, part 99.
814. gbdel.txt - Accession numbers of entries deleted since the previous release.
815. gbenv1.seq - Environmental sampling sequence entries, part 1.
816. gbenv10.seq - Environmental sampling sequence entries, part 10.
817. gbenv100.seq - Environmental sampling sequence entries, part 100.
818. gbenv101.seq - Environmental sampling sequence entries, part 101.
819. gbenv11.seq - Environmental sampling sequence entries, part 11.
820. gbenv12.seq - Environmental sampling sequence entries, part 12.
821. gbenv13.seq - Environmental sampling sequence entries, part 13.
822. gbenv14.seq - Environmental sampling sequence entries, part 14.
823. gbenv15.seq - Environmental sampling sequence entries, part 15.
824. gbenv16.seq - Environmental sampling sequence entries, part 16.
825. gbenv17.seq - Environmental sampling sequence entries, part 17.
826. gbenv18.seq - Environmental sampling sequence entries, part 18.
827. gbenv19.seq - Environmental sampling sequence entries, part 19.
828. gbenv2.seq - Environmental sampling sequence entries, part 2.
829. gbenv20.seq - Environmental sampling sequence entries, part 20.
830. gbenv21.seq - Environmental sampling sequence entries, part 21.
831. gbenv22.seq - Environmental sampling sequence entries, part 22.
832. gbenv23.seq - Environmental sampling sequence entries, part 23.
833. gbenv24.seq - Environmental sampling sequence entries, part 24.
834. gbenv25.seq - Environmental sampling sequence entries, part 25.
835. gbenv26.seq - Environmental sampling sequence entries, part 26.
836. gbenv27.seq - Environmental sampling sequence entries, part 27.
837. gbenv28.seq - Environmental sampling sequence entries, part 28.
838. gbenv29.seq - Environmental sampling sequence entries, part 29.
839. gbenv3.seq - Environmental sampling sequence entries, part 3.
840. gbenv30.seq - Environmental sampling sequence entries, part 30.
841. gbenv31.seq - Environmental sampling sequence entries, part 31.
842. gbenv32.seq - Environmental sampling sequence entries, part 32.
843. gbenv33.seq - Environmental sampling sequence entries, part 33.
844. gbenv34.seq - Environmental sampling sequence entries, part 34.
845. gbenv35.seq - Environmental sampling sequence entries, part 35.
846. gbenv36.seq - Environmental sampling sequence entries, part 36.
847. gbenv37.seq - Environmental sampling sequence entries, part 37.
848. gbenv38.seq - Environmental sampling sequence entries, part 38.
849. gbenv39.seq - Environmental sampling sequence entries, part 39.
850. gbenv4.seq - Environmental sampling sequence entries, part 4.
851. gbenv40.seq - Environmental sampling sequence entries, part 40.
852. gbenv41.seq - Environmental sampling sequence entries, part 41.
853. gbenv42.seq - Environmental sampling sequence entries, part 42.
854. gbenv43.seq - Environmental sampling sequence entries, part 43.
855. gbenv44.seq - Environmental sampling sequence entries, part 44.
856. gbenv45.seq - Environmental sampling sequence entries, part 45.
857. gbenv46.seq - Environmental sampling sequence entries, part 46.
858. gbenv47.seq - Environmental sampling sequence entries, part 47.
859. gbenv48.seq - Environmental sampling sequence entries, part 48.
860. gbenv49.seq - Environmental sampling sequence entries, part 49.
861. gbenv5.seq - Environmental sampling sequence entries, part 5.
862. gbenv50.seq - Environmental sampling sequence entries, part 50.
863. gbenv51.seq - Environmental sampling sequence entries, part 51.
864. gbenv52.seq - Environmental sampling sequence entries, part 52.
865. gbenv53.seq - Environmental sampling sequence entries, part 53.
866. gbenv54.seq - Environmental sampling sequence entries, part 54.
867. gbenv55.seq - Environmental sampling sequence entries, part 55.
868. gbenv56.seq - Environmental sampling sequence entries, part 56.
869. gbenv57.seq - Environmental sampling sequence entries, part 57.
870. gbenv58.seq - Environmental sampling sequence entries, part 58.
871. gbenv59.seq - Environmental sampling sequence entries, part 59.
872. gbenv6.seq - Environmental sampling sequence entries, part 6.
873. gbenv60.seq - Environmental sampling sequence entries, part 60.
874. gbenv61.seq - Environmental sampling sequence entries, part 61.
875. gbenv62.seq - Environmental sampling sequence entries, part 62.
876. gbenv63.seq - Environmental sampling sequence entries, part 63.
877. gbenv64.seq - Environmental sampling sequence entries, part 64.
878. gbenv65.seq - Environmental sampling sequence entries, part 65.
879. gbenv66.seq - Environmental sampling sequence entries, part 66.
880. gbenv67.seq - Environmental sampling sequence entries, part 67.
881. gbenv68.seq - Environmental sampling sequence entries, part 68.
882. gbenv69.seq - Environmental sampling sequence entries, part 69.
883. gbenv7.seq - Environmental sampling sequence entries, part 7.
884. gbenv70.seq - Environmental sampling sequence entries, part 70.
885. gbenv71.seq - Environmental sampling sequence entries, part 71.
886. gbenv72.seq - Environmental sampling sequence entries, part 72.
887. gbenv73.seq - Environmental sampling sequence entries, part 73.
888. gbenv74.seq - Environmental sampling sequence entries, part 74.
889. gbenv75.seq - Environmental sampling sequence entries, part 75.
890. gbenv76.seq - Environmental sampling sequence entries, part 76.
891. gbenv77.seq - Environmental sampling sequence entries, part 77.
892. gbenv78.seq - Environmental sampling sequence entries, part 78.
893. gbenv79.seq - Environmental sampling sequence entries, part 79.
894. gbenv8.seq - Environmental sampling sequence entries, part 8.
895. gbenv80.seq - Environmental sampling sequence entries, part 80.
896. gbenv81.seq - Environmental sampling sequence entries, part 81.
897. gbenv82.seq - Environmental sampling sequence entries, part 82.
898. gbenv83.seq - Environmental sampling sequence entries, part 83.
899. gbenv84.seq - Environmental sampling sequence entries, part 84.
900. gbenv85.seq - Environmental sampling sequence entries, part 85.
901. gbenv86.seq - Environmental sampling sequence entries, part 86.
902. gbenv87.seq - Environmental sampling sequence entries, part 87.
903. gbenv88.seq - Environmental sampling sequence entries, part 88.
904. gbenv89.seq - Environmental sampling sequence entries, part 89.
905. gbenv9.seq - Environmental sampling sequence entries, part 9.
906. gbenv90.seq - Environmental sampling sequence entries, part 90.
907. gbenv91.seq - Environmental sampling sequence entries, part 91.
908. gbenv92.seq - Environmental sampling sequence entries, part 92.
909. gbenv93.seq - Environmental sampling sequence entries, part 93.
910. gbenv94.seq - Environmental sampling sequence entries, part 94.
911. gbenv95.seq - Environmental sampling sequence entries, part 95.
912. gbenv96.seq - Environmental sampling sequence entries, part 96.
913. gbenv97.seq - Environmental sampling sequence entries, part 97.
914. gbenv98.seq - Environmental sampling sequence entries, part 98.
915. gbenv99.seq - Environmental sampling sequence entries, part 99.
916. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
917. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
918. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
919. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
920. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
921. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
922. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
923. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
924. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
925. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
926. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
927. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
928. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
929. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
930. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
931. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
932. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
933. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
934. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
935. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
936. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
937. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
938. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
939. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
940. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
941. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
942. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
943. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
944. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
945. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
946. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
947. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
948. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
949. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
950. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
951. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
952. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
953. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
954. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
955. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
956. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
957. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
958. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
959. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
960. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
961. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
962. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
963. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
964. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
965. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
966. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
967. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
968. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
969. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
970. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
971. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
972. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
973. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
974. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
975. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
976. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
977. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
978. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
979. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
980. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
981. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
982. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
983. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
984. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
985. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
986. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
987. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
988. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
989. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
990. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
991. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
992. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
993. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
994. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
995. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
996. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
997. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
998. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
999. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1000. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1001. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1002. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1003. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1004. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1005. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1006. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1007. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1008. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1009. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1010. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1011. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1012. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1013. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1014. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1015. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1016. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1017. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1018. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1019. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1020. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1021. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1022. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1023. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1024. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1025. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1026. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1027. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1028. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1029. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1030. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1031. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1032. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1033. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1034. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1035. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1036. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1037. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1038. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1039. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1040. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1041. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1042. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1043. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1044. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1045. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1046. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1047. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1048. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1049. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1050. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1051. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1052. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1053. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1054. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1055. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1056. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1057. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1058. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1059. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1060. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1061. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1062. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1063. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1064. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1065. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1066. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1067. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1068. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1069. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1070. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1071. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1072. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1073. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1074. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1075. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1076. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1077. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1078. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1079. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1080. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1081. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1082. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1083. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1084. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1085. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1086. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1087. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1088. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1089. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1090. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1091. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1092. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1093. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1094. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1095. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1096. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1097. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1098. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1099. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1100. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1101. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1102. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1103. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1104. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1105. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1106. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1107. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1108. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1109. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1110. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1111. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1112. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1113. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1114. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1115. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1116. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1117. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1118. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1119. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1120. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1121. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1122. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1123. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1124. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1125. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1126. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1127. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1128. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1129. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1130. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1131. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1132. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1133. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1134. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1135. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1136. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1137. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1138. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1139. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1140. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1141. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1142. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1143. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1144. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1145. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1146. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1147. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1148. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1149. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1150. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1151. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1152. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1153. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1154. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1155. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1156. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1157. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1158. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1159. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1160. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1161. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1162. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1163. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1164. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1165. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1166. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1167. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1168. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1169. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1170. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1171. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1172. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1173. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1174. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1175. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1176. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1177. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1178. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1179. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1180. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1181. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1182. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1183. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1184. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1185. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1186. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1187. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1188. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1189. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1190. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1191. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1192. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1193. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1194. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1195. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1196. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1197. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1198. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1199. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1200. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1201. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1202. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1203. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1204. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1205. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1206. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1207. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1208. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1209. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1210. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1211. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1212. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1213. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1214. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1215. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1216. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1217. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1218. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1219. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1220. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1221. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1222. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1223. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1224. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1225. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1226. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1227. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1228. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1229. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1230. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1231. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1232. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1233. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1234. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1235. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1236. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1237. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1238. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1239. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1240. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1241. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1242. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1243. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1244. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1245. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1246. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1247. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1248. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1249. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1250. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1251. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1252. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1253. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1254. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1255. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1256. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1257. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1258. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1259. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1260. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1261. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1262. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1263. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1264. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1265. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1266. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1267. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1268. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1269. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1270. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1271. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1272. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1273. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1274. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1275. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1276. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1277. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1278. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1279. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1280. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1281. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1282. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1283. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1284. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1285. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1286. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1287. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1288. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1289. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1290. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1291. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1292. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1293. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1294. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1295. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1296. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1297. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1298. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1299. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1300. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1301. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1302. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1303. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1304. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1305. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1306. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1307. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1308. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1309. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1310. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1311. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1312. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1313. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1314. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1315. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1316. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1317. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1318. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1319. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1320. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1321. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1322. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1323. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1324. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1325. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1326. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1327. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1328. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1329. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1330. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1331. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1332. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1333. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1334. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1335. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1336. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1337. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1338. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1339. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1340. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1341. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1342. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1343. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1344. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1345. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1346. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1347. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1348. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1349. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1350. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1351. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1352. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1353. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1354. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1355. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1356. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1357. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1358. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1359. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1360. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1361. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1362. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1363. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1364. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1365. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1366. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1367. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1368. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1369. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1370. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1371. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1372. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1373. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1374. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1375. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1376. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1377. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1378. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1379. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1380. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1381. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1382. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1383. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1384. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1385. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1386. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1387. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1388. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1389. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1390. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1391. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1392. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1393. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1394. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1395. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1396. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1397. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1398. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1399. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1400. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1401. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1402. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1403. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1404. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1405. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1406. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1407. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1408. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1409. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1410. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1411. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1412. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1413. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1414. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1415. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1416. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1417. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1418. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1419. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1420. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1421. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1422. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1423. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1424. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1425. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1426. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1427. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1428. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1429. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1430. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1431. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1432. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1433. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1434. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1435. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1436. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1437. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1438. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1439. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1440. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1441. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1442. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1443. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1444. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1445. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1446. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1447. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1448. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1449. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1450. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1451. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1452. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1453. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1454. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1455. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1456. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1457. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1458. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1459. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1460. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1461. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1462. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1463. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1464. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1465. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1466. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1467. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1468. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1469. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1470. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1471. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1472. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1473. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1474. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1475. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1476. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1477. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1478. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1479. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1480. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1481. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1482. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1483. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1484. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1485. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1486. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1487. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1488. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1489. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1490. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1491. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1492. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1493. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1494. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1495. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1496. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1497. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1498. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1499. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1500. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1501. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1502. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1503. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1504. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1505. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1506. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1507. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1508. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1509. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1510. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1511. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1512. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1513. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1514. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1515. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1516. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1517. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1518. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1519. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1520. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1521. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1522. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1523. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1524. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1525. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1526. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1527. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1528. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1529. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1530. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1531. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1532. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1533. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1534. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1535. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1536. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1537. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1538. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1539. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1540. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1541. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1542. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1543. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1544. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1545. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1546. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1547. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1548. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1549. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1550. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1551. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1552. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1553. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1554. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1555. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1556. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1557. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1558. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1559. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1560. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1561. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1562. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1563. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1564. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1565. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1566. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1567. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1568. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1569. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1570. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1571. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1572. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1573. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1574. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1575. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1576. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1577. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1578. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1579. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1580. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1581. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1582. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1583. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1584. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1585. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1586. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1587. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1588. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1589. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1590. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1591. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1592. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1593. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1594. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1595. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1596. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1597. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1598. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1599. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1600. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1601. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1602. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1603. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1604. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1605. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1606. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1607. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1608. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1609. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1610. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1611. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1612. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1613. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1614. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1615. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1616. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1617. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1618. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1619. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1620. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1621. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1622. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1623. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1624. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1625. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1626. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1627. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1628. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1629. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1630. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1631. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1632. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1633. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1634. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1635. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1636. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1637. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1638. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1639. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1640. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1641. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1642. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1643. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1644. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1645. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1646. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1647. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1648. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1649. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1650. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1651. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1652. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1653. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1654. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1655. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1656. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1657. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1658. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1659. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1660. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1661. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1662. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1663. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1664. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1665. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1666. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1667. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1668. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1669. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1670. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1671. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1672. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1673. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1674. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1675. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1676. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1677. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1678. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1679. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1680. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1681. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1682. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1683. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1684. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1685. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1686. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1687. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1688. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1689. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1690. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1691. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1692. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1693. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1694. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1695. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1696. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1697. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1698. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1699. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1700. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1701. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1702. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1703. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1704. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1705. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1706. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1707. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1708. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1709. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1710. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1711. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1712. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1713. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1714. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1715. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1716. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1717. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1718. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1719. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1720. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1721. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1722. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1723. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1724. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1725. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1726. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1727. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1728. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1729. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1730. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1731. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1732. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1733. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1734. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1735. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1736. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1737. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1738. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1739. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1740. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1741. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1742. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1743. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1744. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1745. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1746. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1747. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1748. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1749. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1750. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1751. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1752. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1753. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1754. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1755. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1756. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1757. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1758. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1759. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1760. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1761. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1762. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1763. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1764. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1765. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1766. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1767. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1768. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1769. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1770. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1771. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1772. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1773. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1774. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1775. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1776. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1777. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1778. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1779. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1780. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1781. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1782. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1783. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1784. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1785. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1786. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1787. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1788. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1789. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1790. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1791. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1792. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1793. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1794. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1795. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1796. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1797. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1798. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1799. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1800. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1801. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1802. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1803. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1804. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1805. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1806. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1807. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1808. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1809. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1810. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1811. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1812. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1813. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1814. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1815. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1816. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1817. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1818. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1819. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1820. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1821. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1822. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1823. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1824. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1825. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1826. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1827. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1828. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1829. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1830. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1831. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1832. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1833. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1834. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1835. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1836. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1837. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1838. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1839. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1840. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1841. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1842. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1843. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1844. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1845. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1846. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1847. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1848. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1849. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1850. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1851. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1852. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1853. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1854. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1855. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1856. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1857. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
1858. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
1859. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
1860. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
1861. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
1862. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
1863. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1864. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
1865. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
1866. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
1867. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
1868. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
1869. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
1870. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
1871. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
1872. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
1873. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
1874. gbinv1.seq - Invertebrate sequence entries, part 1.
1875. gbinv10.seq - Invertebrate sequence entries, part 10.
1876. gbinv100.seq - Invertebrate sequence entries, part 100.
1877. gbinv101.seq - Invertebrate sequence entries, part 101.
1878. gbinv102.seq - Invertebrate sequence entries, part 102.
1879. gbinv103.seq - Invertebrate sequence entries, part 103.
1880. gbinv104.seq - Invertebrate sequence entries, part 104.
1881. gbinv105.seq - Invertebrate sequence entries, part 105.
1882. gbinv106.seq - Invertebrate sequence entries, part 106.
1883. gbinv107.seq - Invertebrate sequence entries, part 107.
1884. gbinv108.seq - Invertebrate sequence entries, part 108.
1885. gbinv109.seq - Invertebrate sequence entries, part 109.
1886. gbinv11.seq - Invertebrate sequence entries, part 11.
1887. gbinv110.seq - Invertebrate sequence entries, part 110.
1888. gbinv111.seq - Invertebrate sequence entries, part 111.
1889. gbinv112.seq - Invertebrate sequence entries, part 112.
1890. gbinv113.seq - Invertebrate sequence entries, part 113.
1891. gbinv114.seq - Invertebrate sequence entries, part 114.
1892. gbinv115.seq - Invertebrate sequence entries, part 115.
1893. gbinv116.seq - Invertebrate sequence entries, part 116.
1894. gbinv117.seq - Invertebrate sequence entries, part 117.
1895. gbinv118.seq - Invertebrate sequence entries, part 118.
1896. gbinv119.seq - Invertebrate sequence entries, part 119.
1897. gbinv12.seq - Invertebrate sequence entries, part 12.
1898. gbinv120.seq - Invertebrate sequence entries, part 120.
1899. gbinv121.seq - Invertebrate sequence entries, part 121.
1900. gbinv122.seq - Invertebrate sequence entries, part 122.
1901. gbinv123.seq - Invertebrate sequence entries, part 123.
1902. gbinv124.seq - Invertebrate sequence entries, part 124.
1903. gbinv125.seq - Invertebrate sequence entries, part 125.
1904. gbinv126.seq - Invertebrate sequence entries, part 126.
1905. gbinv127.seq - Invertebrate sequence entries, part 127.
1906. gbinv128.seq - Invertebrate sequence entries, part 128.
1907. gbinv129.seq - Invertebrate sequence entries, part 129.
1908. gbinv13.seq - Invertebrate sequence entries, part 13.
1909. gbinv130.seq - Invertebrate sequence entries, part 130.
1910. gbinv131.seq - Invertebrate sequence entries, part 131.
1911. gbinv132.seq - Invertebrate sequence entries, part 132.
1912. gbinv133.seq - Invertebrate sequence entries, part 133.
1913. gbinv134.seq - Invertebrate sequence entries, part 134.
1914. gbinv135.seq - Invertebrate sequence entries, part 135.
1915. gbinv136.seq - Invertebrate sequence entries, part 136.
1916. gbinv137.seq - Invertebrate sequence entries, part 137.
1917. gbinv138.seq - Invertebrate sequence entries, part 138.
1918. gbinv139.seq - Invertebrate sequence entries, part 139.
1919. gbinv14.seq - Invertebrate sequence entries, part 14.
1920. gbinv140.seq - Invertebrate sequence entries, part 140.
1921. gbinv141.seq - Invertebrate sequence entries, part 141.
1922. gbinv142.seq - Invertebrate sequence entries, part 142.
1923. gbinv143.seq - Invertebrate sequence entries, part 143.
1924. gbinv144.seq - Invertebrate sequence entries, part 144.
1925. gbinv145.seq - Invertebrate sequence entries, part 145.
1926. gbinv146.seq - Invertebrate sequence entries, part 146.
1927. gbinv147.seq - Invertebrate sequence entries, part 147.
1928. gbinv148.seq - Invertebrate sequence entries, part 148.
1929. gbinv149.seq - Invertebrate sequence entries, part 149.
1930. gbinv15.seq - Invertebrate sequence entries, part 15.
1931. gbinv150.seq - Invertebrate sequence entries, part 150.
1932. gbinv151.seq - Invertebrate sequence entries, part 151.
1933. gbinv152.seq - Invertebrate sequence entries, part 152.
1934. gbinv153.seq - Invertebrate sequence entries, part 153.
1935. gbinv154.seq - Invertebrate sequence entries, part 154.
1936. gbinv155.seq - Invertebrate sequence entries, part 155.
1937. gbinv156.seq - Invertebrate sequence entries, part 156.
1938. gbinv157.seq - Invertebrate sequence entries, part 157.
1939. gbinv158.seq - Invertebrate sequence entries, part 158.
1940. gbinv159.seq - Invertebrate sequence entries, part 159.
1941. gbinv16.seq - Invertebrate sequence entries, part 16.
1942. gbinv160.seq - Invertebrate sequence entries, part 160.
1943. gbinv161.seq - Invertebrate sequence entries, part 161.
1944. gbinv17.seq - Invertebrate sequence entries, part 17.
1945. gbinv18.seq - Invertebrate sequence entries, part 18.
1946. gbinv19.seq - Invertebrate sequence entries, part 19.
1947. gbinv2.seq - Invertebrate sequence entries, part 2.
1948. gbinv20.seq - Invertebrate sequence entries, part 20.
1949. gbinv21.seq - Invertebrate sequence entries, part 21.
1950. gbinv22.seq - Invertebrate sequence entries, part 22.
1951. gbinv23.seq - Invertebrate sequence entries, part 23.
1952. gbinv24.seq - Invertebrate sequence entries, part 24.
1953. gbinv25.seq - Invertebrate sequence entries, part 25.
1954. gbinv26.seq - Invertebrate sequence entries, part 26.
1955. gbinv27.seq - Invertebrate sequence entries, part 27.
1956. gbinv28.seq - Invertebrate sequence entries, part 28.
1957. gbinv29.seq - Invertebrate sequence entries, part 29.
1958. gbinv3.seq - Invertebrate sequence entries, part 3.
1959. gbinv30.seq - Invertebrate sequence entries, part 30.
1960. gbinv31.seq - Invertebrate sequence entries, part 31.
1961. gbinv32.seq - Invertebrate sequence entries, part 32.
1962. gbinv33.seq - Invertebrate sequence entries, part 33.
1963. gbinv34.seq - Invertebrate sequence entries, part 34.
1964. gbinv35.seq - Invertebrate sequence entries, part 35.
1965. gbinv36.seq - Invertebrate sequence entries, part 36.
1966. gbinv37.seq - Invertebrate sequence entries, part 37.
1967. gbinv38.seq - Invertebrate sequence entries, part 38.
1968. gbinv39.seq - Invertebrate sequence entries, part 39.
1969. gbinv4.seq - Invertebrate sequence entries, part 4.
1970. gbinv40.seq - Invertebrate sequence entries, part 40.
1971. gbinv41.seq - Invertebrate sequence entries, part 41.
1972. gbinv42.seq - Invertebrate sequence entries, part 42.
1973. gbinv43.seq - Invertebrate sequence entries, part 43.
1974. gbinv44.seq - Invertebrate sequence entries, part 44.
1975. gbinv45.seq - Invertebrate sequence entries, part 45.
1976. gbinv46.seq - Invertebrate sequence entries, part 46.
1977. gbinv47.seq - Invertebrate sequence entries, part 47.
1978. gbinv48.seq - Invertebrate sequence entries, part 48.
1979. gbinv49.seq - Invertebrate sequence entries, part 49.
1980. gbinv5.seq - Invertebrate sequence entries, part 5.
1981. gbinv50.seq - Invertebrate sequence entries, part 50.
1982. gbinv51.seq - Invertebrate sequence entries, part 51.
1983. gbinv52.seq - Invertebrate sequence entries, part 52.
1984. gbinv53.seq - Invertebrate sequence entries, part 53.
1985. gbinv54.seq - Invertebrate sequence entries, part 54.
1986. gbinv55.seq - Invertebrate sequence entries, part 55.
1987. gbinv56.seq - Invertebrate sequence entries, part 56.
1988. gbinv57.seq - Invertebrate sequence entries, part 57.
1989. gbinv58.seq - Invertebrate sequence entries, part 58.
1990. gbinv59.seq - Invertebrate sequence entries, part 59.
1991. gbinv6.seq - Invertebrate sequence entries, part 6.
1992. gbinv60.seq - Invertebrate sequence entries, part 60.
1993. gbinv61.seq - Invertebrate sequence entries, part 61.
1994. gbinv62.seq - Invertebrate sequence entries, part 62.
1995. gbinv63.seq - Invertebrate sequence entries, part 63.
1996. gbinv64.seq - Invertebrate sequence entries, part 64.
1997. gbinv65.seq - Invertebrate sequence entries, part 65.
1998. gbinv66.seq - Invertebrate sequence entries, part 66.
1999. gbinv67.seq - Invertebrate sequence entries, part 67.
2000. gbinv68.seq - Invertebrate sequence entries, part 68.
2001. gbinv69.seq - Invertebrate sequence entries, part 69.
2002. gbinv7.seq - Invertebrate sequence entries, part 7.
2003. gbinv70.seq - Invertebrate sequence entries, part 70.
2004. gbinv71.seq - Invertebrate sequence entries, part 71.
2005. gbinv72.seq - Invertebrate sequence entries, part 72.
2006. gbinv73.seq - Invertebrate sequence entries, part 73.
2007. gbinv74.seq - Invertebrate sequence entries, part 74.
2008. gbinv75.seq - Invertebrate sequence entries, part 75.
2009. gbinv76.seq - Invertebrate sequence entries, part 76.
2010. gbinv77.seq - Invertebrate sequence entries, part 77.
2011. gbinv78.seq - Invertebrate sequence entries, part 78.
2012. gbinv79.seq - Invertebrate sequence entries, part 79.
2013. gbinv8.seq - Invertebrate sequence entries, part 8.
2014. gbinv80.seq - Invertebrate sequence entries, part 80.
2015. gbinv81.seq - Invertebrate sequence entries, part 81.
2016. gbinv82.seq - Invertebrate sequence entries, part 82.
2017. gbinv83.seq - Invertebrate sequence entries, part 83.
2018. gbinv84.seq - Invertebrate sequence entries, part 84.
2019. gbinv85.seq - Invertebrate sequence entries, part 85.
2020. gbinv86.seq - Invertebrate sequence entries, part 86.
2021. gbinv87.seq - Invertebrate sequence entries, part 87.
2022. gbinv88.seq - Invertebrate sequence entries, part 88.
2023. gbinv89.seq - Invertebrate sequence entries, part 89.
2024. gbinv9.seq - Invertebrate sequence entries, part 9.
2025. gbinv90.seq - Invertebrate sequence entries, part 90.
2026. gbinv91.seq - Invertebrate sequence entries, part 91.
2027. gbinv92.seq - Invertebrate sequence entries, part 92.
2028. gbinv93.seq - Invertebrate sequence entries, part 93.
2029. gbinv94.seq - Invertebrate sequence entries, part 94.
2030. gbinv95.seq - Invertebrate sequence entries, part 95.
2031. gbinv96.seq - Invertebrate sequence entries, part 96.
2032. gbinv97.seq - Invertebrate sequence entries, part 97.
2033. gbinv98.seq - Invertebrate sequence entries, part 98.
2034. gbinv99.seq - Invertebrate sequence entries, part 99.
2035. gbmam1.seq - Other mammalian sequence entries, part 1.
2036. gbmam10.seq - Other mammalian sequence entries, part 10.
2037. gbmam11.seq - Other mammalian sequence entries, part 11.
2038. gbmam12.seq - Other mammalian sequence entries, part 12.
2039. gbmam13.seq - Other mammalian sequence entries, part 13.
2040. gbmam14.seq - Other mammalian sequence entries, part 14.
2041. gbmam15.seq - Other mammalian sequence entries, part 15.
2042. gbmam16.seq - Other mammalian sequence entries, part 16.
2043. gbmam17.seq - Other mammalian sequence entries, part 17.
2044. gbmam18.seq - Other mammalian sequence entries, part 18.
2045. gbmam19.seq - Other mammalian sequence entries, part 19.
2046. gbmam2.seq - Other mammalian sequence entries, part 2.
2047. gbmam20.seq - Other mammalian sequence entries, part 20.
2048. gbmam21.seq - Other mammalian sequence entries, part 21.
2049. gbmam22.seq - Other mammalian sequence entries, part 22.
2050. gbmam23.seq - Other mammalian sequence entries, part 23.
2051. gbmam24.seq - Other mammalian sequence entries, part 24.
2052. gbmam25.seq - Other mammalian sequence entries, part 25.
2053. gbmam26.seq - Other mammalian sequence entries, part 26.
2054. gbmam27.seq - Other mammalian sequence entries, part 27.
2055. gbmam28.seq - Other mammalian sequence entries, part 28.
2056. gbmam29.seq - Other mammalian sequence entries, part 29.
2057. gbmam3.seq - Other mammalian sequence entries, part 3.
2058. gbmam30.seq - Other mammalian sequence entries, part 30.
2059. gbmam31.seq - Other mammalian sequence entries, part 31.
2060. gbmam32.seq - Other mammalian sequence entries, part 32.
2061. gbmam33.seq - Other mammalian sequence entries, part 33.
2062. gbmam34.seq - Other mammalian sequence entries, part 34.
2063. gbmam35.seq - Other mammalian sequence entries, part 35.
2064. gbmam36.seq - Other mammalian sequence entries, part 36.
2065. gbmam37.seq - Other mammalian sequence entries, part 37.
2066. gbmam38.seq - Other mammalian sequence entries, part 38.
2067. gbmam39.seq - Other mammalian sequence entries, part 39.
2068. gbmam4.seq - Other mammalian sequence entries, part 4.
2069. gbmam5.seq - Other mammalian sequence entries, part 5.
2070. gbmam6.seq - Other mammalian sequence entries, part 6.
2071. gbmam7.seq - Other mammalian sequence entries, part 7.
2072. gbmam8.seq - Other mammalian sequence entries, part 8.
2073. gbmam9.seq - Other mammalian sequence entries, part 9.
2074. gbnew.txt - Accession numbers of entries new since the previous release.
2075. gbpat1.seq - Patent sequence entries, part 1.
2076. gbpat10.seq - Patent sequence entries, part 10.
2077. gbpat100.seq - Patent sequence entries, part 100.
2078. gbpat101.seq - Patent sequence entries, part 101.
2079. gbpat102.seq - Patent sequence entries, part 102.
2080. gbpat103.seq - Patent sequence entries, part 103.
2081. gbpat104.seq - Patent sequence entries, part 104.
2082. gbpat105.seq - Patent sequence entries, part 105.
2083. gbpat106.seq - Patent sequence entries, part 106.
2084. gbpat107.seq - Patent sequence entries, part 107.
2085. gbpat108.seq - Patent sequence entries, part 108.
2086. gbpat109.seq - Patent sequence entries, part 109.
2087. gbpat11.seq - Patent sequence entries, part 11.
2088. gbpat110.seq - Patent sequence entries, part 110.
2089. gbpat111.seq - Patent sequence entries, part 111.
2090. gbpat112.seq - Patent sequence entries, part 112.
2091. gbpat113.seq - Patent sequence entries, part 113.
2092. gbpat114.seq - Patent sequence entries, part 114.
2093. gbpat115.seq - Patent sequence entries, part 115.
2094. gbpat116.seq - Patent sequence entries, part 116.
2095. gbpat117.seq - Patent sequence entries, part 117.
2096. gbpat118.seq - Patent sequence entries, part 118.
2097. gbpat119.seq - Patent sequence entries, part 119.
2098. gbpat12.seq - Patent sequence entries, part 12.
2099. gbpat120.seq - Patent sequence entries, part 120.
2100. gbpat121.seq - Patent sequence entries, part 121.
2101. gbpat122.seq - Patent sequence entries, part 122.
2102. gbpat123.seq - Patent sequence entries, part 123.
2103. gbpat124.seq - Patent sequence entries, part 124.
2104. gbpat125.seq - Patent sequence entries, part 125.
2105. gbpat126.seq - Patent sequence entries, part 126.
2106. gbpat127.seq - Patent sequence entries, part 127.
2107. gbpat128.seq - Patent sequence entries, part 128.
2108. gbpat129.seq - Patent sequence entries, part 129.
2109. gbpat13.seq - Patent sequence entries, part 13.
2110. gbpat130.seq - Patent sequence entries, part 130.
2111. gbpat131.seq - Patent sequence entries, part 131.
2112. gbpat132.seq - Patent sequence entries, part 132.
2113. gbpat133.seq - Patent sequence entries, part 133.
2114. gbpat134.seq - Patent sequence entries, part 134.
2115. gbpat135.seq - Patent sequence entries, part 135.
2116. gbpat136.seq - Patent sequence entries, part 136.
2117. gbpat137.seq - Patent sequence entries, part 137.
2118. gbpat138.seq - Patent sequence entries, part 138.
2119. gbpat139.seq - Patent sequence entries, part 139.
2120. gbpat14.seq - Patent sequence entries, part 14.
2121. gbpat140.seq - Patent sequence entries, part 140.
2122. gbpat141.seq - Patent sequence entries, part 141.
2123. gbpat142.seq - Patent sequence entries, part 142.
2124. gbpat143.seq - Patent sequence entries, part 143.
2125. gbpat144.seq - Patent sequence entries, part 144.
2126. gbpat145.seq - Patent sequence entries, part 145.
2127. gbpat146.seq - Patent sequence entries, part 146.
2128. gbpat147.seq - Patent sequence entries, part 147.
2129. gbpat148.seq - Patent sequence entries, part 148.
2130. gbpat149.seq - Patent sequence entries, part 149.
2131. gbpat15.seq - Patent sequence entries, part 15.
2132. gbpat150.seq - Patent sequence entries, part 150.
2133. gbpat151.seq - Patent sequence entries, part 151.
2134. gbpat152.seq - Patent sequence entries, part 152.
2135. gbpat153.seq - Patent sequence entries, part 153.
2136. gbpat154.seq - Patent sequence entries, part 154.
2137. gbpat155.seq - Patent sequence entries, part 155.
2138. gbpat156.seq - Patent sequence entries, part 156.
2139. gbpat157.seq - Patent sequence entries, part 157.
2140. gbpat158.seq - Patent sequence entries, part 158.
2141. gbpat159.seq - Patent sequence entries, part 159.
2142. gbpat16.seq - Patent sequence entries, part 16.
2143. gbpat160.seq - Patent sequence entries, part 160.
2144. gbpat161.seq - Patent sequence entries, part 161.
2145. gbpat162.seq - Patent sequence entries, part 162.
2146. gbpat163.seq - Patent sequence entries, part 163.
2147. gbpat164.seq - Patent sequence entries, part 164.
2148. gbpat165.seq - Patent sequence entries, part 165.
2149. gbpat166.seq - Patent sequence entries, part 166.
2150. gbpat167.seq - Patent sequence entries, part 167.
2151. gbpat168.seq - Patent sequence entries, part 168.
2152. gbpat169.seq - Patent sequence entries, part 169.
2153. gbpat17.seq - Patent sequence entries, part 17.
2154. gbpat170.seq - Patent sequence entries, part 170.
2155. gbpat171.seq - Patent sequence entries, part 171.
2156. gbpat172.seq - Patent sequence entries, part 172.
2157. gbpat173.seq - Patent sequence entries, part 173.
2158. gbpat174.seq - Patent sequence entries, part 174.
2159. gbpat175.seq - Patent sequence entries, part 175.
2160. gbpat176.seq - Patent sequence entries, part 176.
2161. gbpat177.seq - Patent sequence entries, part 177.
2162. gbpat178.seq - Patent sequence entries, part 178.
2163. gbpat179.seq - Patent sequence entries, part 179.
2164. gbpat18.seq - Patent sequence entries, part 18.
2165. gbpat180.seq - Patent sequence entries, part 180.
2166. gbpat181.seq - Patent sequence entries, part 181.
2167. gbpat182.seq - Patent sequence entries, part 182.
2168. gbpat183.seq - Patent sequence entries, part 183.
2169. gbpat184.seq - Patent sequence entries, part 184.
2170. gbpat185.seq - Patent sequence entries, part 185.
2171. gbpat186.seq - Patent sequence entries, part 186.
2172. gbpat187.seq - Patent sequence entries, part 187.
2173. gbpat188.seq - Patent sequence entries, part 188.
2174. gbpat189.seq - Patent sequence entries, part 189.
2175. gbpat19.seq - Patent sequence entries, part 19.
2176. gbpat190.seq - Patent sequence entries, part 190.
2177. gbpat191.seq - Patent sequence entries, part 191.
2178. gbpat192.seq - Patent sequence entries, part 192.
2179. gbpat193.seq - Patent sequence entries, part 193.
2180. gbpat194.seq - Patent sequence entries, part 194.
2181. gbpat195.seq - Patent sequence entries, part 195.
2182. gbpat196.seq - Patent sequence entries, part 196.
2183. gbpat197.seq - Patent sequence entries, part 197.
2184. gbpat198.seq - Patent sequence entries, part 198.
2185. gbpat199.seq - Patent sequence entries, part 199.
2186. gbpat2.seq - Patent sequence entries, part 2.
2187. gbpat20.seq - Patent sequence entries, part 20.
2188. gbpat200.seq - Patent sequence entries, part 200.
2189. gbpat201.seq - Patent sequence entries, part 201.
2190. gbpat202.seq - Patent sequence entries, part 202.
2191. gbpat203.seq - Patent sequence entries, part 203.
2192. gbpat204.seq - Patent sequence entries, part 204.
2193. gbpat205.seq - Patent sequence entries, part 205.
2194. gbpat206.seq - Patent sequence entries, part 206.
2195. gbpat207.seq - Patent sequence entries, part 207.
2196. gbpat208.seq - Patent sequence entries, part 208.
2197. gbpat209.seq - Patent sequence entries, part 209.
2198. gbpat21.seq - Patent sequence entries, part 21.
2199. gbpat210.seq - Patent sequence entries, part 210.
2200. gbpat211.seq - Patent sequence entries, part 211.
2201. gbpat212.seq - Patent sequence entries, part 212.
2202. gbpat213.seq - Patent sequence entries, part 213.
2203. gbpat214.seq - Patent sequence entries, part 214.
2204. gbpat215.seq - Patent sequence entries, part 215.
2205. gbpat216.seq - Patent sequence entries, part 216.
2206. gbpat217.seq - Patent sequence entries, part 217.
2207. gbpat218.seq - Patent sequence entries, part 218.
2208. gbpat219.seq - Patent sequence entries, part 219.
2209. gbpat22.seq - Patent sequence entries, part 22.
2210. gbpat220.seq - Patent sequence entries, part 220.
2211. gbpat221.seq - Patent sequence entries, part 221.
2212. gbpat222.seq - Patent sequence entries, part 222.
2213. gbpat223.seq - Patent sequence entries, part 223.
2214. gbpat224.seq - Patent sequence entries, part 224.
2215. gbpat225.seq - Patent sequence entries, part 225.
2216. gbpat226.seq - Patent sequence entries, part 226.
2217. gbpat227.seq - Patent sequence entries, part 227.
2218. gbpat228.seq - Patent sequence entries, part 228.
2219. gbpat229.seq - Patent sequence entries, part 229.
2220. gbpat23.seq - Patent sequence entries, part 23.
2221. gbpat230.seq - Patent sequence entries, part 230.
2222. gbpat231.seq - Patent sequence entries, part 231.
2223. gbpat232.seq - Patent sequence entries, part 232.
2224. gbpat233.seq - Patent sequence entries, part 233.
2225. gbpat234.seq - Patent sequence entries, part 234.
2226. gbpat235.seq - Patent sequence entries, part 235.
2227. gbpat236.seq - Patent sequence entries, part 236.
2228. gbpat237.seq - Patent sequence entries, part 237.
2229. gbpat238.seq - Patent sequence entries, part 238.
2230. gbpat239.seq - Patent sequence entries, part 239.
2231. gbpat24.seq - Patent sequence entries, part 24.
2232. gbpat240.seq - Patent sequence entries, part 240.
2233. gbpat241.seq - Patent sequence entries, part 241.
2234. gbpat242.seq - Patent sequence entries, part 242.
2235. gbpat243.seq - Patent sequence entries, part 243.
2236. gbpat244.seq - Patent sequence entries, part 244.
2237. gbpat245.seq - Patent sequence entries, part 245.
2238. gbpat246.seq - Patent sequence entries, part 246.
2239. gbpat247.seq - Patent sequence entries, part 247.
2240. gbpat248.seq - Patent sequence entries, part 248.
2241. gbpat249.seq - Patent sequence entries, part 249.
2242. gbpat25.seq - Patent sequence entries, part 25.
2243. gbpat250.seq - Patent sequence entries, part 250.
2244. gbpat251.seq - Patent sequence entries, part 251.
2245. gbpat252.seq - Patent sequence entries, part 252.
2246. gbpat253.seq - Patent sequence entries, part 253.
2247. gbpat254.seq - Patent sequence entries, part 254.
2248. gbpat255.seq - Patent sequence entries, part 255.
2249. gbpat256.seq - Patent sequence entries, part 256.
2250. gbpat257.seq - Patent sequence entries, part 257.
2251. gbpat258.seq - Patent sequence entries, part 258.
2252. gbpat259.seq - Patent sequence entries, part 259.
2253. gbpat26.seq - Patent sequence entries, part 26.
2254. gbpat260.seq - Patent sequence entries, part 260.
2255. gbpat261.seq - Patent sequence entries, part 261.
2256. gbpat262.seq - Patent sequence entries, part 262.
2257. gbpat263.seq - Patent sequence entries, part 263.
2258. gbpat264.seq - Patent sequence entries, part 264.
2259. gbpat265.seq - Patent sequence entries, part 265.
2260. gbpat266.seq - Patent sequence entries, part 266.
2261. gbpat267.seq - Patent sequence entries, part 267.
2262. gbpat268.seq - Patent sequence entries, part 268.
2263. gbpat269.seq - Patent sequence entries, part 269.
2264. gbpat27.seq - Patent sequence entries, part 27.
2265. gbpat270.seq - Patent sequence entries, part 270.
2266. gbpat271.seq - Patent sequence entries, part 271.
2267. gbpat272.seq - Patent sequence entries, part 272.
2268. gbpat273.seq - Patent sequence entries, part 273.
2269. gbpat274.seq - Patent sequence entries, part 274.
2270. gbpat275.seq - Patent sequence entries, part 275.
2271. gbpat276.seq - Patent sequence entries, part 276.
2272. gbpat277.seq - Patent sequence entries, part 277.
2273. gbpat278.seq - Patent sequence entries, part 278.
2274. gbpat279.seq - Patent sequence entries, part 279.
2275. gbpat28.seq - Patent sequence entries, part 28.
2276. gbpat280.seq - Patent sequence entries, part 280.
2277. gbpat281.seq - Patent sequence entries, part 281.
2278. gbpat282.seq - Patent sequence entries, part 282.
2279. gbpat283.seq - Patent sequence entries, part 283.
2280. gbpat284.seq - Patent sequence entries, part 284.
2281. gbpat285.seq - Patent sequence entries, part 285.
2282. gbpat286.seq - Patent sequence entries, part 286.
2283. gbpat287.seq - Patent sequence entries, part 287.
2284. gbpat288.seq - Patent sequence entries, part 288.
2285. gbpat289.seq - Patent sequence entries, part 289.
2286. gbpat29.seq - Patent sequence entries, part 29.
2287. gbpat290.seq - Patent sequence entries, part 290.
2288. gbpat291.seq - Patent sequence entries, part 291.
2289. gbpat292.seq - Patent sequence entries, part 292.
2290. gbpat293.seq - Patent sequence entries, part 293.
2291. gbpat294.seq - Patent sequence entries, part 294.
2292. gbpat295.seq - Patent sequence entries, part 295.
2293. gbpat296.seq - Patent sequence entries, part 296.
2294. gbpat297.seq - Patent sequence entries, part 297.
2295. gbpat298.seq - Patent sequence entries, part 298.
2296. gbpat299.seq - Patent sequence entries, part 299.
2297. gbpat3.seq - Patent sequence entries, part 3.
2298. gbpat30.seq - Patent sequence entries, part 30.
2299. gbpat300.seq - Patent sequence entries, part 300.
2300. gbpat301.seq - Patent sequence entries, part 301.
2301. gbpat302.seq - Patent sequence entries, part 302.
2302. gbpat303.seq - Patent sequence entries, part 303.
2303. gbpat304.seq - Patent sequence entries, part 304.
2304. gbpat305.seq - Patent sequence entries, part 305.
2305. gbpat306.seq - Patent sequence entries, part 306.
2306. gbpat307.seq - Patent sequence entries, part 307.
2307. gbpat308.seq - Patent sequence entries, part 308.
2308. gbpat309.seq - Patent sequence entries, part 309.
2309. gbpat31.seq - Patent sequence entries, part 31.
2310. gbpat310.seq - Patent sequence entries, part 310.
2311. gbpat311.seq - Patent sequence entries, part 311.
2312. gbpat312.seq - Patent sequence entries, part 312.
2313. gbpat313.seq - Patent sequence entries, part 313.
2314. gbpat314.seq - Patent sequence entries, part 314.
2315. gbpat315.seq - Patent sequence entries, part 315.
2316. gbpat316.seq - Patent sequence entries, part 316.
2317. gbpat317.seq - Patent sequence entries, part 317.
2318. gbpat318.seq - Patent sequence entries, part 318.
2319. gbpat319.seq - Patent sequence entries, part 319.
2320. gbpat32.seq - Patent sequence entries, part 32.
2321. gbpat320.seq - Patent sequence entries, part 320.
2322. gbpat321.seq - Patent sequence entries, part 321.
2323. gbpat322.seq - Patent sequence entries, part 322.
2324. gbpat323.seq - Patent sequence entries, part 323.
2325. gbpat33.seq - Patent sequence entries, part 33.
2326. gbpat34.seq - Patent sequence entries, part 34.
2327. gbpat35.seq - Patent sequence entries, part 35.
2328. gbpat36.seq - Patent sequence entries, part 36.
2329. gbpat37.seq - Patent sequence entries, part 37.
2330. gbpat38.seq - Patent sequence entries, part 38.
2331. gbpat39.seq - Patent sequence entries, part 39.
2332. gbpat4.seq - Patent sequence entries, part 4.
2333. gbpat40.seq - Patent sequence entries, part 40.
2334. gbpat41.seq - Patent sequence entries, part 41.
2335. gbpat42.seq - Patent sequence entries, part 42.
2336. gbpat43.seq - Patent sequence entries, part 43.
2337. gbpat44.seq - Patent sequence entries, part 44.
2338. gbpat45.seq - Patent sequence entries, part 45.
2339. gbpat46.seq - Patent sequence entries, part 46.
2340. gbpat47.seq - Patent sequence entries, part 47.
2341. gbpat48.seq - Patent sequence entries, part 48.
2342. gbpat49.seq - Patent sequence entries, part 49.
2343. gbpat5.seq - Patent sequence entries, part 5.
2344. gbpat50.seq - Patent sequence entries, part 50.
2345. gbpat51.seq - Patent sequence entries, part 51.
2346. gbpat52.seq - Patent sequence entries, part 52.
2347. gbpat53.seq - Patent sequence entries, part 53.
2348. gbpat54.seq - Patent sequence entries, part 54.
2349. gbpat55.seq - Patent sequence entries, part 55.
2350. gbpat56.seq - Patent sequence entries, part 56.
2351. gbpat57.seq - Patent sequence entries, part 57.
2352. gbpat58.seq - Patent sequence entries, part 58.
2353. gbpat59.seq - Patent sequence entries, part 59.
2354. gbpat6.seq - Patent sequence entries, part 6.
2355. gbpat60.seq - Patent sequence entries, part 60.
2356. gbpat61.seq - Patent sequence entries, part 61.
2357. gbpat62.seq - Patent sequence entries, part 62.
2358. gbpat63.seq - Patent sequence entries, part 63.
2359. gbpat64.seq - Patent sequence entries, part 64.
2360. gbpat65.seq - Patent sequence entries, part 65.
2361. gbpat66.seq - Patent sequence entries, part 66.
2362. gbpat67.seq - Patent sequence entries, part 67.
2363. gbpat68.seq - Patent sequence entries, part 68.
2364. gbpat69.seq - Patent sequence entries, part 69.
2365. gbpat7.seq - Patent sequence entries, part 7.
2366. gbpat70.seq - Patent sequence entries, part 70.
2367. gbpat71.seq - Patent sequence entries, part 71.
2368. gbpat72.seq - Patent sequence entries, part 72.
2369. gbpat73.seq - Patent sequence entries, part 73.
2370. gbpat74.seq - Patent sequence entries, part 74.
2371. gbpat75.seq - Patent sequence entries, part 75.
2372. gbpat76.seq - Patent sequence entries, part 76.
2373. gbpat77.seq - Patent sequence entries, part 77.
2374. gbpat78.seq - Patent sequence entries, part 78.
2375. gbpat79.seq - Patent sequence entries, part 79.
2376. gbpat8.seq - Patent sequence entries, part 8.
2377. gbpat80.seq - Patent sequence entries, part 80.
2378. gbpat81.seq - Patent sequence entries, part 81.
2379. gbpat82.seq - Patent sequence entries, part 82.
2380. gbpat83.seq - Patent sequence entries, part 83.
2381. gbpat84.seq - Patent sequence entries, part 84.
2382. gbpat85.seq - Patent sequence entries, part 85.
2383. gbpat86.seq - Patent sequence entries, part 86.
2384. gbpat87.seq - Patent sequence entries, part 87.
2385. gbpat88.seq - Patent sequence entries, part 88.
2386. gbpat89.seq - Patent sequence entries, part 89.
2387. gbpat9.seq - Patent sequence entries, part 9.
2388. gbpat90.seq - Patent sequence entries, part 90.
2389. gbpat91.seq - Patent sequence entries, part 91.
2390. gbpat92.seq - Patent sequence entries, part 92.
2391. gbpat93.seq - Patent sequence entries, part 93.
2392. gbpat94.seq - Patent sequence entries, part 94.
2393. gbpat95.seq - Patent sequence entries, part 95.
2394. gbpat96.seq - Patent sequence entries, part 96.
2395. gbpat97.seq - Patent sequence entries, part 97.
2396. gbpat98.seq - Patent sequence entries, part 98.
2397. gbpat99.seq - Patent sequence entries, part 99.
2398. gbphg1.seq - Phage sequence entries, part 1.
2399. gbphg2.seq - Phage sequence entries, part 2.
2400. gbphg3.seq - Phage sequence entries, part 3.
2401. gbphg4.seq - Phage sequence entries, part 4.
2402. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2403. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2404. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2405. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2406. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2407. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2408. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2409. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2410. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2411. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2412. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2413. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2414. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2415. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2416. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2417. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2418. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2419. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2420. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2421. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2422. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2423. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2424. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2425. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2426. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2427. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2428. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2429. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2430. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2431. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2432. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2433. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2434. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2435. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2436. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2437. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2438. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2439. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2440. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2441. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2442. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2443. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2444. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2445. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2446. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2447. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2448. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2449. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2450. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2451. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2452. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2453. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2454. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2455. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2456. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2457. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2458. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2459. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2460. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2461. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2462. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2463. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2464. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2465. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2466. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2467. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2468. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2469. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2470. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2471. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2472. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2473. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2474. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2475. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2476. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2477. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2478. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2479. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2480. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2481. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2482. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2483. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2484. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2485. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2486. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2487. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2488. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2489. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2490. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2491. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2492. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2493. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2494. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2495. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2496. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2497. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2498. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2499. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2500. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2501. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2502. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2503. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2504. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2505. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2506. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2507. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2508. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2509. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2510. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2511. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2512. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2513. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2514. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2515. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2516. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2517. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2518. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2519. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2520. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2521. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2522. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2523. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2524. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2525. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2526. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2527. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2528. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2529. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2530. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2531. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2532. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2533. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2534. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2535. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2536. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2537. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2538. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2539. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2540. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2541. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2542. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2543. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2544. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2545. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2546. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2547. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2548. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2549. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2550. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2551. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2552. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2553. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2554. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2555. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2556. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2557. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2558. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2559. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2560. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2561. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2562. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2563. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2564. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2565. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2566. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2567. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2568. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2569. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2570. gbpri1.seq - Primate sequence entries, part 1.
2571. gbpri10.seq - Primate sequence entries, part 10.
2572. gbpri11.seq - Primate sequence entries, part 11.
2573. gbpri12.seq - Primate sequence entries, part 12.
2574. gbpri13.seq - Primate sequence entries, part 13.
2575. gbpri14.seq - Primate sequence entries, part 14.
2576. gbpri15.seq - Primate sequence entries, part 15.
2577. gbpri16.seq - Primate sequence entries, part 16.
2578. gbpri17.seq - Primate sequence entries, part 17.
2579. gbpri18.seq - Primate sequence entries, part 18.
2580. gbpri19.seq - Primate sequence entries, part 19.
2581. gbpri2.seq - Primate sequence entries, part 2.
2582. gbpri20.seq - Primate sequence entries, part 20.
2583. gbpri21.seq - Primate sequence entries, part 21.
2584. gbpri22.seq - Primate sequence entries, part 22.
2585. gbpri23.seq - Primate sequence entries, part 23.
2586. gbpri24.seq - Primate sequence entries, part 24.
2587. gbpri25.seq - Primate sequence entries, part 25.
2588. gbpri26.seq - Primate sequence entries, part 26.
2589. gbpri27.seq - Primate sequence entries, part 27.
2590. gbpri28.seq - Primate sequence entries, part 28.
2591. gbpri29.seq - Primate sequence entries, part 29.
2592. gbpri3.seq - Primate sequence entries, part 3.
2593. gbpri30.seq - Primate sequence entries, part 30.
2594. gbpri31.seq - Primate sequence entries, part 31.
2595. gbpri32.seq - Primate sequence entries, part 32.
2596. gbpri33.seq - Primate sequence entries, part 33.
2597. gbpri34.seq - Primate sequence entries, part 34.
2598. gbpri35.seq - Primate sequence entries, part 35.
2599. gbpri36.seq - Primate sequence entries, part 36.
2600. gbpri37.seq - Primate sequence entries, part 37.
2601. gbpri38.seq - Primate sequence entries, part 38.
2602. gbpri39.seq - Primate sequence entries, part 39.
2603. gbpri4.seq - Primate sequence entries, part 4.
2604. gbpri40.seq - Primate sequence entries, part 40.
2605. gbpri41.seq - Primate sequence entries, part 41.
2606. gbpri42.seq - Primate sequence entries, part 42.
2607. gbpri43.seq - Primate sequence entries, part 43.
2608. gbpri44.seq - Primate sequence entries, part 44.
2609. gbpri45.seq - Primate sequence entries, part 45.
2610. gbpri46.seq - Primate sequence entries, part 46.
2611. gbpri47.seq - Primate sequence entries, part 47.
2612. gbpri48.seq - Primate sequence entries, part 48.
2613. gbpri49.seq - Primate sequence entries, part 49.
2614. gbpri5.seq - Primate sequence entries, part 5.
2615. gbpri50.seq - Primate sequence entries, part 50.
2616. gbpri51.seq - Primate sequence entries, part 51.
2617. gbpri52.seq - Primate sequence entries, part 52.
2618. gbpri53.seq - Primate sequence entries, part 53.
2619. gbpri54.seq - Primate sequence entries, part 54.
2620. gbpri55.seq - Primate sequence entries, part 55.
2621. gbpri56.seq - Primate sequence entries, part 56.
2622. gbpri57.seq - Primate sequence entries, part 57.
2623. gbpri58.seq - Primate sequence entries, part 58.
2624. gbpri6.seq - Primate sequence entries, part 6.
2625. gbpri7.seq - Primate sequence entries, part 7.
2626. gbpri8.seq - Primate sequence entries, part 8.
2627. gbpri9.seq - Primate sequence entries, part 9.
2628. gbrel.txt - Release notes (this document).
2629. gbrod1.seq - Rodent sequence entries, part 1.
2630. gbrod10.seq - Rodent sequence entries, part 10.
2631. gbrod11.seq - Rodent sequence entries, part 11.
2632. gbrod12.seq - Rodent sequence entries, part 12.
2633. gbrod13.seq - Rodent sequence entries, part 13.
2634. gbrod14.seq - Rodent sequence entries, part 14.
2635. gbrod15.seq - Rodent sequence entries, part 15.
2636. gbrod16.seq - Rodent sequence entries, part 16.
2637. gbrod17.seq - Rodent sequence entries, part 17.
2638. gbrod18.seq - Rodent sequence entries, part 18.
2639. gbrod19.seq - Rodent sequence entries, part 19.
2640. gbrod2.seq - Rodent sequence entries, part 2.
2641. gbrod20.seq - Rodent sequence entries, part 20.
2642. gbrod21.seq - Rodent sequence entries, part 21.
2643. gbrod22.seq - Rodent sequence entries, part 22.
2644. gbrod23.seq - Rodent sequence entries, part 23.
2645. gbrod24.seq - Rodent sequence entries, part 24.
2646. gbrod25.seq - Rodent sequence entries, part 25.
2647. gbrod26.seq - Rodent sequence entries, part 26.
2648. gbrod27.seq - Rodent sequence entries, part 27.
2649. gbrod28.seq - Rodent sequence entries, part 28.
2650. gbrod29.seq - Rodent sequence entries, part 29.
2651. gbrod3.seq - Rodent sequence entries, part 3.
2652. gbrod30.seq - Rodent sequence entries, part 30.
2653. gbrod4.seq - Rodent sequence entries, part 4.
2654. gbrod5.seq - Rodent sequence entries, part 5.
2655. gbrod6.seq - Rodent sequence entries, part 6.
2656. gbrod7.seq - Rodent sequence entries, part 7.
2657. gbrod8.seq - Rodent sequence entries, part 8.
2658. gbrod9.seq - Rodent sequence entries, part 9.
2659. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2660. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2661. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2662. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2663. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2664. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2665. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2666. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2667. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2668. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2669. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2670. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2671. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2672. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2673. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2674. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2675. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2676. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2677. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2678. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2679. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2680. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2681. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2682. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2683. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2684. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2685. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2686. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2687. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2688. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2689. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2690. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2691. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2692. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2693. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2694. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2695. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2696. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2697. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2698. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2699. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2700. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2701. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2702. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2703. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2704. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2705. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2706. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2707. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2708. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2709. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2710. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2711. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2712. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2713. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2714. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2715. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2716. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2717. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2718. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2719. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2720. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2721. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2722. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2723. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2724. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2725. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2726. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2727. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2728. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2729. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2730. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2731. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2732. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2733. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2734. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2735. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2736. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2737. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2738. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2739. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2740. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2741. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2742. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2743. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2744. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2745. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2746. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2747. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2748. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2749. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2750. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2751. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2752. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2753. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2754. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2755. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2756. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2757. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2758. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2759. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2760. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2761. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2762. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2763. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2764. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2765. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2766. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2767. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2768. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2769. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2770. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2771. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2772. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2773. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2774. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2775. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2776. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2777. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2778. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2779. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2780. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2781. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2782. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2783. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2784. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2785. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
2786. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
2787. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
2788. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
2789. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2790. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
2791. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
2792. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
2793. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
2794. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
2795. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
2796. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
2797. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
2798. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
2799. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
2800. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2801. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2802. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
2803. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
2804. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
2805. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
2806. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
2807. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
2808. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
2809. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
2810. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
2811. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
2812. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2813. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
2814. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
2815. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
2816. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
2817. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
2818. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
2819. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
2820. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
2821. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
2822. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
2823. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2824. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
2825. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
2826. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
2827. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
2828. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
2829. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
2830. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
2831. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
2832. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
2833. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
2834. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2835. gbtsa230.seq - TSA (transcriptome shotgun assembly) sequence entries, part 230.
2836. gbtsa231.seq - TSA (transcriptome shotgun assembly) sequence entries, part 231.
2837. gbtsa232.seq - TSA (transcriptome shotgun assembly) sequence entries, part 232.
2838. gbtsa233.seq - TSA (transcriptome shotgun assembly) sequence entries, part 233.
2839. gbtsa234.seq - TSA (transcriptome shotgun assembly) sequence entries, part 234.
2840. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2841. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2842. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2843. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2844. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2845. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2846. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2847. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2848. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2849. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2850. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2851. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2852. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2853. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2854. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2855. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2856. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2857. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2858. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2859. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2860. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2861. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2862. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2863. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2864. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2865. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2866. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2867. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2868. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2869. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2870. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2871. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2872. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2873. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2874. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2875. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2876. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2877. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2878. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2879. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2880. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2881. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2882. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2883. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2884. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2885. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2886. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2887. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2888. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2889. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2890. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2891. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2892. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2893. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2894. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2895. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2896. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2897. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2898. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2899. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2900. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2901. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2902. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2903. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2904. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2905. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2906. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2907. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2908. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2909. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2910. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2911. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2912. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2913. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2914. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2915. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2916. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2917. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2918. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2919. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2920. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2921. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2922. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2923. gbuna1.seq - Unannotated sequence entries, part 1.
2924. gbvrl1.seq - Viral sequence entries, part 1.
2925. gbvrl10.seq - Viral sequence entries, part 10.
2926. gbvrl11.seq - Viral sequence entries, part 11.
2927. gbvrl12.seq - Viral sequence entries, part 12.
2928. gbvrl13.seq - Viral sequence entries, part 13.
2929. gbvrl14.seq - Viral sequence entries, part 14.
2930. gbvrl15.seq - Viral sequence entries, part 15.
2931. gbvrl16.seq - Viral sequence entries, part 16.
2932. gbvrl17.seq - Viral sequence entries, part 17.
2933. gbvrl18.seq - Viral sequence entries, part 18.
2934. gbvrl19.seq - Viral sequence entries, part 19.
2935. gbvrl2.seq - Viral sequence entries, part 2.
2936. gbvrl20.seq - Viral sequence entries, part 20.
2937. gbvrl21.seq - Viral sequence entries, part 21.
2938. gbvrl22.seq - Viral sequence entries, part 22.
2939. gbvrl23.seq - Viral sequence entries, part 23.
2940. gbvrl24.seq - Viral sequence entries, part 24.
2941. gbvrl25.seq - Viral sequence entries, part 25.
2942. gbvrl26.seq - Viral sequence entries, part 26.
2943. gbvrl27.seq - Viral sequence entries, part 27.
2944. gbvrl28.seq - Viral sequence entries, part 28.
2945. gbvrl29.seq - Viral sequence entries, part 29.
2946. gbvrl3.seq - Viral sequence entries, part 3.
2947. gbvrl30.seq - Viral sequence entries, part 30.
2948. gbvrl31.seq - Viral sequence entries, part 31.
2949. gbvrl32.seq - Viral sequence entries, part 32.
2950. gbvrl33.seq - Viral sequence entries, part 33.
2951. gbvrl34.seq - Viral sequence entries, part 34.
2952. gbvrl35.seq - Viral sequence entries, part 35.
2953. gbvrl36.seq - Viral sequence entries, part 36.
2954. gbvrl37.seq - Viral sequence entries, part 37.
2955. gbvrl38.seq - Viral sequence entries, part 38.
2956. gbvrl39.seq - Viral sequence entries, part 39.
2957. gbvrl4.seq - Viral sequence entries, part 4.
2958. gbvrl40.seq - Viral sequence entries, part 40.
2959. gbvrl41.seq - Viral sequence entries, part 41.
2960. gbvrl42.seq - Viral sequence entries, part 42.
2961. gbvrl43.seq - Viral sequence entries, part 43.
2962. gbvrl44.seq - Viral sequence entries, part 44.
2963. gbvrl45.seq - Viral sequence entries, part 45.
2964. gbvrl46.seq - Viral sequence entries, part 46.
2965. gbvrl47.seq - Viral sequence entries, part 47.
2966. gbvrl48.seq - Viral sequence entries, part 48.
2967. gbvrl49.seq - Viral sequence entries, part 49.
2968. gbvrl5.seq - Viral sequence entries, part 5.
2969. gbvrl50.seq - Viral sequence entries, part 50.
2970. gbvrl51.seq - Viral sequence entries, part 51.
2971. gbvrl52.seq - Viral sequence entries, part 52.
2972. gbvrl53.seq - Viral sequence entries, part 53.
2973. gbvrl6.seq - Viral sequence entries, part 6.
2974. gbvrl7.seq - Viral sequence entries, part 7.
2975. gbvrl8.seq - Viral sequence entries, part 8.
2976. gbvrl9.seq - Viral sequence entries, part 9.
2977. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2978. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2979. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2980. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2981. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2982. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2983. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2984. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2985. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2986. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2987. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2988. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2989. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2990. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2991. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2992. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2993. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2994. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2995. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2996. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2997. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2998. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2999. gbvrt3.seq - Other vertebrate sequence entries, part 3.
3000. gbvrt30.seq - Other vertebrate sequence entries, part 30.
3001. gbvrt31.seq - Other vertebrate sequence entries, part 31.
3002. gbvrt32.seq - Other vertebrate sequence entries, part 32.
3003. gbvrt33.seq - Other vertebrate sequence entries, part 33.
3004. gbvrt34.seq - Other vertebrate sequence entries, part 34.
3005. gbvrt35.seq - Other vertebrate sequence entries, part 35.
3006. gbvrt36.seq - Other vertebrate sequence entries, part 36.
3007. gbvrt37.seq - Other vertebrate sequence entries, part 37.
3008. gbvrt38.seq - Other vertebrate sequence entries, part 38.
3009. gbvrt39.seq - Other vertebrate sequence entries, part 39.
3010. gbvrt4.seq - Other vertebrate sequence entries, part 4.
3011. gbvrt40.seq - Other vertebrate sequence entries, part 40.
3012. gbvrt41.seq - Other vertebrate sequence entries, part 41.
3013. gbvrt42.seq - Other vertebrate sequence entries, part 42.
3014. gbvrt43.seq - Other vertebrate sequence entries, part 43.
3015. gbvrt44.seq - Other vertebrate sequence entries, part 44.
3016. gbvrt45.seq - Other vertebrate sequence entries, part 45.
3017. gbvrt46.seq - Other vertebrate sequence entries, part 46.
3018. gbvrt47.seq - Other vertebrate sequence entries, part 47.
3019. gbvrt48.seq - Other vertebrate sequence entries, part 48.
3020. gbvrt49.seq - Other vertebrate sequence entries, part 49.
3021. gbvrt5.seq - Other vertebrate sequence entries, part 5.
3022. gbvrt50.seq - Other vertebrate sequence entries, part 50.
3023. gbvrt51.seq - Other vertebrate sequence entries, part 51.
3024. gbvrt52.seq - Other vertebrate sequence entries, part 52.
3025. gbvrt53.seq - Other vertebrate sequence entries, part 53.
3026. gbvrt54.seq - Other vertebrate sequence entries, part 54.
3027. gbvrt55.seq - Other vertebrate sequence entries, part 55.
3028. gbvrt56.seq - Other vertebrate sequence entries, part 56.
3029. gbvrt57.seq - Other vertebrate sequence entries, part 57.
3030. gbvrt58.seq - Other vertebrate sequence entries, part 58.
3031. gbvrt59.seq - Other vertebrate sequence entries, part 59.
3032. gbvrt6.seq - Other vertebrate sequence entries, part 6.
3033. gbvrt60.seq - Other vertebrate sequence entries, part 60.
3034. gbvrt61.seq - Other vertebrate sequence entries, part 61.
3035. gbvrt62.seq - Other vertebrate sequence entries, part 62.
3036. gbvrt63.seq - Other vertebrate sequence entries, part 63.
3037. gbvrt64.seq - Other vertebrate sequence entries, part 64.
3038. gbvrt65.seq - Other vertebrate sequence entries, part 65.
3039. gbvrt66.seq - Other vertebrate sequence entries, part 66.
3040. gbvrt67.seq - Other vertebrate sequence entries, part 67.
3041. gbvrt68.seq - Other vertebrate sequence entries, part 68.
3042. gbvrt69.seq - Other vertebrate sequence entries, part 69.
3043. gbvrt7.seq - Other vertebrate sequence entries, part 7.
3044. gbvrt70.seq - Other vertebrate sequence entries, part 70.
3045. gbvrt71.seq - Other vertebrate sequence entries, part 71.
3046. gbvrt72.seq - Other vertebrate sequence entries, part 72.
3047. gbvrt73.seq - Other vertebrate sequence entries, part 73.
3048. gbvrt74.seq - Other vertebrate sequence entries, part 74.
3049. gbvrt75.seq - Other vertebrate sequence entries, part 75.
3050. gbvrt76.seq - Other vertebrate sequence entries, part 76.
3051. gbvrt77.seq - Other vertebrate sequence entries, part 77.
3052. gbvrt78.seq - Other vertebrate sequence entries, part 78.
3053. gbvrt79.seq - Other vertebrate sequence entries, part 79.
3054. gbvrt8.seq - Other vertebrate sequence entries, part 8.
3055. gbvrt80.seq - Other vertebrate sequence entries, part 80.
3056. gbvrt81.seq - Other vertebrate sequence entries, part 81.
3057. gbvrt82.seq - Other vertebrate sequence entries, part 82.
3058. gbvrt83.seq - Other vertebrate sequence entries, part 83.
3059. gbvrt84.seq - Other vertebrate sequence entries, part 84.
3060. gbvrt85.seq - Other vertebrate sequence entries, part 85.
3061. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 224.0 flatfiles require roughly 871 GB (sequence
files only) or 871 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999069     gbbct1.seq
 212438964     gbbct10.seq
 239894254     gbbct100.seq
 244190644     gbbct101.seq
 245934548     gbbct102.seq
 244824665     gbbct103.seq
 241012404     gbbct104.seq
 241253040     gbbct105.seq
 244632881     gbbct106.seq
 247874534     gbbct107.seq
 239483634     gbbct108.seq
 248329237     gbbct109.seq
 102201125     gbbct11.seq
  58570566     gbbct110.seq
 244950777     gbbct111.seq
 246522126     gbbct112.seq
 240783673     gbbct113.seq
 242853380     gbbct114.seq
 242365577     gbbct115.seq
 242436790     gbbct116.seq
 243237447     gbbct117.seq
 244466731     gbbct118.seq
 246861818     gbbct119.seq
 245569037     gbbct12.seq
 244398726     gbbct120.seq
 239551701     gbbct121.seq
  63050800     gbbct122.seq
 241061316     gbbct123.seq
 241974689     gbbct124.seq
 247957273     gbbct125.seq
 245909858     gbbct126.seq
 243013381     gbbct127.seq
 249716160     gbbct128.seq
 240691900     gbbct129.seq
  36856569     gbbct13.seq
 234838992     gbbct130.seq
 249720387     gbbct131.seq
 179663832     gbbct132.seq
 243058380     gbbct133.seq
 241430483     gbbct134.seq
 243604903     gbbct135.seq
 247595542     gbbct136.seq
 247761927     gbbct137.seq
 249431207     gbbct138.seq
 245812740     gbbct139.seq
 248768407     gbbct14.seq
  45171391     gbbct140.seq
 244041850     gbbct141.seq
 242152958     gbbct142.seq
 245203914     gbbct143.seq
 247853655     gbbct144.seq
 244652127     gbbct145.seq
 248880100     gbbct146.seq
 249626605     gbbct147.seq
  19598343     gbbct148.seq
 241268273     gbbct149.seq
 249920251     gbbct15.seq
 242062241     gbbct150.seq
 243064193     gbbct151.seq
 247539814     gbbct152.seq
 243050086     gbbct153.seq
 246917271     gbbct154.seq
 247454514     gbbct155.seq
 158090177     gbbct156.seq
 246553114     gbbct157.seq
 244026129     gbbct158.seq
 240103193     gbbct159.seq
 248897031     gbbct16.seq
 249050572     gbbct160.seq
 249699404     gbbct161.seq
 246620321     gbbct162.seq
 247361636     gbbct163.seq
 247941212     gbbct164.seq
  34479906     gbbct165.seq
 249568669     gbbct166.seq
 248729365     gbbct167.seq
 239514245     gbbct168.seq
 241250654     gbbct169.seq
 240308267     gbbct17.seq
 246074399     gbbct170.seq
 244339032     gbbct171.seq
 244072888     gbbct172.seq
 248135600     gbbct173.seq
 223539715     gbbct174.seq
 240745573     gbbct175.seq
 242425169     gbbct176.seq
 236776712     gbbct177.seq
 247440560     gbbct178.seq
 246434412     gbbct179.seq
 236177391     gbbct18.seq
 247155956     gbbct180.seq
 249300475     gbbct181.seq
 245996023     gbbct182.seq
  90081322     gbbct183.seq
 249325367     gbbct184.seq
 249672015     gbbct185.seq
 242373605     gbbct186.seq
 242412790     gbbct187.seq
 240777660     gbbct188.seq
 242939394     gbbct189.seq
 242737867     gbbct19.seq
 249211780     gbbct190.seq
 245401080     gbbct191.seq
 247750649     gbbct192.seq
 247899331     gbbct193.seq
 247020751     gbbct194.seq
 243345223     gbbct195.seq
 249437892     gbbct196.seq
 245148592     gbbct197.seq
  61924669     gbbct198.seq
 243951361     gbbct199.seq
 242055947     gbbct2.seq
 249580497     gbbct20.seq
 240030040     gbbct200.seq
 247739431     gbbct201.seq
 245981494     gbbct202.seq
 249797544     gbbct203.seq
 248933302     gbbct204.seq
 244372923     gbbct205.seq
 238047005     gbbct206.seq
 245764715     gbbct207.seq
 249506162     gbbct208.seq
 248910775     gbbct209.seq
 249082299     gbbct21.seq
 249941673     gbbct210.seq
 243382403     gbbct211.seq
  60275392     gbbct212.seq
 244265982     gbbct213.seq
 244085681     gbbct214.seq
 249533419     gbbct215.seq
 249844671     gbbct216.seq
 247960863     gbbct217.seq
 239314822     gbbct218.seq
 244652974     gbbct219.seq
 234094073     gbbct22.seq
 229096697     gbbct220.seq
 244729496     gbbct221.seq
 241701301     gbbct222.seq
 242815608     gbbct223.seq
 249349347     gbbct224.seq
 239506612     gbbct225.seq
 240959548     gbbct226.seq
 243045049     gbbct227.seq
 248741239     gbbct228.seq
 244183457     gbbct229.seq
 242721144     gbbct23.seq
 187725665     gbbct230.seq
 243098032     gbbct231.seq
 239674336     gbbct232.seq
 245066804     gbbct233.seq
 247061176     gbbct234.seq
 245185967     gbbct235.seq
 249262897     gbbct236.seq
 246431988     gbbct237.seq
 244221188     gbbct238.seq
 243684851     gbbct239.seq
 248209535     gbbct24.seq
 109581887     gbbct240.seq
 249968996     gbbct241.seq
 246026514     gbbct242.seq
 249672481     gbbct243.seq
 243557508     gbbct244.seq
 245337490     gbbct245.seq
 239330361     gbbct246.seq
 249905147     gbbct247.seq
 245052672     gbbct248.seq
 239509861     gbbct249.seq
 235446199     gbbct25.seq
 242303777     gbbct250.seq
 249654062     gbbct251.seq
  24201832     gbbct252.seq
 238304020     gbbct253.seq
 246105675     gbbct254.seq
 237805400     gbbct255.seq
 249614804     gbbct256.seq
 246013339     gbbct257.seq
 224470333     gbbct258.seq
 247104658     gbbct259.seq
 210785348     gbbct26.seq
 244803019     gbbct260.seq
 249369301     gbbct261.seq
 246399568     gbbct262.seq
 249908602     gbbct263.seq
 239335420     gbbct264.seq
 245075201     gbbct265.seq
 249457309     gbbct266.seq
 248609332     gbbct267.seq
 247456432     gbbct268.seq
 242726271     gbbct269.seq
  21361410     gbbct27.seq
 246647471     gbbct270.seq
 247931796     gbbct271.seq
 248450619     gbbct272.seq
 248842595     gbbct273.seq
 248584759     gbbct274.seq
 243812668     gbbct275.seq
 249568869     gbbct276.seq
 244323111     gbbct277.seq
  46151823     gbbct278.seq
 245082644     gbbct279.seq
  38584442     gbbct28.seq
 248889326     gbbct280.seq
 249930862     gbbct281.seq
 248723738     gbbct282.seq
 249912231     gbbct283.seq
 240148825     gbbct284.seq
 242210244     gbbct285.seq
 167391330     gbbct286.seq
 249201063     gbbct287.seq
 245885004     gbbct288.seq
 246336319     gbbct289.seq
 238485173     gbbct29.seq
 243143148     gbbct290.seq
 245176522     gbbct291.seq
 241118436     gbbct292.seq
 174942173     gbbct293.seq
 246600840     gbbct294.seq
 248400249     gbbct295.seq
 244815797     gbbct296.seq
 239366230     gbbct297.seq
 247378384     gbbct298.seq
 239588319     gbbct299.seq
 248983483     gbbct3.seq
 242844193     gbbct30.seq
 241061131     gbbct300.seq
 247582836     gbbct301.seq
 249935747     gbbct302.seq
 241588892     gbbct303.seq
 246646358     gbbct304.seq
 242440631     gbbct305.seq
 245334049     gbbct306.seq
 216255908     gbbct307.seq
 242514780     gbbct308.seq
 248734234     gbbct309.seq
 240149683     gbbct31.seq
 245820149     gbbct310.seq
 248211113     gbbct311.seq
 245914296     gbbct312.seq
 238790681     gbbct313.seq
 247846362     gbbct314.seq
 249897021     gbbct315.seq
 136876418     gbbct316.seq
 248960476     gbbct317.seq
 241315031     gbbct318.seq
 249650848     gbbct319.seq
 246548461     gbbct32.seq
 249948849     gbbct320.seq
 240478250     gbbct321.seq
 249984747     gbbct322.seq
 240763586     gbbct323.seq
 240512073     gbbct324.seq
 248911496     gbbct325.seq
 249584014     gbbct326.seq
 246971052     gbbct327.seq
 248362147     gbbct328.seq
 242325321     gbbct329.seq
 245935466     gbbct33.seq
  13033489     gbbct330.seq
 247089915     gbbct331.seq
 247430897     gbbct332.seq
 247214547     gbbct333.seq
 246908590     gbbct334.seq
 236449424     gbbct335.seq
 248140756     gbbct336.seq
 249887021     gbbct337.seq
 195103933     gbbct338.seq
 246621485     gbbct339.seq
 249518826     gbbct34.seq
 246484709     gbbct340.seq
 246405028     gbbct341.seq
 246344957     gbbct342.seq
 245784979     gbbct343.seq
 245627215     gbbct344.seq
 245970500     gbbct345.seq
 249632070     gbbct346.seq
  65101821     gbbct347.seq
 245104598     gbbct348.seq
 242318622     gbbct349.seq
 246133996     gbbct35.seq
 249822721     gbbct350.seq
 242680990     gbbct351.seq
 246756873     gbbct352.seq
 245966795     gbbct353.seq
 239174631     gbbct354.seq
 248893196     gbbct355.seq
 247512586     gbbct356.seq
 248150165     gbbct357.seq
 248856340     gbbct358.seq
  27606323     gbbct359.seq
 242557341     gbbct36.seq
 247022890     gbbct360.seq
 243029734     gbbct361.seq
 242645628     gbbct362.seq
 248906057     gbbct363.seq
 215688724     gbbct364.seq
 249721060     gbbct365.seq
 242637561     gbbct366.seq
 244208240     gbbct367.seq
 248147811     gbbct368.seq
 244431183     gbbct369.seq
 178904831     gbbct37.seq
 241142736     gbbct370.seq
 235255090     gbbct371.seq
 249226626     gbbct372.seq
  85234625     gbbct373.seq
 246899972     gbbct374.seq
 245791502     gbbct375.seq
 242121483     gbbct376.seq
 247597004     gbbct377.seq
 246850399     gbbct378.seq
 240398154     gbbct379.seq
 249772593     gbbct38.seq
 249973359     gbbct380.seq
  15386211     gbbct381.seq
 246618731     gbbct382.seq
  59045460     gbbct383.seq
   6831071     gbbct384.seq
  14103539     gbbct385.seq
  22748338     gbbct386.seq
  44381496     gbbct387.seq
  86368394     gbbct388.seq
 168079278     gbbct389.seq
 245216747     gbbct39.seq
 249999232     gbbct390.seq
 249889732     gbbct391.seq
 245925094     gbbct392.seq
 245549346     gbbct393.seq
 248944287     gbbct394.seq
 248162642     gbbct395.seq
 245373501     gbbct396.seq
 243447783     gbbct397.seq
 249614260     gbbct398.seq
 249998838     gbbct399.seq
 248864558     gbbct4.seq
 246908906     gbbct40.seq
  12596489     gbbct400.seq
 248638081     gbbct401.seq
 244384048     gbbct402.seq
 249044924     gbbct403.seq
 249998334     gbbct404.seq
 248186358     gbbct405.seq
 250000058     gbbct406.seq
 249998266     gbbct407.seq
 226582156     gbbct408.seq
 249995292     gbbct409.seq
 248715882     gbbct41.seq
 249998727     gbbct410.seq
 249998303     gbbct411.seq
  37606586     gbbct412.seq
 249999087     gbbct413.seq
 249997472     gbbct414.seq
  82433647     gbbct415.seq
 249998884     gbbct416.seq
 249877730     gbbct417.seq
 117115355     gbbct418.seq
 249999126     gbbct419.seq
 240139156     gbbct42.seq
 225891564     gbbct420.seq
 249749914     gbbct421.seq
 249986440     gbbct422.seq
 243410181     gbbct423.seq
 247855068     gbbct424.seq
 248006174     gbbct425.seq
 235048876     gbbct426.seq
 247103658     gbbct427.seq
 249998295     gbbct428.seq
 249596867     gbbct429.seq
 247363974     gbbct43.seq
 161340851     gbbct430.seq
 247759314     gbbct431.seq
 242910695     gbbct432.seq
 237900244     gbbct433.seq
 245712341     gbbct434.seq
 248414428     gbbct435.seq
 249575409     gbbct436.seq
 248880570     gbbct437.seq
 244778047     gbbct438.seq
  71877336     gbbct439.seq
 238146940     gbbct44.seq
 245765995     gbbct440.seq
 247489156     gbbct441.seq
 244899861     gbbct442.seq
 243637735     gbbct443.seq
 242380419     gbbct444.seq
 236198153     gbbct445.seq
  28966756     gbbct446.seq
  40748749     gbbct447.seq
  66464170     gbbct448.seq
 249998277     gbbct449.seq
 248620387     gbbct45.seq
   2534520     gbbct450.seq
 249758428     gbbct46.seq
 247753957     gbbct47.seq
 246732524     gbbct48.seq
 244482410     gbbct49.seq
 249969232     gbbct5.seq
 116082187     gbbct50.seq
 245318834     gbbct51.seq
 239965684     gbbct52.seq
 243796533     gbbct53.seq
 246827033     gbbct54.seq
 249205986     gbbct55.seq
 248427261     gbbct56.seq
 245610930     gbbct57.seq
 243530947     gbbct58.seq
 249937923     gbbct59.seq
  40300291     gbbct6.seq
 247965813     gbbct60.seq
 249558828     gbbct61.seq
 243878263     gbbct62.seq
 240165452     gbbct63.seq
 249557873     gbbct64.seq
 249998380     gbbct65.seq
 242573406     gbbct66.seq
 249165910     gbbct67.seq
 246719307     gbbct68.seq
 244405644     gbbct69.seq
 236398510     gbbct7.seq
 242761774     gbbct70.seq
 249982200     gbbct71.seq
 247124168     gbbct72.seq
 244747315     gbbct73.seq
 249639495     gbbct74.seq
 247348144     gbbct75.seq
   4108412     gbbct76.seq
 244241167     gbbct77.seq
 247972852     gbbct78.seq
 249362143     gbbct79.seq
 157697252     gbbct8.seq
 240279987     gbbct80.seq
 249670077     gbbct81.seq
 247055015     gbbct82.seq
 244594662     gbbct83.seq
 249789616     gbbct84.seq
 238886164     gbbct85.seq
 248633884     gbbct86.seq
 249773968     gbbct87.seq
 247795922     gbbct88.seq
 248440102     gbbct89.seq
 246787688     gbbct9.seq
  22803063     gbbct90.seq
 245123007     gbbct91.seq
 248424203     gbbct92.seq
 244246404     gbbct93.seq
 244865592     gbbct94.seq
 248209675     gbbct95.seq
 240342508     gbbct96.seq
 241788095     gbbct97.seq
 246700557     gbbct98.seq
 249734496     gbbct99.seq
    974919     gbchg.txt
 247668030     gbcon1.seq
 249993616     gbcon10.seq
 250000102     gbcon100.seq
  48471727     gbcon101.seq
 249995058     gbcon102.seq
 249995292     gbcon103.seq
 249999081     gbcon104.seq
 249996003     gbcon105.seq
 249997161     gbcon106.seq
   9912200     gbcon107.seq
 249999865     gbcon108.seq
 249997281     gbcon109.seq
 247293795     gbcon11.seq
 249998854     gbcon110.seq
 249998474     gbcon111.seq
 187377117     gbcon112.seq
 249993476     gbcon113.seq
 249996617     gbcon114.seq
 249996794     gbcon115.seq
 249995754     gbcon116.seq
 249995024     gbcon117.seq
 114605876     gbcon118.seq
 249997526     gbcon119.seq
 246203832     gbcon12.seq
 249996436     gbcon120.seq
 249997759     gbcon121.seq
 249997192     gbcon122.seq
 249996943     gbcon123.seq
 136128497     gbcon124.seq
 249998114     gbcon125.seq
 249995914     gbcon126.seq
 249999832     gbcon127.seq
 222788052     gbcon128.seq
 173591655     gbcon129.seq
 248059138     gbcon13.seq
 249996463     gbcon130.seq
 250000239     gbcon131.seq
  45123591     gbcon132.seq
 249999603     gbcon133.seq
 249983531     gbcon134.seq
 203591373     gbcon135.seq
 199346006     gbcon136.seq
 249841737     gbcon137.seq
 249611925     gbcon138.seq
 249998936     gbcon139.seq
 244142099     gbcon14.seq
 249999162     gbcon140.seq
 249997540     gbcon141.seq
 126473604     gbcon142.seq
 250000136     gbcon143.seq
 249414186     gbcon144.seq
 244775416     gbcon145.seq
 244013501     gbcon146.seq
 249998477     gbcon147.seq
 249862330     gbcon148.seq
 249993450     gbcon149.seq
 246239190     gbcon15.seq
  85451615     gbcon150.seq
 249999726     gbcon151.seq
 249995880     gbcon152.seq
 249940060     gbcon153.seq
 249991271     gbcon154.seq
 249985806     gbcon155.seq
 249998099     gbcon156.seq
 249999517     gbcon157.seq
 249996338     gbcon158.seq
  50733734     gbcon159.seq
 247660756     gbcon16.seq
 249571796     gbcon160.seq
 250000176     gbcon161.seq
 249998570     gbcon162.seq
 250000040     gbcon163.seq
 131026604     gbcon164.seq
 249998777     gbcon165.seq
 249999227     gbcon166.seq
 249984889     gbcon167.seq
 250000231     gbcon168.seq
 249999099     gbcon169.seq
 249737056     gbcon17.seq
 249998165     gbcon170.seq
 249998848     gbcon171.seq
 163321567     gbcon172.seq
 249999170     gbcon173.seq
 250000067     gbcon174.seq
 249998022     gbcon175.seq
 249997221     gbcon176.seq
 168829507     gbcon177.seq
 250000153     gbcon178.seq
 249997963     gbcon179.seq
 249729380     gbcon18.seq
 249116844     gbcon180.seq
 249972961     gbcon181.seq
 249999719     gbcon182.seq
 249887570     gbcon183.seq
 249794164     gbcon184.seq
 249842269     gbcon185.seq
 249998535     gbcon186.seq
  66673812     gbcon187.seq
 250000186     gbcon188.seq
 249997648     gbcon189.seq
 249930591     gbcon19.seq
 249998336     gbcon190.seq
 249962518     gbcon191.seq
 250000201     gbcon192.seq
 249997666     gbcon193.seq
   3379171     gbcon194.seq
 249999760     gbcon195.seq
 249999180     gbcon196.seq
 249997731     gbcon197.seq
 249999441     gbcon198.seq
 147973187     gbcon199.seq
 249771117     gbcon2.seq
 248929822     gbcon20.seq
 249996910     gbcon200.seq
 249953516     gbcon201.seq
 249992681     gbcon202.seq
 249999676     gbcon203.seq
 249999054     gbcon204.seq
 249999066     gbcon205.seq
 249999523     gbcon206.seq
   7384293     gbcon207.seq
 249995329     gbcon208.seq
 249998874     gbcon209.seq
 245190892     gbcon21.seq
 249998513     gbcon210.seq
 249999827     gbcon211.seq
 198324129     gbcon212.seq
  44793208     gbcon213.seq
 249999960     gbcon214.seq
 249997460     gbcon215.seq
 249999952     gbcon216.seq
 249992457     gbcon217.seq
 249997971     gbcon218.seq
 177764167     gbcon219.seq
 249872423     gbcon22.seq
 249984182     gbcon220.seq
 249999721     gbcon221.seq
 249927780     gbcon222.seq
 249998933     gbcon223.seq
 249991132     gbcon224.seq
 249997185     gbcon225.seq
 152497079     gbcon226.seq
 249997803     gbcon227.seq
 249992491     gbcon228.seq
 249997847     gbcon229.seq
 249998174     gbcon23.seq
 249997197     gbcon230.seq
 216484831     gbcon231.seq
 249999114     gbcon232.seq
 249998924     gbcon233.seq
 249994103     gbcon234.seq
 200780670     gbcon235.seq
 249998900     gbcon236.seq
 249999619     gbcon237.seq
 249996195     gbcon238.seq
 249998520     gbcon239.seq
  87709929     gbcon24.seq
 249991860     gbcon240.seq
   3958814     gbcon241.seq
 249251023     gbcon242.seq
 249998464     gbcon243.seq
 249998008     gbcon244.seq
 249976487     gbcon245.seq
 249985162     gbcon246.seq
 249885603     gbcon247.seq
  92858203     gbcon248.seq
 249999094     gbcon249.seq
 249990197     gbcon25.seq
 249999464     gbcon250.seq
 250000234     gbcon251.seq
 249998082     gbcon252.seq
 151305618     gbcon253.seq
 249997409     gbcon254.seq
 249999409     gbcon255.seq
 250000017     gbcon256.seq
 249999172     gbcon257.seq
 250000253     gbcon258.seq
  84245568     gbcon259.seq
 249995972     gbcon26.seq
 249998262     gbcon260.seq
 249992859     gbcon261.seq
 249615947     gbcon262.seq
 249999025     gbcon263.seq
 249996860     gbcon264.seq
 175637906     gbcon265.seq
 249999844     gbcon266.seq
 249991507     gbcon267.seq
 249998896     gbcon268.seq
 249998776     gbcon269.seq
 249999602     gbcon27.seq
 250000091     gbcon270.seq
 104911921     gbcon271.seq
 250000006     gbcon272.seq
 249993928     gbcon273.seq
 250000212     gbcon274.seq
 249981030     gbcon275.seq
 249994604     gbcon276.seq
 104113954     gbcon277.seq
 249327116     gbcon278.seq
 249997399     gbcon279.seq
 249999838     gbcon28.seq
 249999344     gbcon280.seq
 249999564     gbcon281.seq
 184746884     gbcon282.seq
 250000025     gbcon283.seq
 249998630     gbcon284.seq
 249802308     gbcon285.seq
 249997831     gbcon286.seq
 249993757     gbcon287.seq
 249998471     gbcon288.seq
 129494379     gbcon289.seq
 249998707     gbcon29.seq
 249873034     gbcon290.seq
 249979533     gbcon291.seq
 249670066     gbcon292.seq
 249966235     gbcon293.seq
 249999947     gbcon294.seq
 249997141     gbcon295.seq
 249929697     gbcon296.seq
 191115726     gbcon297.seq
 249998940     gbcon298.seq
 249987801     gbcon299.seq
 249929057     gbcon3.seq
 249999347     gbcon30.seq
 249939952     gbcon300.seq
 249992035     gbcon301.seq
 249919359     gbcon302.seq
 249998674     gbcon303.seq
  55227763     gbcon304.seq
 249989790     gbcon305.seq
 249999707     gbcon306.seq
 249997458     gbcon307.seq
 250000197     gbcon308.seq
 249637220     gbcon309.seq
  81247390     gbcon31.seq
 249723877     gbcon310.seq
 249998781     gbcon311.seq
  14398034     gbcon312.seq
 250000253     gbcon313.seq
 250000174     gbcon314.seq
 250000096     gbcon315.seq
 249248548     gbcon316.seq
 249728950     gbcon317.seq
 249962225     gbcon318.seq
 249984503     gbcon319.seq
 249998890     gbcon32.seq
 249997295     gbcon320.seq
 165024350     gbcon321.seq
 249999458     gbcon322.seq
 249998177     gbcon323.seq
 249473350     gbcon324.seq
 249996447     gbcon325.seq
 125802579     gbcon326.seq
 249560188     gbcon327.seq
 249996458     gbcon328.seq
 249999193     gbcon329.seq
 249999804     gbcon33.seq
 249998147     gbcon330.seq
 249998835     gbcon331.seq
 249992753     gbcon332.seq
 249998198     gbcon333.seq
  75643595     gbcon334.seq
 249999069     gbcon335.seq
 249786810     gbcon336.seq
 249996790     gbcon337.seq
 249998963     gbcon338.seq
 249993799     gbcon339.seq
 249999148     gbcon34.seq
 249994707     gbcon340.seq
 250000183     gbcon341.seq
 249996098     gbcon342.seq
 250000228     gbcon343.seq
 249998314     gbcon344.seq
 223470775     gbcon345.seq
 250000041     gbcon346.seq
 249998616     gbcon347.seq
 249999761     gbcon348.seq
 249999436     gbcon349.seq
 249999869     gbcon35.seq
  37638463     gbcon350.seq
 249999246     gbcon351.seq
 249998030     gbcon352.seq
 249947846     gbcon353.seq
 249972136     gbcon354.seq
 249999603     gbcon355.seq
 249949789     gbcon356.seq
 249999907     gbcon357.seq
 141132016     gbcon358.seq
 249998792     gbcon359.seq
 247507218     gbcon36.seq
 249999289     gbcon360.seq
 249999796     gbcon361.seq
  80388456     gbcon362.seq
 248844640     gbcon37.seq
 249981802     gbcon38.seq
  38588250     gbcon39.seq
 249994905     gbcon4.seq
 249997284     gbcon40.seq
 249483126     gbcon41.seq
 125744383     gbcon42.seq
 126402123     gbcon43.seq
 249991267     gbcon44.seq
 249999217     gbcon45.seq
 249999517     gbcon46.seq
 249997898     gbcon47.seq
  26019784     gbcon48.seq
 249999520     gbcon49.seq
 249996532     gbcon5.seq
 250000158     gbcon50.seq
 249997942     gbcon51.seq
 249996661     gbcon52.seq
 249999447     gbcon53.seq
 197802191     gbcon54.seq
 249995009     gbcon55.seq
 249998243     gbcon56.seq
 249997153     gbcon57.seq
 249998312     gbcon58.seq
 249999774     gbcon59.seq
 249997726     gbcon6.seq
 249998166     gbcon60.seq
  41929642     gbcon61.seq
 249997971     gbcon62.seq
 249998523     gbcon63.seq
 249994641     gbcon64.seq
 249997127     gbcon65.seq
 249999662     gbcon66.seq
  27021264     gbcon67.seq
 249996783     gbcon68.seq
 249999817     gbcon69.seq
 178915949     gbcon7.seq
 249998382     gbcon70.seq
 249995556     gbcon71.seq
 249997081     gbcon72.seq
  20620805     gbcon73.seq
 249994608     gbcon74.seq
 249995334     gbcon75.seq
 249996443     gbcon76.seq
 249996717     gbcon77.seq
 249997080     gbcon78.seq
 135388982     gbcon79.seq
 249992520     gbcon8.seq
 249999204     gbcon80.seq
 249998450     gbcon81.seq
 249998272     gbcon82.seq
 249997459     gbcon83.seq
 176584001     gbcon84.seq
 249996314     gbcon85.seq
 249999452     gbcon86.seq
 249994925     gbcon87.seq
 249997508     gbcon88.seq
 238783867     gbcon89.seq
 249909238     gbcon9.seq
 249999844     gbcon90.seq
 249998048     gbcon91.seq
 250000106     gbcon92.seq
 249995283     gbcon93.seq
 249993884     gbcon94.seq
  85705140     gbcon95.seq
 249995498     gbcon96.seq
 249995014     gbcon97.seq
 249999777     gbcon98.seq
 249995148     gbcon99.seq
   3449997     gbdel.txt
 249999032     gbenv1.seq
 249999164     gbenv10.seq
 249998207     gbenv100.seq
  38690598     gbenv101.seq
 249996816     gbenv11.seq
 249998116     gbenv12.seq
  53561329     gbenv13.seq
 249998802     gbenv14.seq
 249999945     gbenv15.seq
 249997811     gbenv16.seq
 249999344     gbenv17.seq
 249997826     gbenv18.seq
 249999128     gbenv19.seq
 249997475     gbenv2.seq
 249999306     gbenv20.seq
 245126374     gbenv21.seq
 249999224     gbenv22.seq
 249999745     gbenv23.seq
 249998250     gbenv24.seq
 250000087     gbenv25.seq
 173476550     gbenv26.seq
 249997969     gbenv27.seq
 249999621     gbenv28.seq
 250000075     gbenv29.seq
 250000068     gbenv3.seq
 250000213     gbenv30.seq
 249999904     gbenv31.seq
 249999790     gbenv32.seq
  69852264     gbenv33.seq
 249997840     gbenv34.seq
 249998513     gbenv35.seq
 249999714     gbenv36.seq
 249999258     gbenv37.seq
 181614002     gbenv38.seq
 249998572     gbenv39.seq
 249997510     gbenv4.seq
 249998447     gbenv40.seq
 250000150     gbenv41.seq
 249998474     gbenv42.seq
 249997151     gbenv43.seq
 249999466     gbenv44.seq
  46311757     gbenv45.seq
 249999334     gbenv46.seq
 249999510     gbenv47.seq
 250000048     gbenv48.seq
 249999792     gbenv49.seq
 245057440     gbenv5.seq
 192014688     gbenv50.seq
 249998834     gbenv51.seq
 249999763     gbenv52.seq
 249998634     gbenv53.seq
 249998248     gbenv54.seq
 249999537     gbenv55.seq
  83146800     gbenv56.seq
 249999397     gbenv57.seq
 249997909     gbenv58.seq
 249949873     gbenv59.seq
 249998667     gbenv6.seq
 249999669     gbenv60.seq
 249999207     gbenv61.seq
 213232151     gbenv62.seq
 250000199     gbenv63.seq
 249999966     gbenv64.seq
 249998413     gbenv65.seq
 249999532     gbenv66.seq
 249997177     gbenv67.seq
  84586250     gbenv68.seq
 249997037     gbenv69.seq
 249998833     gbenv7.seq
 249998435     gbenv70.seq
 249957283     gbenv71.seq
 249999108     gbenv72.seq
 249998861     gbenv73.seq
 143569062     gbenv74.seq
 249999787     gbenv75.seq
 249999420     gbenv76.seq
 250000137     gbenv77.seq
 249999331     gbenv78.seq
 249998660     gbenv79.seq
 213642445     gbenv8.seq
  89224017     gbenv80.seq
 249998162     gbenv81.seq
 249999769     gbenv82.seq
 249998247     gbenv83.seq
 249998758     gbenv84.seq
 234482887     gbenv85.seq
 249998867     gbenv86.seq
 249999765     gbenv87.seq
 250000206     gbenv88.seq
 249998237     gbenv89.seq
 249998115     gbenv9.seq
 249999450     gbenv90.seq
 127142899     gbenv91.seq
 249998473     gbenv92.seq
 249999349     gbenv93.seq
 249997881     gbenv94.seq
 249999465     gbenv95.seq
 206613589     gbenv96.seq
 249998299     gbenv97.seq
 249998591     gbenv98.seq
 249998925     gbenv99.seq
 524289430     gbest1.seq
 524291173     gbest10.seq
 524291890     gbest100.seq
 524288823     gbest101.seq
 524290171     gbest102.seq
 524290630     gbest103.seq
 324648067     gbest104.seq
 524290182     gbest105.seq
 524290859     gbest106.seq
 524290670     gbest107.seq
 381846367     gbest108.seq
 385036642     gbest109.seq
 524288745     gbest11.seq
 379178955     gbest110.seq
 379762555     gbest111.seq
 376681647     gbest112.seq
 380970518     gbest113.seq
 385571277     gbest114.seq
 383979816     gbest115.seq
 383046098     gbest116.seq
 379514962     gbest117.seq
 402947158     gbest118.seq
 488301143     gbest119.seq
 524289527     gbest12.seq
 524290518     gbest120.seq
 524289816     gbest121.seq
 524290318     gbest122.seq
 524289958     gbest123.seq
 448193301     gbest124.seq
 524289155     gbest125.seq
 524289162     gbest126.seq
 524289532     gbest127.seq
 524289963     gbest128.seq
 524291859     gbest129.seq
 118127874     gbest13.seq
 524290289     gbest130.seq
 524289155     gbest131.seq
 524290021     gbest132.seq
 524292039     gbest133.seq
 524289917     gbest134.seq
 524291752     gbest135.seq
 524291752     gbest136.seq
 263868490     gbest137.seq
 524290561     gbest138.seq
 524289028     gbest139.seq
 524290433     gbest14.seq
 524292748     gbest140.seq
 524290709     gbest141.seq
 524291776     gbest142.seq
 524290716     gbest143.seq
 524291381     gbest144.seq
 524292796     gbest145.seq
 524292004     gbest146.seq
 524290883     gbest147.seq
 524290126     gbest148.seq
 524292204     gbest149.seq
 524290300     gbest15.seq
 524291816     gbest150.seq
 454010589     gbest151.seq
 524290037     gbest152.seq
 524291562     gbest153.seq
 524290377     gbest154.seq
 524290692     gbest155.seq
 524289108     gbest156.seq
 524290429     gbest157.seq
 524289835     gbest158.seq
 524295949     gbest159.seq
 524290173     gbest16.seq
 524290972     gbest160.seq
 524290785     gbest161.seq
 524289649     gbest162.seq
 524289310     gbest163.seq
 211832086     gbest164.seq
 524290340     gbest165.seq
 524289486     gbest166.seq
 524288990     gbest167.seq
 524290463     gbest168.seq
 524289100     gbest169.seq
 524290145     gbest17.seq
 524289534     gbest170.seq
 524291834     gbest171.seq
 524289006     gbest172.seq
 524289543     gbest173.seq
 524290582     gbest174.seq
 524288886     gbest175.seq
 524289976     gbest176.seq
 524290354     gbest177.seq
  65409596     gbest178.seq
 524290703     gbest179.seq
 524292257     gbest18.seq
 524290849     gbest180.seq
 524289166     gbest181.seq
 524289609     gbest182.seq
 524289672     gbest183.seq
 524289921     gbest184.seq
 524288758     gbest185.seq
 524289905     gbest186.seq
 524292305     gbest187.seq
 524290064     gbest188.seq
 524290527     gbest189.seq
 524288867     gbest19.seq
 524291424     gbest190.seq
 431628261     gbest191.seq
 524289597     gbest192.seq
 524291674     gbest193.seq
 524292530     gbest194.seq
 524291621     gbest195.seq
 524291368     gbest196.seq
 524288998     gbest197.seq
 524289462     gbest198.seq
 524290268     gbest199.seq
 524289738     gbest2.seq
 524289925     gbest20.seq
 524291088     gbest200.seq
 524290724     gbest201.seq
 524290499     gbest202.seq
 524289347     gbest203.seq
 524290912     gbest204.seq
  14082549     gbest205.seq
 524289211     gbest206.seq
 524289653     gbest207.seq
 524290915     gbest208.seq
 524289675     gbest209.seq
 524290113     gbest21.seq
 524291229     gbest210.seq
 524290700     gbest211.seq
 524291174     gbest212.seq
 524292251     gbest213.seq
 524290658     gbest214.seq
 524290630     gbest215.seq
 444670755     gbest216.seq
 524290389     gbest217.seq
 524289226     gbest218.seq
 524291079     gbest219.seq
 484312301     gbest22.seq
 524292671     gbest220.seq
 524293373     gbest221.seq
 524290977     gbest222.seq
 524290330     gbest223.seq
 524290789     gbest224.seq
 524290197     gbest225.seq
 524289865     gbest226.seq
 524291504     gbest227.seq
 524289954     gbest228.seq
 431947476     gbest229.seq
 491199140     gbest23.seq
 524289496     gbest230.seq
 524288796     gbest231.seq
 524291403     gbest232.seq
 524292539     gbest233.seq
 524289172     gbest234.seq
 524292440     gbest235.seq
 524290921     gbest236.seq
 524288822     gbest237.seq
 524289640     gbest238.seq
 524289434     gbest239.seq
 501203885     gbest24.seq
 524291738     gbest240.seq
 524291234     gbest241.seq
 524290150     gbest242.seq
 524290337     gbest243.seq
 222299949     gbest244.seq
 524291601     gbest245.seq
 524290788     gbest246.seq
 524291003     gbest247.seq
 524288902     gbest248.seq
 524293387     gbest249.seq
 309252037     gbest25.seq
 524289513     gbest250.seq
 524290435     gbest251.seq
 512253858     gbest252.seq
 524290854     gbest253.seq
 524291449     gbest254.seq
 524288949     gbest255.seq
 313896267     gbest256.seq
 524289314     gbest257.seq
 524289374     gbest258.seq
 524289908     gbest259.seq
 524289024     gbest26.seq
 524290169     gbest260.seq
 524289670     gbest261.seq
 524290703     gbest262.seq
 524289748     gbest263.seq
 524291212     gbest264.seq
 524289135     gbest265.seq
 524289377     gbest266.seq
 190795518     gbest267.seq
 524288976     gbest268.seq
 524289033     gbest269.seq
 524291216     gbest27.seq
 524289326     gbest270.seq
 524290860     gbest271.seq
 524288802     gbest272.seq
 524289458     gbest273.seq
 524290760     gbest274.seq
 524290582     gbest275.seq
 524290211     gbest276.seq
 524289407     gbest277.seq
 524289047     gbest278.seq
 342122043     gbest279.seq
 524292236     gbest28.seq
 524289993     gbest280.seq
 524289813     gbest281.seq
 524290174     gbest282.seq
 524290363     gbest283.seq
 524290641     gbest284.seq
 524288938     gbest285.seq
 524289248     gbest286.seq
 524291607     gbest287.seq
 524289063     gbest288.seq
 524291578     gbest289.seq
 524290814     gbest29.seq
 524289976     gbest290.seq
 260072484     gbest291.seq
 524291855     gbest292.seq
 524289414     gbest293.seq
 524290796     gbest294.seq
 524290976     gbest295.seq
 524290225     gbest296.seq
 524292402     gbest297.seq
 524290375     gbest298.seq
 524290309     gbest299.seq
 488661507     gbest3.seq
 524288748     gbest30.seq
 524289255     gbest300.seq
 524289430     gbest301.seq
 466911068     gbest302.seq
 299213792     gbest303.seq
 472922302     gbest304.seq
 470054216     gbest305.seq
 524290102     gbest306.seq
 524289951     gbest307.seq
 524291257     gbest308.seq
 524291344     gbest309.seq
 524290378     gbest31.seq
 524290025     gbest310.seq
 524291643     gbest311.seq
 524291189     gbest312.seq
 524289520     gbest313.seq
 524291760     gbest314.seq
 524290580     gbest315.seq
 354140774     gbest316.seq
 524290430     gbest317.seq
 524291117     gbest318.seq
 524289038     gbest319.seq
 524290348     gbest32.seq
 524289888     gbest320.seq
 524291010     gbest321.seq
 524292218     gbest322.seq
 524289898     gbest323.seq
 524288766     gbest324.seq
 524289660     gbest325.seq
 524291631     gbest326.seq
 524292141     gbest327.seq
 513976083     gbest328.seq
 514480894     gbest329.seq
 524289596     gbest33.seq
 202913170     gbest330.seq
 524288948     gbest331.seq
 524291034     gbest332.seq
 524289129     gbest333.seq
 524290979     gbest334.seq
 524289671     gbest335.seq
 524290928     gbest336.seq
 493815248     gbest337.seq
 524292852     gbest338.seq
 524289009     gbest339.seq
 503553696     gbest34.seq
 524293270     gbest340.seq
 524289807     gbest341.seq
 524288969     gbest342.seq
 524291948     gbest343.seq
 307692832     gbest344.seq
 524291387     gbest345.seq
 524290463     gbest346.seq
 524289630     gbest347.seq
 524291647     gbest348.seq
 524288891     gbest349.seq
 485111278     gbest35.seq
 524289821     gbest350.seq
 509093357     gbest351.seq
 524291437     gbest352.seq
 524290389     gbest353.seq
 524294240     gbest354.seq
 524290840     gbest355.seq
 524290848     gbest356.seq
 524291710     gbest357.seq
 524291512     gbest358.seq
 113592414     gbest359.seq
 486901104     gbest36.seq
 524290210     gbest360.seq
 524288879     gbest361.seq
 524290447     gbest362.seq
 524290447     gbest363.seq
 524291508     gbest364.seq
 524291635     gbest365.seq
 524288843     gbest366.seq
 524291398     gbest367.seq
 524289007     gbest368.seq
 524290124     gbest369.seq
 485902151     gbest37.seq
 524289474     gbest370.seq
  36041360     gbest371.seq
 524290829     gbest372.seq
 524288913     gbest373.seq
 524291007     gbest374.seq
 524290836     gbest375.seq
 524288891     gbest376.seq
 524290949     gbest377.seq
 484767374     gbest378.seq
 524290177     gbest379.seq
 480376634     gbest38.seq
 524291293     gbest380.seq
 524291605     gbest381.seq
 524289970     gbest382.seq
 243253917     gbest383.seq
 524290442     gbest384.seq
 524291377     gbest385.seq
 524290224     gbest386.seq
 524291939     gbest387.seq
 524290480     gbest388.seq
 524290121     gbest389.seq
 485067229     gbest39.seq
 524290696     gbest390.seq
 524290655     gbest391.seq
 524290001     gbest392.seq
 524291287     gbest393.seq
 132254603     gbest394.seq
 524290369     gbest395.seq
 524288973     gbest396.seq
 524292018     gbest397.seq
 524289517     gbest398.seq
 524288946     gbest399.seq
 524290058     gbest4.seq
 118176941     gbest40.seq
 524288912     gbest400.seq
 524289998     gbest401.seq
 524291145     gbest402.seq
 524290927     gbest403.seq
 524290030     gbest404.seq
 524291339     gbest405.seq
 524290968     gbest406.seq
 370569797     gbest407.seq
 524292092     gbest408.seq
 524289779     gbest409.seq
 524291523     gbest41.seq
 524289249     gbest410.seq
 524288810     gbest411.seq
 524291123     gbest412.seq
 524291200     gbest413.seq
 524290364     gbest414.seq
 524289073     gbest415.seq
 524293148     gbest416.seq
 524291464     gbest417.seq
 524290207     gbest418.seq
 524289888     gbest419.seq
 522434125     gbest42.seq
 494381784     gbest420.seq
 524288827     gbest421.seq
 524291355     gbest422.seq
 524290407     gbest423.seq
 524291855     gbest424.seq
 524290262     gbest425.seq
 524290350     gbest426.seq
 524292098     gbest427.seq
 524291159     gbest428.seq
 524291978     gbest429.seq
 524288847     gbest43.seq
 524291843     gbest430.seq
 524289689     gbest431.seq
 524291671     gbest432.seq
 524289643     gbest433.seq
 524292189     gbest434.seq
 162889262     gbest435.seq
 524289116     gbest436.seq
 524290821     gbest437.seq
 524293300     gbest438.seq
 524290536     gbest439.seq
 524290735     gbest44.seq
 524292157     gbest440.seq
 524290920     gbest441.seq
 524289983     gbest442.seq
 524290294     gbest443.seq
 524291218     gbest444.seq
 524289994     gbest445.seq
 524289647     gbest446.seq
 524290228     gbest447.seq
  64669217     gbest448.seq
 524291774     gbest449.seq
 524289090     gbest45.seq
 524290496     gbest450.seq
 524289393     gbest451.seq
 524290873     gbest452.seq
 524290491     gbest453.seq
 524288763     gbest454.seq
 524290630     gbest455.seq
 524289090     gbest456.seq
 524290640     gbest457.seq
 524289241     gbest458.seq
 524289880     gbest459.seq
 524290337     gbest46.seq
  29008489     gbest460.seq
 524290259     gbest461.seq
 524289551     gbest462.seq
 524289239     gbest463.seq
 524288860     gbest464.seq
 524290530     gbest465.seq
 524289579     gbest466.seq
 524290733     gbest467.seq
 524289041     gbest468.seq
 524290622     gbest469.seq
 524289843     gbest47.seq
 524290679     gbest470.seq
 524288978     gbest471.seq
   8114889     gbest472.seq
 524290488     gbest473.seq
 524288951     gbest474.seq
 524291848     gbest475.seq
 524290486     gbest476.seq
 524289092     gbest477.seq
 524290772     gbest478.seq
 524291835     gbest479.seq
 524290488     gbest48.seq
 524291988     gbest480.seq
 524289336     gbest481.seq
 524288749     gbest482.seq
 524288783     gbest483.seq
 465786881     gbest484.seq
 285729756     gbest485.seq
 524291892     gbest49.seq
 524291687     gbest5.seq
 524290090     gbest50.seq
 524290113     gbest51.seq
 524288762     gbest52.seq
 524291139     gbest53.seq
 210632137     gbest54.seq
 524291597     gbest55.seq
 524289822     gbest56.seq
 524288917     gbest57.seq
 524292103     gbest58.seq
 524290271     gbest59.seq
 524288727     gbest6.seq
 524291889     gbest60.seq
 524290321     gbest61.seq
 524291206     gbest62.seq
 524290754     gbest63.seq
 524291042     gbest64.seq
 524289957     gbest65.seq
 524291162     gbest66.seq
 419145188     gbest67.seq
 524292606     gbest68.seq
 524290936     gbest69.seq
 524289159     gbest7.seq
 524290332     gbest70.seq
 524289304     gbest71.seq
 524289523     gbest72.seq
 524291325     gbest73.seq
 524290682     gbest74.seq
 524293202     gbest75.seq
 524291680     gbest76.seq
 524288996     gbest77.seq
 524292082     gbest78.seq
 524290493     gbest79.seq
 524290679     gbest8.seq
 144599937     gbest80.seq
 524291008     gbest81.seq
 524290808     gbest82.seq
 524289493     gbest83.seq
 524290982     gbest84.seq
 524290971     gbest85.seq
 524291331     gbest86.seq
 524289963     gbest87.seq
 524288924     gbest88.seq
 524288936     gbest89.seq
 524290307     gbest9.seq
 524290319     gbest90.seq
 524288910     gbest91.seq
 420697563     gbest92.seq
 524290826     gbest93.seq
 524290381     gbest94.seq
 524291074     gbest95.seq
 524291258     gbest96.seq
 524292340     gbest97.seq
 524289344     gbest98.seq
 524288940     gbest99.seq
 524289548     gbgss1.seq
 524291663     gbgss10.seq
 524289867     gbgss100.seq
 524289266     gbgss101.seq
 524290051     gbgss102.seq
 524289370     gbgss103.seq
 385476398     gbgss104.seq
 524289922     gbgss105.seq
 524288765     gbgss106.seq
 524290347     gbgss107.seq
 524289587     gbgss108.seq
 524290291     gbgss109.seq
 524290558     gbgss11.seq
 524288985     gbgss110.seq
 524289095     gbgss111.seq
 524288850     gbgss112.seq
 524289375     gbgss113.seq
 524290606     gbgss114.seq
 524289829     gbgss115.seq
  20623638     gbgss116.seq
 524289817     gbgss117.seq
 524290249     gbgss118.seq
 524288973     gbgss119.seq
 524290305     gbgss12.seq
 524291084     gbgss120.seq
 524289124     gbgss121.seq
 524290159     gbgss122.seq
 524291045     gbgss123.seq
 524289822     gbgss124.seq
 524292239     gbgss125.seq
 524290773     gbgss126.seq
 524289515     gbgss127.seq
 524289527     gbgss128.seq
 169719051     gbgss129.seq
 524289813     gbgss13.seq
 524290077     gbgss130.seq
 524288802     gbgss131.seq
 524291286     gbgss132.seq
 524288726     gbgss133.seq
 524289268     gbgss134.seq
 524291744     gbgss135.seq
 524289542     gbgss136.seq
 524290402     gbgss137.seq
 524290544     gbgss138.seq
 496334783     gbgss139.seq
 524290131     gbgss14.seq
 494767826     gbgss140.seq
 160418501     gbgss141.seq
 524288856     gbgss142.seq
 524290673     gbgss143.seq
 524291154     gbgss144.seq
 524289018     gbgss145.seq
 524290553     gbgss146.seq
 524289739     gbgss147.seq
 524289183     gbgss148.seq
 524290902     gbgss149.seq
 524289551     gbgss15.seq
 524289657     gbgss150.seq
 524288881     gbgss151.seq
 294120774     gbgss152.seq
 524289220     gbgss153.seq
 524289911     gbgss154.seq
 524290815     gbgss155.seq
 524290219     gbgss156.seq
 524290349     gbgss157.seq
 524288779     gbgss158.seq
 524290398     gbgss159.seq
 524291042     gbgss16.seq
 524290684     gbgss160.seq
 524289110     gbgss161.seq
 524289554     gbgss162.seq
 524289592     gbgss163.seq
 524290379     gbgss164.seq
 100839462     gbgss165.seq
 524289377     gbgss166.seq
 524291804     gbgss167.seq
 524290653     gbgss168.seq
 524289944     gbgss169.seq
 524290192     gbgss17.seq
 524289399     gbgss170.seq
 524289120     gbgss171.seq
 524290969     gbgss172.seq
 524290092     gbgss173.seq
 343606418     gbgss174.seq
 249999307     gbgss175.seq
 249999803     gbgss176.seq
 249999034     gbgss177.seq
 250000188     gbgss178.seq
  27270082     gbgss179.seq
 524288910     gbgss18.seq
 250000220     gbgss180.seq
 249999312     gbgss181.seq
 249997128     gbgss182.seq
 249998262     gbgss183.seq
 219536183     gbgss184.seq
 250000046     gbgss185.seq
 249997736     gbgss186.seq
 249999841     gbgss187.seq
 250000005     gbgss188.seq
 189705997     gbgss189.seq
 276907075     gbgss19.seq
 249999911     gbgss190.seq
 249997779     gbgss191.seq
 249998992     gbgss192.seq
 249997543     gbgss193.seq
 249998328     gbgss194.seq
  66166938     gbgss195.seq
 249998062     gbgss196.seq
    542128     gbgss197.seq
  80022020     gbgss198.seq
 250000228     gbgss199.seq
 524289207     gbgss2.seq
 524289061     gbgss20.seq
 249999996     gbgss200.seq
  84490531     gbgss201.seq
 249998087     gbgss202.seq
 249999221     gbgss203.seq
 249998781     gbgss204.seq
 197045515     gbgss205.seq
 249999644     gbgss206.seq
 250000078     gbgss207.seq
 249998943     gbgss208.seq
 241194397     gbgss209.seq
 524290692     gbgss21.seq
 249998895     gbgss210.seq
 249998646     gbgss211.seq
 249999899     gbgss212.seq
 239478749     gbgss213.seq
 249999622     gbgss214.seq
 249996865     gbgss215.seq
 249999649     gbgss216.seq
 250000226     gbgss217.seq
 121271948     gbgss218.seq
 249999870     gbgss219.seq
 524288746     gbgss22.seq
 250000164     gbgss220.seq
 249998650     gbgss221.seq
 249998378     gbgss222.seq
  86638471     gbgss223.seq
 249999180     gbgss224.seq
 250000196     gbgss225.seq
 249998742     gbgss226.seq
 249998926     gbgss227.seq
 249999544     gbgss228.seq
 137865838     gbgss229.seq
 524290705     gbgss23.seq
 249999577     gbgss230.seq
 249999925     gbgss231.seq
 249999323     gbgss232.seq
 249997632     gbgss233.seq
  79228653     gbgss234.seq
 249997675     gbgss235.seq
 249998339     gbgss236.seq
 249999331     gbgss237.seq
 249999245     gbgss238.seq
 249997693     gbgss239.seq
 524290126     gbgss24.seq
 249997728     gbgss240.seq
  99502593     gbgss241.seq
 249998155     gbgss242.seq
 249999580     gbgss243.seq
 249999271     gbgss244.seq
  52447926     gbgss245.seq
  53076689     gbgss246.seq
 249998109     gbgss247.seq
 249998073     gbgss248.seq
 249999880     gbgss249.seq
 524290310     gbgss25.seq
 249999725     gbgss250.seq
 249998744     gbgss251.seq
 249997664     gbgss252.seq
 211852026     gbgss253.seq
 249997890     gbgss254.seq
 249999836     gbgss255.seq
 249998514     gbgss256.seq
 249998986     gbgss257.seq
  21316342     gbgss258.seq
 249997567     gbgss259.seq
 524290464     gbgss26.seq
 249999132     gbgss260.seq
 249996572     gbgss261.seq
 249998435     gbgss262.seq
 249997631     gbgss263.seq
 249998992     gbgss264.seq
 181964370     gbgss265.seq
 249998672     gbgss266.seq
 250000165     gbgss267.seq
 250000243     gbgss268.seq
 221699337     gbgss269.seq
 524290278     gbgss27.seq
 249999134     gbgss270.seq
 249998851     gbgss271.seq
 249998700     gbgss272.seq
 249999839     gbgss273.seq
 249999513     gbgss274.seq
 249999543     gbgss275.seq
 145308699     gbgss276.seq
 249997149     gbgss277.seq
 249998191     gbgss278.seq
 249999087     gbgss279.seq
 524290203     gbgss28.seq
 249998744     gbgss280.seq
 227218278     gbgss281.seq
 249997931     gbgss282.seq
 249997185     gbgss283.seq
 249999114     gbgss284.seq
 249999909     gbgss285.seq
 249998098     gbgss286.seq
 116181294     gbgss287.seq
 249999837     gbgss288.seq
 249998408     gbgss289.seq
 524289630     gbgss29.seq
 249998054     gbgss290.seq
 249997635     gbgss291.seq
 215534679     gbgss292.seq
 249998609     gbgss293.seq
 249998604     gbgss294.seq
 249999576     gbgss295.seq
 249998662     gbgss296.seq
  85129549     gbgss297.seq
 249999096     gbgss298.seq
 249998187     gbgss299.seq
 524289224     gbgss3.seq
 524289734     gbgss30.seq
 249997655     gbgss300.seq
 249997711     gbgss301.seq
 249998095     gbgss302.seq
 249998419     gbgss303.seq
 133314224     gbgss304.seq
  37530326     gbgss31.seq
 524290692     gbgss32.seq
 524289403     gbgss33.seq
 524290861     gbgss34.seq
 524289081     gbgss35.seq
 524290990     gbgss36.seq
 524289827     gbgss37.seq
 524290494     gbgss38.seq
 489536509     gbgss39.seq
 524289495     gbgss4.seq
 524290131     gbgss40.seq
 524290844     gbgss41.seq
 524288954     gbgss42.seq
  19398427     gbgss43.seq
 524291495     gbgss44.seq
 524290249     gbgss45.seq
 524291200     gbgss46.seq
 524288917     gbgss47.seq
 216278345     gbgss48.seq
 524291261     gbgss49.seq
 151331340     gbgss5.seq
 524289547     gbgss50.seq
 524290300     gbgss51.seq
 524288815     gbgss52.seq
 524289068     gbgss53.seq
 524288850     gbgss54.seq
 524290747     gbgss55.seq
 524291151     gbgss56.seq
 524289539     gbgss57.seq
 524290108     gbgss58.seq
 524291562     gbgss59.seq
 524291287     gbgss6.seq
  21383019     gbgss60.seq
 524291753     gbgss61.seq
 524289183     gbgss62.seq
 524291682     gbgss63.seq
 452316992     gbgss64.seq
 524289532     gbgss65.seq
 524292013     gbgss66.seq
 524291234     gbgss67.seq
 524289331     gbgss68.seq
 524289862     gbgss69.seq
 524288948     gbgss7.seq
 524290833     gbgss70.seq
 524290794     gbgss71.seq
 524291780     gbgss72.seq
 524290521     gbgss73.seq
 524289223     gbgss74.seq
 524289628     gbgss75.seq
 524290381     gbgss76.seq
  22124421     gbgss77.seq
 524291311     gbgss78.seq
 524291294     gbgss79.seq
 524288897     gbgss8.seq
 524288996     gbgss80.seq
 524289231     gbgss81.seq
 524291575     gbgss82.seq
 524292193     gbgss83.seq
 524291698     gbgss84.seq
 524291177     gbgss85.seq
 524289126     gbgss86.seq
 524290930     gbgss87.seq
 524291368     gbgss88.seq
 359882343     gbgss89.seq
 524291546     gbgss9.seq
 524290979     gbgss90.seq
 524290405     gbgss91.seq
 524291434     gbgss92.seq
 524289231     gbgss93.seq
 524289414     gbgss94.seq
 524292071     gbgss95.seq
 524288954     gbgss96.seq
 524291454     gbgss97.seq
 524291567     gbgss98.seq
 524289220     gbgss99.seq
 249997993     gbhtc1.seq
 249996645     gbhtc10.seq
 249997355     gbhtc11.seq
 187633685     gbhtc12.seq
 249999169     gbhtc13.seq
 249999170     gbhtc14.seq
 152669326     gbhtc15.seq
 249995478     gbhtc2.seq
 249991894     gbhtc3.seq
 249985970     gbhtc4.seq
 249999048     gbhtc5.seq
 249987440     gbhtc6.seq
 249996035     gbhtc7.seq
  80798178     gbhtc8.seq
 249998827     gbhtc9.seq
 249919103     gbhtg1.seq
 249935336     gbhtg10.seq
 249898506     gbhtg100.seq
 249852504     gbhtg101.seq
 249535042     gbhtg102.seq
 249888102     gbhtg103.seq
   3688130     gbhtg104.seq
 249799093     gbhtg105.seq
 249998294     gbhtg106.seq
 249949907     gbhtg107.seq
 249916550     gbhtg108.seq
 249978605     gbhtg109.seq
    799292     gbhtg11.seq
 249896195     gbhtg110.seq
 167433043     gbhtg111.seq
 249850870     gbhtg112.seq
 249939795     gbhtg113.seq
 249869598     gbhtg114.seq
 249906673     gbhtg115.seq
 249768916     gbhtg116.seq
 249967908     gbhtg117.seq
 249944117     gbhtg118.seq
 219057303     gbhtg119.seq
 249867576     gbhtg12.seq
 249986066     gbhtg120.seq
 249896587     gbhtg121.seq
 249935778     gbhtg122.seq
 249900357     gbhtg123.seq
 249891139     gbhtg124.seq
 249797886     gbhtg125.seq
 249847034     gbhtg126.seq
 249920794     gbhtg127.seq
 249887387     gbhtg128.seq
 249875072     gbhtg129.seq
 249953697     gbhtg13.seq
 249927268     gbhtg130.seq
 111142351     gbhtg131.seq
 249872326     gbhtg132.seq
 249895390     gbhtg133.seq
 249844710     gbhtg134.seq
 249988579     gbhtg135.seq
 249862660     gbhtg136.seq
 135815749     gbhtg137.seq
 249905628     gbhtg138.seq
 249808330     gbhtg139.seq
 249995099     gbhtg14.seq
 249958007     gbhtg140.seq
 249697484     gbhtg141.seq
 249816953     gbhtg142.seq
 134304697     gbhtg143.seq
 249939319     gbhtg144.seq
 249796848     gbhtg145.seq
 249816843     gbhtg146.seq
 249887715     gbhtg147.seq
 249907646     gbhtg148.seq
 249922755     gbhtg149.seq
 249938964     gbhtg15.seq
 249831405     gbhtg150.seq
 249900380     gbhtg151.seq
 249955029     gbhtg152.seq
 249849581     gbhtg153.seq
 242314578     gbhtg154.seq
 249750336     gbhtg16.seq
 249774726     gbhtg17.seq
 249714731     gbhtg18.seq
 249957759     gbhtg19.seq
 249965174     gbhtg2.seq
 249931734     gbhtg20.seq
 235850971     gbhtg21.seq
 249743613     gbhtg22.seq
 249849760     gbhtg23.seq
 249968489     gbhtg24.seq
 249904378     gbhtg25.seq
 249743777     gbhtg26.seq
 249872278     gbhtg27.seq
 249943100     gbhtg28.seq
 249821972     gbhtg29.seq
 249990925     gbhtg3.seq
 249974297     gbhtg30.seq
 225307913     gbhtg31.seq
 249988250     gbhtg32.seq
 249721384     gbhtg33.seq
 249910646     gbhtg34.seq
 249900069     gbhtg35.seq
 249839995     gbhtg36.seq
 249796553     gbhtg37.seq
 249749194     gbhtg38.seq
 249608093     gbhtg39.seq
 249912663     gbhtg4.seq
 249819463     gbhtg40.seq
 224341330     gbhtg41.seq
 249988697     gbhtg42.seq
 249929499     gbhtg43.seq
 249878159     gbhtg44.seq
 249894493     gbhtg45.seq
 249780350     gbhtg46.seq
 249512030     gbhtg47.seq
 249848882     gbhtg48.seq
 249876862     gbhtg49.seq
 249892800     gbhtg5.seq
 249885096     gbhtg50.seq
 234805407     gbhtg51.seq
 249992060     gbhtg52.seq
 249969706     gbhtg53.seq
 249777162     gbhtg54.seq
 249928077     gbhtg55.seq
 249738038     gbhtg56.seq
  18488541     gbhtg57.seq
 249846209     gbhtg58.seq
 249813703     gbhtg59.seq
 249976698     gbhtg6.seq
 249982730     gbhtg60.seq
 249908507     gbhtg61.seq
 225116490     gbhtg62.seq
 249869194     gbhtg63.seq
 249892574     gbhtg64.seq
 249989957     gbhtg65.seq
 249828950     gbhtg66.seq
 249951490     gbhtg67.seq
  15793409     gbhtg68.seq
 249969504     gbhtg69.seq
 249792412     gbhtg7.seq
 249868114     gbhtg70.seq
 249949360     gbhtg71.seq
 249752681     gbhtg72.seq
 223399956     gbhtg73.seq
 249932036     gbhtg74.seq
 249871175     gbhtg75.seq
 249835275     gbhtg76.seq
 249935773     gbhtg77.seq
 235157893     gbhtg78.seq
 249863959     gbhtg79.seq
 249808933     gbhtg8.seq
 249962382     gbhtg80.seq
 249850658     gbhtg81.seq
 249876924     gbhtg82.seq
 202286158     gbhtg83.seq
 249854884     gbhtg84.seq
 249932273     gbhtg85.seq
 249851460     gbhtg86.seq
 249870703     gbhtg87.seq
 206005872     gbhtg88.seq
 249874212     gbhtg89.seq
 249937013     gbhtg9.seq
 249860356     gbhtg90.seq
 249764128     gbhtg91.seq
 249875964     gbhtg92.seq
 194399433     gbhtg93.seq
 249959164     gbhtg94.seq
 249968993     gbhtg95.seq
 249861046     gbhtg96.seq
 249785036     gbhtg97.seq
 161649769     gbhtg98.seq
 249859601     gbhtg99.seq
 249996924     gbinv1.seq
 249996863     gbinv10.seq
 220912860     gbinv100.seq
 249981399     gbinv101.seq
 249990983     gbinv102.seq
 249997696     gbinv103.seq
 249998148     gbinv104.seq
 249995586     gbinv105.seq
 249999464     gbinv106.seq
 249999737     gbinv107.seq
  75240537     gbinv108.seq
 249987806     gbinv109.seq
 246455194     gbinv11.seq
 249988271     gbinv110.seq
 249949268     gbinv111.seq
 249993955     gbinv112.seq
 249997413     gbinv113.seq
 249972564     gbinv114.seq
 249997588     gbinv115.seq
  86895465     gbinv116.seq
 249970386     gbinv117.seq
 249920309     gbinv118.seq
 249982791     gbinv119.seq
 249934189     gbinv12.seq
 249988791     gbinv120.seq
 249994013     gbinv121.seq
 249997824     gbinv122.seq
 249991376     gbinv123.seq
 249998656     gbinv124.seq
 249999016     gbinv125.seq
 148200629     gbinv126.seq
 250000225     gbinv127.seq
 249995035     gbinv128.seq
 249997553     gbinv129.seq
 226516876     gbinv13.seq
 249915287     gbinv130.seq
 249990767     gbinv131.seq
 249992342     gbinv132.seq
 247880203     gbinv133.seq
  44990217     gbinv134.seq
 249976624     gbinv135.seq
 249927190     gbinv136.seq
 249993435     gbinv137.seq
 249991798     gbinv138.seq
  26858693     gbinv139.seq
 248469141     gbinv14.seq
 249997218     gbinv140.seq
 249998241     gbinv141.seq
  58216986     gbinv142.seq
 249999169     gbinv143.seq
 249988375     gbinv144.seq
 249989803     gbinv145.seq
 249999700     gbinv146.seq
 144731450     gbinv147.seq
 249999293     gbinv148.seq
 249999529     gbinv149.seq
 249998011     gbinv15.seq
 249999498     gbinv150.seq
 249998461     gbinv151.seq
 172341792     gbinv152.seq
 249999188     gbinv153.seq
 249363279     gbinv154.seq
 239262608     gbinv155.seq
 249049351     gbinv156.seq
 249968615     gbinv157.seq
 248463534     gbinv158.seq
 249998276     gbinv159.seq
 249999425     gbinv16.seq
 249973304     gbinv160.seq
  15944973     gbinv161.seq
  47313794     gbinv17.seq
 249997906     gbinv18.seq
 249999072     gbinv19.seq
 249990731     gbinv2.seq
 249999509     gbinv20.seq
 153532046     gbinv21.seq
 249393983     gbinv22.seq
 247814048     gbinv23.seq
 249995028     gbinv24.seq
 249965819     gbinv25.seq
 238665918     gbinv26.seq
 228612344     gbinv27.seq
 175319053     gbinv28.seq
 249999598     gbinv29.seq
 249891316     gbinv3.seq
 249997445     gbinv30.seq
 218240279     gbinv31.seq
 249999371     gbinv32.seq
 249999092     gbinv33.seq
 249999076     gbinv34.seq
 249999387     gbinv35.seq
 165885174     gbinv36.seq
 249997276     gbinv37.seq
 249997722     gbinv38.seq
 249998459     gbinv39.seq
 200055865     gbinv4.seq
 249999829     gbinv40.seq
 173045629     gbinv41.seq
 249998835     gbinv42.seq
 250000039     gbinv43.seq
 249999189     gbinv44.seq
 249999564     gbinv45.seq
 113495191     gbinv46.seq
 249998240     gbinv47.seq
 249998328     gbinv48.seq
 249999248     gbinv49.seq
 249999427     gbinv5.seq
 249999805     gbinv50.seq
  93004294     gbinv51.seq
 249998545     gbinv52.seq
 249997567     gbinv53.seq
 249997359     gbinv54.seq
 249999471     gbinv55.seq
 249999944     gbinv56.seq
 249997320     gbinv57.seq
 249997633     gbinv58.seq
 249996914     gbinv59.seq
 249995717     gbinv6.seq
 249998783     gbinv60.seq
  20546191     gbinv61.seq
 249997908     gbinv62.seq
 249997411     gbinv63.seq
 249996103     gbinv64.seq
 249999433     gbinv65.seq
 213333973     gbinv66.seq
 250000117     gbinv67.seq
 249999290     gbinv68.seq
 249998469     gbinv69.seq
 249998265     gbinv7.seq
 250000179     gbinv70.seq
 249997602     gbinv71.seq
 249995597     gbinv72.seq
 128171676     gbinv73.seq
 249999804     gbinv74.seq
 249999334     gbinv75.seq
 249998579     gbinv76.seq
 195993243     gbinv77.seq
 249991369     gbinv78.seq
 249993034     gbinv79.seq
 249998959     gbinv8.seq
 249389122     gbinv80.seq
 249962220     gbinv81.seq
 249968289     gbinv82.seq
 249896214     gbinv83.seq
 249930162     gbinv84.seq
 217071619     gbinv85.seq
 249989875     gbinv86.seq
 249995216     gbinv87.seq
 249994945     gbinv88.seq
 249999207     gbinv89.seq
 133044371     gbinv9.seq
  49757515     gbinv90.seq
 249964309     gbinv91.seq
 249970247     gbinv92.seq
 249990524     gbinv93.seq
 249954734     gbinv94.seq
 249988030     gbinv95.seq
 249976719     gbinv96.seq
 249995127     gbinv97.seq
 249998096     gbinv98.seq
 250000264     gbinv99.seq
 249980631     gbmam1.seq
 338653931     gbmam10.seq
 315434407     gbmam11.seq
 162425847     gbmam12.seq
 150157334     gbmam13.seq
 159032538     gbmam14.seq
 136269230     gbmam15.seq
 122412955     gbmam16.seq
 248159396     gbmam17.seq
 202955071     gbmam18.seq
 208310866     gbmam19.seq
 249999796     gbmam2.seq
 209752346     gbmam20.seq
 197940543     gbmam21.seq
 230561841     gbmam22.seq
 220222444     gbmam23.seq
 123191120     gbmam24.seq
 191446156     gbmam25.seq
   9943428     gbmam26.seq
  43989127     gbmam27.seq
  91322474     gbmam28.seq
  88810709     gbmam29.seq
  84178532     gbmam3.seq
   6365611     gbmam30.seq
  20918349     gbmam31.seq
 250000193     gbmam32.seq
 199534125     gbmam33.seq
 249998737     gbmam34.seq
 250000234     gbmam35.seq
 249998934     gbmam36.seq
 249998666     gbmam37.seq
 211572850     gbmam38.seq
 115495486     gbmam39.seq
  82808026     gbmam4.seq
  71294825     gbmam5.seq
  22570875     gbmam6.seq
   1268605     gbmam7.seq
   2477678     gbmam8.seq
 375834657     gbmam9.seq
  20716899     gbnew.txt
 250000031     gbpat1.seq
 249999403     gbpat10.seq
 249998963     gbpat100.seq
 249999641     gbpat101.seq
 249999965     gbpat102.seq
 249999455     gbpat103.seq
 137267099     gbpat104.seq
 250000015     gbpat105.seq
 249999153     gbpat106.seq
 249888679     gbpat107.seq
 249749771     gbpat108.seq
 250000144     gbpat109.seq
 168177634     gbpat11.seq
 179847106     gbpat110.seq
 250000018     gbpat111.seq
 249999494     gbpat112.seq
 249998309     gbpat113.seq
  70384586     gbpat114.seq
 250000230     gbpat115.seq
 249999933     gbpat116.seq
 249690376     gbpat117.seq
 249999993     gbpat118.seq
 249999110     gbpat119.seq
 249997518     gbpat12.seq
  55704446     gbpat120.seq
 249999350     gbpat121.seq
 249999805     gbpat122.seq
 249999831     gbpat123.seq
 249998300     gbpat124.seq
 144919044     gbpat125.seq
 249999927     gbpat126.seq
 249999834     gbpat127.seq
 226235203     gbpat128.seq
 249966117     gbpat129.seq
 249999130     gbpat13.seq
 249976912     gbpat130.seq
 249999729     gbpat131.seq
 249998903     gbpat132.seq
 249998034     gbpat133.seq
  59559800     gbpat134.seq
 249995969     gbpat135.seq
 249995285     gbpat136.seq
 249998740     gbpat137.seq
 249998430     gbpat138.seq
 249999159     gbpat139.seq
 249999336     gbpat14.seq
   9607227     gbpat140.seq
 249999998     gbpat141.seq
 249998686     gbpat142.seq
 249999576     gbpat143.seq
 249998604     gbpat144.seq
  36785302     gbpat145.seq
 249995259     gbpat146.seq
 249999971     gbpat147.seq
 249999853     gbpat148.seq
 224419737     gbpat149.seq
 249997775     gbpat15.seq
 249999338     gbpat150.seq
 249999887     gbpat151.seq
 249999570     gbpat152.seq
  75491672     gbpat153.seq
 249999318     gbpat154.seq
 249999451     gbpat155.seq
 249998979     gbpat156.seq
  55092198     gbpat157.seq
 249996414     gbpat158.seq
 249998540     gbpat159.seq
 250000031     gbpat16.seq
 249999681     gbpat160.seq
 250000018     gbpat161.seq
 249999173     gbpat162.seq
 249997487     gbpat163.seq
 202372659     gbpat164.seq
 250000181     gbpat165.seq
 249999529     gbpat166.seq
 249999529     gbpat167.seq
 205870569     gbpat168.seq
 249999373     gbpat169.seq
  66933105     gbpat17.seq
 249958947     gbpat170.seq
 250000002     gbpat171.seq
   2094359     gbpat172.seq
 249998827     gbpat173.seq
 249996412     gbpat174.seq
 249999688     gbpat175.seq
 249997996     gbpat176.seq
  81953257     gbpat177.seq
 249999232     gbpat178.seq
 249999933     gbpat179.seq
 249998753     gbpat18.seq
 249999839     gbpat180.seq
 248237643     gbpat181.seq
 249998773     gbpat182.seq
 249999109     gbpat183.seq
 249998937     gbpat184.seq
 250000075     gbpat185.seq
 248566246     gbpat186.seq
 249998056     gbpat187.seq
 230155279     gbpat188.seq
 250000241     gbpat189.seq
 249999427     gbpat19.seq
 249998973     gbpat190.seq
 249997114     gbpat191.seq
 250000182     gbpat192.seq
 249999162     gbpat193.seq
 249999322     gbpat194.seq
 249998762     gbpat195.seq
  85324625     gbpat196.seq
 249998863     gbpat197.seq
 249999914     gbpat198.seq
 250000229     gbpat199.seq
 249998973     gbpat2.seq
 250000082     gbpat20.seq
 250000119     gbpat200.seq
 207986626     gbpat201.seq
 249999087     gbpat202.seq
 249857891     gbpat203.seq
 249994546     gbpat204.seq
 249998110     gbpat205.seq
 174015117     gbpat206.seq
 249988465     gbpat207.seq
 249998595     gbpat208.seq
 249999040     gbpat209.seq
 249998272     gbpat21.seq
 249998808     gbpat210.seq
 249999587     gbpat211.seq
 249995171     gbpat212.seq
   8454549     gbpat213.seq
 250000236     gbpat214.seq
 249658203     gbpat215.seq
 249999850     gbpat216.seq
 132772208     gbpat217.seq
 249999627     gbpat218.seq
 249997972     gbpat219.seq
 177836873     gbpat22.seq
 249997638     gbpat220.seq
 249999208     gbpat221.seq
 249995993     gbpat222.seq
 249997662     gbpat223.seq
 250000159     gbpat224.seq
 249999079     gbpat225.seq
  56242944     gbpat226.seq
 249999673     gbpat227.seq
 249964291     gbpat228.seq
 249998983     gbpat229.seq
 249999107     gbpat23.seq
 249999334     gbpat230.seq
 208421430     gbpat231.seq
 249999402     gbpat232.seq
 249999571     gbpat233.seq
 249999476     gbpat234.seq
 249999480     gbpat235.seq
  57206881     gbpat236.seq
 250000157     gbpat237.seq
 249997433     gbpat238.seq
 249995648     gbpat239.seq
 249992261     gbpat24.seq
 249998465     gbpat240.seq
 249999640     gbpat241.seq
 237297771     gbpat242.seq
 249999761     gbpat243.seq
 249997553     gbpat244.seq
 249999303     gbpat245.seq
 249999260     gbpat246.seq
  25799234     gbpat247.seq
 249999362     gbpat248.seq
 249995981     gbpat249.seq
 249999952     gbpat25.seq
 250000122     gbpat250.seq
 135116688     gbpat251.seq
 249980978     gbpat252.seq
 249999989     gbpat253.seq
 250000225     gbpat254.seq
 250000225     gbpat255.seq
 148497177     gbpat256.seq
 249998868     gbpat257.seq
 250000114     gbpat258.seq
 249999574     gbpat259.seq
 249999524     gbpat26.seq
  64423759     gbpat260.seq
 249999027     gbpat261.seq
 249989619     gbpat262.seq
 249998962     gbpat263.seq
 249981586     gbpat264.seq
 249999491     gbpat265.seq
 159538878     gbpat266.seq
 249999492     gbpat267.seq
 249998152     gbpat268.seq
 249999028     gbpat269.seq
  62266891     gbpat27.seq
 249988141     gbpat270.seq
 125941966     gbpat271.seq
 249998964     gbpat272.seq
 249990860     gbpat273.seq
 249997470     gbpat274.seq
 249996372     gbpat275.seq
 249997766     gbpat276.seq
 249996061     gbpat277.seq
 249998866     gbpat278.seq
 249999129     gbpat279.seq
 249998364     gbpat28.seq
 169812818     gbpat280.seq
 249998851     gbpat281.seq
 249999544     gbpat282.seq
 249996879     gbpat283.seq
 175271748     gbpat284.seq
 249998765     gbpat285.seq
 249998705     gbpat286.seq
 249999731     gbpat287.seq
 249999750     gbpat288.seq
 249999311     gbpat289.seq
 249998207     gbpat29.seq
 249838548     gbpat290.seq
 151965654     gbpat291.seq
 250000044     gbpat292.seq
 249998417     gbpat293.seq
 250000050     gbpat294.seq
 249999451     gbpat295.seq
  83914691     gbpat296.seq
 249997533     gbpat297.seq
 249999411     gbpat298.seq
 249998841     gbpat299.seq
 250000047     gbpat3.seq
 249998557     gbpat30.seq
 249998625     gbpat300.seq
 250000073     gbpat301.seq
 249998617     gbpat302.seq
 100300068     gbpat303.seq
 250000263     gbpat304.seq
 249990805     gbpat305.seq
 249996345     gbpat306.seq
 249994047     gbpat307.seq
 249996809     gbpat308.seq
 249995243     gbpat309.seq
 249999676     gbpat31.seq
 249995186     gbpat310.seq
 249998638     gbpat311.seq
 250000225     gbpat312.seq
  51686095     gbpat313.seq
 250000037     gbpat314.seq
 249999061     gbpat315.seq
 249998078     gbpat316.seq
 249997681     gbpat317.seq
 249999685     gbpat318.seq
 249997899     gbpat319.seq
 249998921     gbpat32.seq
 249999992     gbpat320.seq
 250000114     gbpat321.seq
 249999758     gbpat322.seq
  55952199     gbpat323.seq
 171736156     gbpat33.seq
 250000074     gbpat34.seq
 249749246     gbpat35.seq
 249999961     gbpat36.seq
 249999114     gbpat37.seq
 249999373     gbpat38.seq
 249994694     gbpat39.seq
 249999549     gbpat4.seq
 249883806     gbpat40.seq
  91529381     gbpat41.seq
 250000006     gbpat42.seq
 249907830     gbpat43.seq
 249999932     gbpat44.seq
 249999604     gbpat45.seq
 249999794     gbpat46.seq
 249764903     gbpat47.seq
 249999760     gbpat48.seq
 246849562     gbpat49.seq
  61168666     gbpat5.seq
 161792602     gbpat50.seq
 249999538     gbpat51.seq
 249999804     gbpat52.seq
 249999700     gbpat53.seq
 249999646     gbpat54.seq
 213206429     gbpat55.seq
 250000030     gbpat56.seq
 250000009     gbpat57.seq
 249999551     gbpat58.seq
 155999999     gbpat59.seq
 249999674     gbpat6.seq
 249999753     gbpat60.seq
 249997634     gbpat61.seq
 249998771     gbpat62.seq
 249999622     gbpat63.seq
 125163564     gbpat64.seq
 249996525     gbpat65.seq
 249999556     gbpat66.seq
 249998622     gbpat67.seq
 249997829     gbpat68.seq
 249998957     gbpat69.seq
 249999576     gbpat7.seq
 249999687     gbpat70.seq
 135705288     gbpat71.seq
 249998906     gbpat72.seq
 249999313     gbpat73.seq
 250000176     gbpat74.seq
 248923221     gbpat75.seq
 248123146     gbpat76.seq
 249394834     gbpat77.seq
 248798213     gbpat78.seq
 249999922     gbpat79.seq
 249996053     gbpat8.seq
 141050219     gbpat80.seq
 250000182     gbpat81.seq
 249999208     gbpat82.seq
 250000165     gbpat83.seq
 249999811     gbpat84.seq
 249999674     gbpat85.seq
 249999155     gbpat86.seq
  87741306     gbpat87.seq
 249925543     gbpat88.seq
 250000176     gbpat89.seq
 249999672     gbpat9.seq
 249999921     gbpat90.seq
 250000210     gbpat91.seq
 250000095     gbpat92.seq
 250000146     gbpat93.seq
 130989890     gbpat94.seq
 249999339     gbpat95.seq
 249999366     gbpat96.seq
 249999447     gbpat97.seq
 249999901     gbpat98.seq
 184979714     gbpat99.seq
 249964823     gbphg1.seq
 249937399     gbphg2.seq
 249922270     gbphg3.seq
 188025060     gbphg4.seq
 250000170     gbpln1.seq
 154367009     gbpln10.seq
  56485858     gbpln100.seq
 217279823     gbpln101.seq
 171793647     gbpln102.seq
 197391133     gbpln103.seq
 177950617     gbpln104.seq
 196456252     gbpln105.seq
 189037039     gbpln106.seq
 220764606     gbpln107.seq
 227204479     gbpln108.seq
 224027156     gbpln109.seq
 249995968     gbpln11.seq
 248372205     gbpln110.seq
 188710737     gbpln111.seq
 249999168     gbpln112.seq
 249999083     gbpln113.seq
  56951633     gbpln114.seq
 249713674     gbpln115.seq
 249996955     gbpln116.seq
 249999225     gbpln117.seq
 249998977     gbpln118.seq
 249999557     gbpln119.seq
 249997444     gbpln12.seq
  13655776     gbpln120.seq
 249999473     gbpln121.seq
 247951112     gbpln122.seq
 249999767     gbpln123.seq
 250000008     gbpln124.seq
  84447498     gbpln125.seq
 249997897     gbpln126.seq
 249999819     gbpln127.seq
 249995973     gbpln128.seq
 212965669     gbpln129.seq
 249998987     gbpln13.seq
 250000058     gbpln130.seq
 249999410     gbpln131.seq
 249999862     gbpln132.seq
 159939526     gbpln133.seq
 249939815     gbpln134.seq
 249993266     gbpln135.seq
 249998668     gbpln136.seq
 129712756     gbpln137.seq
 249996781     gbpln138.seq
 249997622     gbpln139.seq
 249960170     gbpln14.seq
 249864546     gbpln140.seq
 249998889     gbpln141.seq
 249999378     gbpln142.seq
 249998394     gbpln143.seq
  20808964     gbpln144.seq
 249997755     gbpln145.seq
 249998005     gbpln146.seq
 249996837     gbpln147.seq
 249999221     gbpln148.seq
 249830434     gbpln149.seq
 222903078     gbpln15.seq
   6181554     gbpln150.seq
 249727582     gbpln151.seq
 249998662     gbpln152.seq
 249997527     gbpln153.seq
 242129141     gbpln154.seq
 240376439     gbpln155.seq
  88477255     gbpln156.seq
 220745640     gbpln157.seq
 224206313     gbpln158.seq
 225878572     gbpln159.seq
 249999890     gbpln16.seq
 236598142     gbpln160.seq
 248860794     gbpln161.seq
 249842480     gbpln162.seq
 247391123     gbpln163.seq
 249400302     gbpln164.seq
 249999909     gbpln165.seq
 250000146     gbpln166.seq
 249999189     gbpln167.seq
  72639138     gbpln168.seq
 249990442     gbpln17.seq
 249965339     gbpln18.seq
  18729995     gbpln19.seq
 249998548     gbpln2.seq
 241005532     gbpln20.seq
 249891686     gbpln21.seq
 248162352     gbpln22.seq
 249625779     gbpln23.seq
 240030578     gbpln24.seq
 231415812     gbpln25.seq
 232512418     gbpln26.seq
 235239775     gbpln27.seq
 199014935     gbpln28.seq
 201562827     gbpln29.seq
 249945207     gbpln3.seq
 249997616     gbpln30.seq
  95355565     gbpln31.seq
 249998397     gbpln32.seq
 133187712     gbpln33.seq
 203984489     gbpln34.seq
  84488595     gbpln35.seq
 191574833     gbpln36.seq
 228663904     gbpln37.seq
 243276497     gbpln38.seq
 249608485     gbpln39.seq
 249894807     gbpln4.seq
 249676853     gbpln40.seq
 249998559     gbpln41.seq
 249590406     gbpln42.seq
 137796452     gbpln43.seq
 249130516     gbpln44.seq
 249951075     gbpln45.seq
 248595782     gbpln46.seq
 248796588     gbpln47.seq
 249414934     gbpln48.seq
 249604556     gbpln49.seq
 249895660     gbpln5.seq
 103698915     gbpln50.seq
 249349086     gbpln51.seq
 247427951     gbpln52.seq
 243771043     gbpln53.seq
 219791144     gbpln54.seq
 249020201     gbpln55.seq
 134817676     gbpln56.seq
 243505752     gbpln57.seq
 202810877     gbpln58.seq
 214739175     gbpln59.seq
 249993849     gbpln6.seq
 243089376     gbpln60.seq
 249507061     gbpln61.seq
 114980120     gbpln62.seq
 219564350     gbpln63.seq
 226272538     gbpln64.seq
 231030529     gbpln65.seq
 222973880     gbpln66.seq
 223404503     gbpln67.seq
 249245515     gbpln68.seq
 244994778     gbpln69.seq
 249859542     gbpln7.seq
 233654211     gbpln70.seq
 175879654     gbpln71.seq
 249658962     gbpln72.seq
  88257604     gbpln73.seq
 164935257     gbpln74.seq
  40081560     gbpln75.seq
  74904969     gbpln76.seq
 249996143     gbpln77.seq
 249999750     gbpln78.seq
 249998624     gbpln79.seq
 249824040     gbpln8.seq
 106126041     gbpln80.seq
 249999048     gbpln81.seq
 250000026     gbpln82.seq
 249997592     gbpln83.seq
 249997670     gbpln84.seq
 138258463     gbpln85.seq
 249998108     gbpln86.seq
 249896642     gbpln87.seq
 249997467     gbpln88.seq
 249853205     gbpln89.seq
 249999794     gbpln9.seq
 249336722     gbpln90.seq
 249991088     gbpln91.seq
 249999838     gbpln92.seq
  32158017     gbpln93.seq
 249999518     gbpln94.seq
  47405994     gbpln95.seq
 210393091     gbpln96.seq
 247507231     gbpln97.seq
 185606757     gbpln98.seq
 997331397     gbpln99.seq
 147957577     gbpri1.seq
 249829449     gbpri10.seq
 143951048     gbpri11.seq
 249938389     gbpri12.seq
 249864786     gbpri13.seq
 249870085     gbpri14.seq
 249923234     gbpri15.seq
 249847949     gbpri16.seq
 249851601     gbpri17.seq
 249741155     gbpri18.seq
 249904267     gbpri19.seq
 249963726     gbpri2.seq
 249931437     gbpri20.seq
 249975812     gbpri21.seq
 249641383     gbpri22.seq
 249889870     gbpri23.seq
 131749196     gbpri24.seq
 162644090     gbpri25.seq
 249995364     gbpri26.seq
 244711168     gbpri27.seq
 249973486     gbpri28.seq
 249983047     gbpri29.seq
 249829536     gbpri3.seq
 249946931     gbpri30.seq
 249783882     gbpri31.seq
 249750397     gbpri32.seq
 249840243     gbpri33.seq
 249990396     gbpri34.seq
 249992646     gbpri35.seq
  18804857     gbpri36.seq
 249998989     gbpri37.seq
 249959057     gbpri38.seq
 249410811     gbpri39.seq
 249974303     gbpri4.seq
 249985648     gbpri40.seq
 249731470     gbpri41.seq
 179355556     gbpri42.seq
 249999218     gbpri43.seq
 249972950     gbpri44.seq
 249987431     gbpri45.seq
 249997465     gbpri46.seq
 249987422     gbpri47.seq
  66313137     gbpri48.seq
 249969314     gbpri49.seq
 249917217     gbpri5.seq
 249986117     gbpri50.seq
 249993455     gbpri51.seq
  11475656     gbpri52.seq
 314294173     gbpri53.seq
 258775295     gbpri54.seq
 268666434     gbpri55.seq
 249982332     gbpri56.seq
 249950774     gbpri57.seq
 157136738     gbpri58.seq
 249853936     gbpri6.seq
 249750943     gbpri7.seq
 249904713     gbpri8.seq
 249823999     gbpri9.seq
    471277     gbrel.txt
 249961450     gbrod1.seq
 249869153     gbrod10.seq
  80603868     gbrod11.seq
 249853719     gbrod12.seq
 249993397     gbrod13.seq
 249952018     gbrod14.seq
 249790966     gbrod15.seq
 249791212     gbrod16.seq
 249877726     gbrod17.seq
 249887975     gbrod18.seq
 249013510     gbrod19.seq
 249878749     gbrod2.seq
 249735523     gbrod20.seq
 249777714     gbrod21.seq
 204220110     gbrod22.seq
 249998277     gbrod23.seq
 249999073     gbrod24.seq
 249966765     gbrod25.seq
 249996939     gbrod26.seq
 249995280     gbrod27.seq
 249997495     gbrod28.seq
 249998404     gbrod29.seq
 249846336     gbrod3.seq
 239566088     gbrod30.seq
 249956268     gbrod4.seq
 249723115     gbrod5.seq
 249894551     gbrod6.seq
 249813115     gbrod7.seq
 249947122     gbrod8.seq
 249984733     gbrod9.seq
 249997746     gbsts1.seq
 249997088     gbsts10.seq
 206741382     gbsts11.seq
 249998430     gbsts12.seq
 249999169     gbsts13.seq
 250000011     gbsts14.seq
 249998492     gbsts15.seq
  21531082     gbsts16.seq
 249999089     gbsts17.seq
 249999734     gbsts18.seq
 249999322     gbsts19.seq
 249999681     gbsts2.seq
 183106314     gbsts20.seq
 249998943     gbsts3.seq
 249996346     gbsts4.seq
  37833138     gbsts5.seq
 249998732     gbsts6.seq
 249995639     gbsts7.seq
 249996228     gbsts8.seq
 249996787     gbsts9.seq
 249999242     gbsyn1.seq
 144036119     gbsyn10.seq
 249995066     gbsyn2.seq
 249955829     gbsyn3.seq
 249947789     gbsyn4.seq
 249945624     gbsyn5.seq
 249961720     gbsyn6.seq
 249999585     gbsyn7.seq
 249997094     gbsyn8.seq
 249999934     gbsyn9.seq
 249999675     gbtsa1.seq
  50318331     gbtsa10.seq
 249998031     gbtsa100.seq
 249999022     gbtsa101.seq
 249994258     gbtsa102.seq
 250000145     gbtsa103.seq
 249999147     gbtsa104.seq
  99482523     gbtsa105.seq
 249998116     gbtsa106.seq
 249999006     gbtsa107.seq
 249999406     gbtsa108.seq
 249998157     gbtsa109.seq
 249995943     gbtsa11.seq
 249998792     gbtsa110.seq
 249999835     gbtsa111.seq
 221404369     gbtsa112.seq
 250000072     gbtsa113.seq
 250000158     gbtsa114.seq
 250000198     gbtsa115.seq
 249999986     gbtsa116.seq
 250000096     gbtsa117.seq
   9941672     gbtsa118.seq
 249997842     gbtsa119.seq
 249997183     gbtsa12.seq
 249998997     gbtsa120.seq
 249999686     gbtsa121.seq
 215403410     gbtsa122.seq
 249998009     gbtsa123.seq
 249999478     gbtsa124.seq
 250000220     gbtsa125.seq
 249999818     gbtsa126.seq
 249999718     gbtsa127.seq
 249997636     gbtsa128.seq
 164931384     gbtsa129.seq
 249994887     gbtsa13.seq
 249997163     gbtsa130.seq
 249996135     gbtsa131.seq
 249997577     gbtsa132.seq
 250000175     gbtsa133.seq
 249999451     gbtsa134.seq
 250000157     gbtsa135.seq
   2518352     gbtsa136.seq
 249997865     gbtsa137.seq
 249996502     gbtsa138.seq
 249997490     gbtsa139.seq
 249998618     gbtsa14.seq
 249999799     gbtsa140.seq
 131360517     gbtsa141.seq
 249994731     gbtsa142.seq
 249998059     gbtsa143.seq
 249999383     gbtsa144.seq
 249999200     gbtsa145.seq
  30978866     gbtsa146.seq
 249998453     gbtsa147.seq
 249998596     gbtsa148.seq
 249998496     gbtsa149.seq
 249998003     gbtsa15.seq
 249996461     gbtsa150.seq
 249998524     gbtsa151.seq
 249995978     gbtsa152.seq
 249999139     gbtsa153.seq
 249999266     gbtsa154.seq
  45676156     gbtsa155.seq
 249998921     gbtsa156.seq
 249999118     gbtsa157.seq
 249998545     gbtsa158.seq
 250000026     gbtsa159.seq
  16855572     gbtsa16.seq
 249997741     gbtsa160.seq
 249999330     gbtsa161.seq
  84607457     gbtsa162.seq
 249999313     gbtsa163.seq
 249998187     gbtsa164.seq
 249998633     gbtsa165.seq
 139220115     gbtsa166.seq
 249996774     gbtsa167.seq
 249996438     gbtsa168.seq
 249999007     gbtsa169.seq
 249998023     gbtsa17.seq
 249994445     gbtsa170.seq
 249992518     gbtsa171.seq
 249999858     gbtsa172.seq
 208363603     gbtsa173.seq
 249998828     gbtsa174.seq
 249996630     gbtsa175.seq
 249993564     gbtsa176.seq
 249994891     gbtsa177.seq
 250000106     gbtsa178.seq
 249997818     gbtsa179.seq
 249996915     gbtsa18.seq
 230583152     gbtsa180.seq
 249998515     gbtsa181.seq
 249999189     gbtsa182.seq
 249997207     gbtsa183.seq
 249996939     gbtsa184.seq
 249994703     gbtsa185.seq
 249995475     gbtsa186.seq
 249996599     gbtsa187.seq
 154687296     gbtsa188.seq
 249999558     gbtsa189.seq
 249997721     gbtsa19.seq
 249997141     gbtsa190.seq
 249999121     gbtsa191.seq
 249999588     gbtsa192.seq
 249997398     gbtsa193.seq
 249995404     gbtsa194.seq
 249999599     gbtsa195.seq
 222049284     gbtsa196.seq
 249999907     gbtsa197.seq
 249998022     gbtsa198.seq
 249999831     gbtsa199.seq
 249999875     gbtsa2.seq
 249996846     gbtsa20.seq
 249998525     gbtsa200.seq
 231476173     gbtsa201.seq
 249997536     gbtsa202.seq
 249996694     gbtsa203.seq
 249998981     gbtsa204.seq
 249997945     gbtsa205.seq
 249996879     gbtsa206.seq
 249997044     gbtsa207.seq
 249998226     gbtsa208.seq
 249998918     gbtsa209.seq
 179291287     gbtsa21.seq
  32621095     gbtsa210.seq
 249998497     gbtsa211.seq
 249998243     gbtsa212.seq
 249999255     gbtsa213.seq
 249995777     gbtsa214.seq
 249998092     gbtsa215.seq
 249998480     gbtsa216.seq
 249998398     gbtsa217.seq
 219125607     gbtsa218.seq
 249998478     gbtsa219.seq
 250000051     gbtsa22.seq
 249998905     gbtsa220.seq
 249995180     gbtsa221.seq
 249996675     gbtsa222.seq
 249994729     gbtsa223.seq
 249999027     gbtsa224.seq
 249999088     gbtsa225.seq
  28750338     gbtsa226.seq
 249999639     gbtsa227.seq
 249999892     gbtsa228.seq
 249996250     gbtsa229.seq
 249996448     gbtsa23.seq
 249995951     gbtsa230.seq
 249997802     gbtsa231.seq
 249999056     gbtsa232.seq
 249998509     gbtsa233.seq
 171540916     gbtsa234.seq
 250000264     gbtsa24.seq
 249998517     gbtsa25.seq
 146514959     gbtsa26.seq
 249999039     gbtsa27.seq
 249999075     gbtsa28.seq
 249999518     gbtsa29.seq
 249999971     gbtsa3.seq
 249998261     gbtsa30.seq
 249998844     gbtsa31.seq
   8360330     gbtsa32.seq
 249999396     gbtsa33.seq
 249998120     gbtsa34.seq
 249999803     gbtsa35.seq
 249998636     gbtsa36.seq
 249998533     gbtsa37.seq
 249998139     gbtsa38.seq
  67400599     gbtsa39.seq
 250000153     gbtsa4.seq
 249997527     gbtsa40.seq
 249999512     gbtsa41.seq
 249997467     gbtsa42.seq
 249999834     gbtsa43.seq
 249999596     gbtsa44.seq
 249998999     gbtsa45.seq
 249999361     gbtsa46.seq
  25962503     gbtsa47.seq
 249998180     gbtsa48.seq
 249999478     gbtsa49.seq
 146773925     gbtsa5.seq
 249999517     gbtsa50.seq
 249998366     gbtsa51.seq
  71315757     gbtsa52.seq
 250000188     gbtsa53.seq
 249998272     gbtsa54.seq
 249998401     gbtsa55.seq
 249995458     gbtsa56.seq
 153223993     gbtsa57.seq
 249999559     gbtsa58.seq
 249999540     gbtsa59.seq
 249998177     gbtsa6.seq
 249998090     gbtsa60.seq
 250000055     gbtsa61.seq
 250000068     gbtsa62.seq
 249999836     gbtsa63.seq
 249999542     gbtsa64.seq
 236772522     gbtsa65.seq
 249999479     gbtsa66.seq
 249996321     gbtsa67.seq
 249999966     gbtsa68.seq
 249997101     gbtsa69.seq
 249998374     gbtsa7.seq
 249997780     gbtsa70.seq
 249997375     gbtsa71.seq
 226152268     gbtsa72.seq
 249999425     gbtsa73.seq
 249997754     gbtsa74.seq
 249999723     gbtsa75.seq
 249997236     gbtsa76.seq
 249999596     gbtsa77.seq
 249997131     gbtsa78.seq
 174846214     gbtsa79.seq
 249998957     gbtsa8.seq
 249998462     gbtsa80.seq
 249997782     gbtsa81.seq
 250000080     gbtsa82.seq
 250000037     gbtsa83.seq
 249995888     gbtsa84.seq
 104827980     gbtsa85.seq
 249998728     gbtsa86.seq
 249998717     gbtsa87.seq
 249998008     gbtsa88.seq
 249999076     gbtsa89.seq
 249999330     gbtsa9.seq
 249997765     gbtsa90.seq
  39653951     gbtsa91.seq
 249999197     gbtsa92.seq
 249998374     gbtsa93.seq
 249997757     gbtsa94.seq
 249998081     gbtsa95.seq
 249999059     gbtsa96.seq
 144311861     gbtsa97.seq
 249992015     gbtsa98.seq
 249997674     gbtsa99.seq
    893354     gbuna1.seq
 249997646     gbvrl1.seq
 249993948     gbvrl10.seq
 249997005     gbvrl11.seq
 249999464     gbvrl12.seq
 249996497     gbvrl13.seq
 250000075     gbvrl14.seq
 249996969     gbvrl15.seq
  29302139     gbvrl16.seq
 249999491     gbvrl17.seq
 249996293     gbvrl18.seq
 249997439     gbvrl19.seq
 249991775     gbvrl2.seq
 249998487     gbvrl20.seq
 209555145     gbvrl21.seq
 249998103     gbvrl22.seq
 249999119     gbvrl23.seq
 249995036     gbvrl24.seq
 249997031     gbvrl25.seq
 126843107     gbvrl26.seq
 249999046     gbvrl27.seq
 249999885     gbvrl28.seq
 249998636     gbvrl29.seq
 249997817     gbvrl3.seq
 250000079     gbvrl30.seq
 249998755     gbvrl31.seq
  55880828     gbvrl32.seq
 249986852     gbvrl33.seq
 249998909     gbvrl34.seq
 249799070     gbvrl35.seq
 249999088     gbvrl36.seq
 249999797     gbvrl37.seq
  81944476     gbvrl38.seq
 249999646     gbvrl39.seq
 249997529     gbvrl4.seq
 249996177     gbvrl40.seq
 249997474     gbvrl41.seq
 249992758     gbvrl42.seq
 249998314     gbvrl43.seq
  71622208     gbvrl44.seq
 249995910     gbvrl45.seq
 249998844     gbvrl46.seq
 249995645     gbvrl47.seq
 249869941     gbvrl48.seq
 249993789     gbvrl49.seq
 249996073     gbvrl5.seq
 249996649     gbvrl50.seq
 249817716     gbvrl51.seq
 249993287     gbvrl52.seq
  88723800     gbvrl53.seq
  69577680     gbvrl6.seq
 249997230     gbvrl7.seq
 250000218     gbvrl8.seq
 249997584     gbvrl9.seq
 249832916     gbvrt1.seq
  87346686     gbvrt10.seq
 249748867     gbvrt11.seq
 249836066     gbvrt12.seq
 249995333     gbvrt13.seq
  34843259     gbvrt14.seq
 245584491     gbvrt15.seq
 246940585     gbvrt16.seq
 238220155     gbvrt17.seq
 225838100     gbvrt18.seq
 230692563     gbvrt19.seq
 249731436     gbvrt2.seq
 241819223     gbvrt20.seq
 236411971     gbvrt21.seq
 220753809     gbvrt22.seq
 217846760     gbvrt23.seq
 225175051     gbvrt24.seq
 217087050     gbvrt25.seq
 232264818     gbvrt26.seq
 158256912     gbvrt27.seq
 249980624     gbvrt28.seq
 249935599     gbvrt29.seq
 249997888     gbvrt3.seq
 249988735     gbvrt30.seq
 249993373     gbvrt31.seq
 249998313     gbvrt32.seq
 249998285     gbvrt33.seq
  54720082     gbvrt34.seq
 249978123     gbvrt35.seq
 249994105     gbvrt36.seq
 249998497     gbvrt37.seq
 249998104     gbvrt38.seq
 249999789     gbvrt39.seq
 249996789     gbvrt4.seq
  93633751     gbvrt40.seq
 249998785     gbvrt41.seq
 249998849     gbvrt42.seq
 249999735     gbvrt43.seq
 188513184     gbvrt44.seq
 249999413     gbvrt45.seq
 249998010     gbvrt46.seq
  26083368     gbvrt47.seq
 249998516     gbvrt48.seq
 189091078     gbvrt49.seq
 229001127     gbvrt5.seq
 249999201     gbvrt50.seq
 249997587     gbvrt51.seq
 249999164     gbvrt52.seq
 118311361     gbvrt53.seq
 249998375     gbvrt54.seq
 249999149     gbvrt55.seq
 249999125     gbvrt56.seq
  16973055     gbvrt57.seq
 250000041     gbvrt58.seq
 249999674     gbvrt59.seq
 249993256     gbvrt6.seq
 249998071     gbvrt60.seq
 241922005     gbvrt61.seq
 238513275     gbvrt62.seq
 227072423     gbvrt63.seq
 232653007     gbvrt64.seq
 249845791     gbvrt65.seq
 249360656     gbvrt66.seq
 249924167     gbvrt67.seq
 249999586     gbvrt68.seq
  44126581     gbvrt69.seq
  13603205     gbvrt7.seq
 199952251     gbvrt70.seq
 122600608     gbvrt71.seq
 243228521     gbvrt72.seq
 239733905     gbvrt73.seq
 233022258     gbvrt74.seq
 248903510     gbvrt75.seq
 240622316     gbvrt76.seq
 249662766     gbvrt77.seq
 249486033     gbvrt78.seq
 249567265     gbvrt79.seq
 249996567     gbvrt8.seq
 249549093     gbvrt80.seq
 238636497     gbvrt81.seq
 228044136     gbvrt82.seq
 207991154     gbvrt83.seq
 210160413     gbvrt84.seq
 162404629     gbvrt85.seq
  39925961     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64579      87277351
BCT10        12635      75804323
BCT100       62         108342624
BCT101       57         116195274
BCT102       63         111276567
BCT103       39         113384349
BCT104       59         111542017
BCT105       44         107663961
BCT106       44         110441702
BCT107       61         109855524
BCT108       38         110289963
BCT109       47         111322157
BCT11        2600       37759883
BCT110       11         27206151
BCT111       29         106059433
BCT112       24         104995446
BCT113       22         102815134
BCT114       22         103205502
BCT115       22         103088809
BCT116       22         103089218
BCT117       22         103633799
BCT118       22         104408660
BCT119       24         108509216
BCT12        1296       115524731
BCT120       47         110106529
BCT121       39         105943067
BCT122       9          27453619
BCT123       50         111764862
BCT124       60         109369965
BCT125       60         114865324
BCT126       68         113315118
BCT127       44         114294823
BCT128       51         122368703
BCT129       58         118921695
BCT13        14         17783631
BCT130       32         105533620
BCT131       26         110619128
BCT132       35         85165722
BCT133       44         114207420
BCT134       48         116972150
BCT135       62         113378131
BCT136       40         111579752
BCT137       37         115642270
BCT138       25         110288300
BCT139       56         114513545
BCT14        79         119443556
BCT140       7          21581982
BCT141       28         113584725
BCT142       60         113712694
BCT143       50         110304872
BCT144       37         114067329
BCT145       31         120103946
BCT146       48         118088836
BCT147       53         114617819
BCT148       11         9464264
BCT149       78         113214393
BCT15        109        117428562
BCT150       35         110143774
BCT151       46         114210856
BCT152       71         112057562
BCT153       59         114124703
BCT154       66         113760436
BCT155       68         118398060
BCT156       25         67311299
BCT157       53         103990173
BCT158       60         104041780
BCT159       29         106052559
BCT16        64         119321350
BCT160       45         111334518
BCT161       62         114775163
BCT162       48         110006388
BCT163       62         106227389
BCT164       52         112691931
BCT165       17         15103994
BCT166       162        111153271
BCT167       83         112822179
BCT168       48         107014680
BCT169       56         108418810
BCT17        68         115605542
BCT170       39         110201627
BCT171       60         111547533
BCT172       36         110580680
BCT173       47         113632224
BCT174       24         98541315
BCT175       35         105782148
BCT176       31         110769880
BCT177       44         105909847
BCT178       42         110264831
BCT179       40         110631584
BCT18        61         119378485
BCT180       46         113084126
BCT181       49         113221626
BCT182       32         112103898
BCT183       19         41538805
BCT184       94         107567012
BCT185       30         110366632
BCT186       26         106790034
BCT187       26         106809724
BCT188       32         108058883
BCT189       56         111730039
BCT19        39         119572726
BCT190       41         112601964
BCT191       55         109162741
BCT192       35         112246704
BCT193       38         111365483
BCT194       36         109667381
BCT195       46         108994132
BCT196       58         110970701
BCT197       46         115011110
BCT198       19         28379338
BCT199       99         108381810
BCT2         31224      98915171
BCT20        91         122596255
BCT200       51         106146784
BCT201       43         109679126
BCT202       48         113505771
BCT203       44         108778957
BCT204       45         111012807
BCT205       86         110394596
BCT206       56         111476577
BCT207       52         111721087
BCT208       39         110141463
BCT209       35         112358952
BCT21        63         120167574
BCT210       72         116235599
BCT211       49         113144528
BCT212       18         26713993
BCT213       70         111990039
BCT214       43         109558177
BCT215       43         112248629
BCT216       51         112580939
BCT217       68         106646226
BCT218       87         102298976
BCT219       43         109238455
BCT22        82         131179315
BCT220       48         103066847
BCT221       92         109381196
BCT222       47         107492558
BCT223       26         106747657
BCT224       36         110290270
BCT225       53         105305276
BCT226       35         104626025
BCT227       74         105376824
BCT228       42         109920940
BCT229       50         110773701
BCT23        80         120787468
BCT230       26         83046542
BCT231       67         110772768
BCT232       105        103957203
BCT233       61         110261401
BCT234       74         109910275
BCT235       56         106191899
BCT236       56         111254321
BCT237       76         108925402
BCT238       89         109680067
BCT239       32         104499758
BCT24        76         117529385
BCT240       17         49770996
BCT241       50         113958402
BCT242       53         108011335
BCT243       68         109924774
BCT244       49         108917257
BCT245       90         110110991
BCT246       56         105650050
BCT247       40         111206192
BCT248       58         108719423
BCT249       50         112122804
BCT25        85         112676596
BCT250       73         112128506
BCT251       58         110441703
BCT252       22         11268912
BCT253       45         111169376
BCT254       48         112304661
BCT255       47         108169953
BCT256       56         110442296
BCT257       59         114186683
BCT258       39         99574876
BCT259       60         112493559
BCT26        447        103217889
BCT260       52         108878657
BCT261       49         111146812
BCT262       55         111407587
BCT263       80         109607317
BCT264       53         105425973
BCT265       51         108956514
BCT266       118        111755910
BCT267       42         116419382
BCT268       58         109594014
BCT269       47         108993958
BCT27        5200       7533877
BCT270       44         111331834
BCT271       51         113622510
BCT272       44         110120614
BCT273       47         111211419
BCT274       67         109888982
BCT275       50         117916435
BCT276       104        122335072
BCT277       42         107345293
BCT278       9          20653336
BCT279       53         109210382
BCT28        10401      13140132
BCT280       47         119055267
BCT281       50         112993263
BCT282       55         112373409
BCT283       74         110819001
BCT284       53         113327473
BCT285       42         107426612
BCT286       23         75849671
BCT287       70         111512140
BCT288       48         113415583
BCT289       82         115620890
BCT29        53817      84837389
BCT290       65         107878412
BCT291       31         106022739
BCT292       51         106511869
BCT293       50         76395276
BCT294       64         105999418
BCT295       47         110185307
BCT296       80         105114161
BCT297       75         117495758
BCT298       60         114156881
BCT299       50         104169648
BCT3         47         113004732
BCT30        86         109498452
BCT300       68         110382862
BCT301       70         112767619
BCT302       70         113362188
BCT303       38         103208931
BCT304       69         107435895
BCT305       46         107276726
BCT306       37         106301572
BCT307       49         100989773
BCT308       49         106447746
BCT309       44         110590951
BCT31        137        95492678
BCT310       83         113802874
BCT311       56         118353420
BCT312       64         108632777
BCT313       72         115019052
BCT314       65         123780588
BCT315       50         115113933
BCT316       25         65560878
BCT317       63         109325026
BCT318       53         114118179
BCT319       52         110816653
BCT32        58         113456579
BCT320       67         115003215
BCT321       59         108034026
BCT322       68         109370640
BCT323       73         107043890
BCT324       42         106906319
BCT325       80         117203839
BCT326       51         119470325
BCT327       68         110592417
BCT328       75         110464109
BCT329       71         109280718
BCT33        52         112579647
BCT330       3          5573941
BCT331       55         108892211
BCT332       67         109898072
BCT333       71         109072144
BCT334       40         108254301
BCT335       55         104902630
BCT336       40         112218681
BCT337       59         118514711
BCT338       55         91650930
BCT339       50         118405402
BCT34        48         116997605
BCT340       52         114569100
BCT341       43         108854918
BCT342       52         112690097
BCT343       43         109463724
BCT344       52         112254404
BCT345       51         120157417
BCT346       59         116152155
BCT347       10         33059521
BCT348       55         108444630
BCT349       50         107064585
BCT35        59         116528153
BCT350       57         114905490
BCT351       42         108927454
BCT352       53         135929104
BCT353       44         194098041
BCT354       47         126035970
BCT355       65         113636912
BCT356       100        105761262
BCT357       52         114829611
BCT358       75         109895290
BCT359       13         13814939
BCT36        67         111716458
BCT360       211        155633988
BCT361       107        117027742
BCT362       68         106469454
BCT363       69         116253572
BCT364       67         95753613
BCT365       43         111996083
BCT366       49         113117316
BCT367       35         113972923
BCT368       55         124188418
BCT369       58         112157814
BCT37        30         80349661
BCT370       82         117483933
BCT371       36         108323160
BCT372       44         112793107
BCT373       16         39929071
BCT374       57         119465078
BCT375       42         112829367
BCT376       65         110640931
BCT377       84         106534968
BCT378       44         156631995
BCT379       76         108289856
BCT38        44         112327765
BCT380       75         106020302
BCT381       19         5986217
BCT382       204        94545960
BCT383       324        21043424
BCT384       1589       2511957
BCT385       3172       5268484
BCT386       6338       7796395
BCT387       12613      14997742
BCT388       25523      27672605
BCT389       50567      54076140
BCT39        59         108549640
BCT390       76727      78743326
BCT391       72579      78144599
BCT392       8212       93054674
BCT393       5442       100112786
BCT394       3164       103164360
BCT395       131        99758696
BCT396       37         107592501
BCT397       1191       101609791
BCT398       7055       99538875
BCT399       37299      89631404
BCT4         58         114249094
BCT40        72         113152419
BCT400       4039       3625140
BCT401       71367      76385903
BCT402       3728       103841551
BCT403       4392       102170073
BCT404       6609       100692159
BCT405       3488       101201946
BCT406       20948      101459691
BCT407       76011      80446158
BCT408       66694      72942959
BCT409       76457      79300121
BCT41        59         112109297
BCT410       73049      77686621
BCT411       73602      75212605
BCT412       10068      12483060
BCT413       71938      76263469
BCT414       72942      75057616
BCT415       25185      24558384
BCT416       67496      82538817
BCT417       65166      85482321
BCT418       29891      40630389
BCT419       61294      84550504
BCT42        60         105492134
BCT420       51702      84023939
BCT421       29456      102819614
BCT422       3755       150765914
BCT423       1433       176166881
BCT424       5480       105692064
BCT425       1775       108615613
BCT426       3115       113885027
BCT427       1936       108278199
BCT428       2649       118909288
BCT429       1121       117508492
BCT43        58         112573463
BCT430       811        87855602
BCT431       456        124890464
BCT432       708        136047416
BCT433       21         115405396
BCT434       25         119823587
BCT435       23         121254841
BCT436       22         121748253
BCT437       1643       126799256
BCT438       650        135901696
BCT439       684        31541407
BCT44        51         106493710
BCT440       1123       122558330
BCT441       622        149850553
BCT442       48         160127866
BCT443       34         109993540
BCT444       194        123118572
BCT445       131        145986635
BCT446       2159       12023002
BCT447       9659       16117728
BCT448       18026      25573262
BCT449       54691      92713288
BCT45        50         111687232
BCT450       333        822500
BCT46        94         111458496
BCT47        58         111561411
BCT48        84         112644694
BCT49        108        108953601
BCT5         27521      104244667
BCT50        30         51546888
BCT51        201        112694419
BCT52        53         109969331
BCT53        35         108859141
BCT54        60         109966555
BCT55        58         109966357
BCT56        46         113084021
BCT57        77         110161336
BCT58        62         109092488
BCT59        46         111286269
BCT6         10015      14329906
BCT60        60         112027245
BCT61        78         112427817
BCT62        84         111007733
BCT63        67         109336234
BCT64        61         108350042
BCT65        59         109790210
BCT66        55         108616273
BCT67        55         110914781
BCT68        65         113580356
BCT69        62         106974023
BCT7         39658      80452172
BCT70        69         106881048
BCT71        62         115998031
BCT72        44         116898024
BCT73        73         109295595
BCT74        55         114736382
BCT75        66         113765735
BCT76        9          1978793
BCT77        43         109853786
BCT78        51         118673819
BCT79        68         113547030
BCT8         1635       58802251
BCT80        48         110288002
BCT81        55         116500783
BCT82        104        116324895
BCT83        70         111645516
BCT84        85         109846187
BCT85        64         113994836
BCT86        62         118631327
BCT87        51         119558294
BCT88        57         114381603
BCT89        58         119532886
BCT9         8013       93844117
BCT90        4          10793059
BCT91        48         118002347
BCT92        135        118620434
BCT93        182        117074069
BCT94        66         111219258
BCT95        300        116964215
BCT96        60         109500882
BCT97        68         108099610
BCT98        45         112926461
BCT99        62         111891716
ENV1         93358      72333323
ENV10        86894      70993003
ENV100       106425     52970835
ENV101       16468      7924012
ENV11        93912      73213101
ENV12        82531      86709569
ENV13        19472      17012835
ENV14        85264      81189224
ENV15        119466     43018780
ENV16        89276      78082053
ENV17        97040      68007345
ENV18        96513      63826142
ENV19        113337     67178704
ENV2         97294      69151865
ENV20        118297     65720038
ENV21        58555      79062701
ENV22        64374      80737775
ENV23        91129      75798003
ENV24        126222     39552665
ENV25        124076     29252286
ENV26        87082      20053580
ENV27        123687     50579473
ENV28        97292      68249214
ENV29        117749     55875146
ENV3         94995      67761499
ENV30        138272     52907081
ENV31        106609     62339198
ENV32        96269      64928183
ENV33        21989      21773212
ENV34        62756      85293276
ENV35        89627      73501130
ENV36        103471     44257936
ENV37        96565      57687654
ENV38        69275      52741255
ENV39        111907     47549950
ENV4         72051      84212206
ENV40        101596     61418386
ENV41        107102     62845244
ENV42        63768      91043917
ENV43        72790      79085436
ENV44        62246      84556302
ENV45        11521      15696705
ENV46        71119      78555562
ENV47        108843     49752000
ENV48        113079     56886534
ENV49        105032     61483326
ENV5         44831      96431099
ENV50        78190      41637850
ENV51        101429     44616478
ENV52        42568      53405467
ENV53        42078      54694499
ENV54        58590      57604765
ENV55        97249      61447134
ENV56        32758      18476220
ENV57        92511      67352399
ENV58        81442      71525286
ENV59        78899      68374355
ENV6         59751      96047121
ENV60        86535      70200836
ENV61        97036      59979255
ENV62        79995      52197331
ENV63        110426     46323885
ENV64        90531      60933106
ENV65        101844     52169130
ENV66        94533      57428474
ENV67        80353      75383379
ENV68        29760      21720629
ENV69        74406      83178393
ENV7         89801      86374560
ENV70        83688      51661639
ENV71        86652      60199999
ENV72        58514      76587772
ENV73        106203     31855002
ENV74        62564      15805651
ENV75        79276      74763402
ENV76        92971      58332989
ENV77        102135     60375977
ENV78        109328     39419217
ENV79        108746     38386254
ENV8         89429      53197390
ENV80        30886      23060994
ENV81        99401      54592294
ENV82        117115     29632068
ENV83        108293     41973625
ENV84        104455     50580265
ENV85        106912     42544963
ENV86        103076     51220299
ENV87        121757     47550740
ENV88        118373     40229385
ENV89        105940     51773009
ENV9         132108     31605894
ENV90        100068     54719802
ENV91        39109      35458039
ENV92        98001      56329445
ENV93        100574     54951970
ENV94        93072      56022843
ENV95        87143      41626499
ENV96        78717      54967896
ENV97        93726      69971577
ENV98        128321     42522080
ENV99        116359     49017427
EST1         160137     62051490
EST10        169936     73461914
EST100       231475     141036104
EST101       239301     125378254
EST102       194697     104548172
EST103       182395     102754553
EST104       93686      66321774
EST105       161408     120611065
EST106       175080     106821755
EST107       134235     84331809
EST108       63884      23749865
EST109       63412      22288910
EST11        168599     72960451
EST110       63854      23122662
EST111       63916      26929608
EST112       64401      22911933
EST113       64607      24630352
EST114       63537      27083983
EST115       63849      26181805
EST116       64075      27278891
EST117       63912      25159791
EST118       61292      34058859
EST119       129465     64374313
EST12        172537     74054663
EST120       161346     86173343
EST121       184386     92955825
EST122       149309     95954368
EST123       158308     93268636
EST124       125698     81867094
EST125       189329     90796862
EST126       157056     83452617
EST127       158245     84987765
EST128       158518     85460481
EST129       151323     84886213
EST13        56979      27201309
EST130       174562     93787178
EST131       184674     117821171
EST132       202290     102185409
EST133       161220     88463706
EST134       162141     81490822
EST135       144231     85099204
EST136       144317     90726461
EST137       91968      47823737
EST138       173589     98185459
EST139       244896     113059391
EST14        218895     109883726
EST140       155949     84220118
EST141       168101     92693102
EST142       150621     87921231
EST143       135820     83827335
EST144       155969     96196225
EST145       155076     85667409
EST146       124019     63571640
EST147       121156     65084240
EST148       127874     57371020
EST149       127025     51017634
EST15        169755     106514026
EST150       128321     51160127
EST151       111578     41551888
EST152       164718     83016142
EST153       177835     74484978
EST154       162637     111157878
EST155       201803     123525139
EST156       214137     121574464
EST157       175708     96911371
EST158       155860     108340391
EST159       140167     95324107
EST16        183761     113817553
EST160       157856     96775985
EST161       156718     82484495
EST162       139371     78556865
EST163       172452     95505569
EST164       60671      38745600
EST165       151293     92665393
EST166       193519     111110109
EST167       146572     84278889
EST168       142420     72157383
EST169       152813     88508095
EST17        195553     117851861
EST170       190079     105264055
EST171       156987     96392419
EST172       168561     83488417
EST173       130226     87259545
EST174       173653     101865262
EST175       173668     100158962
EST176       119193     67651351
EST177       159856     91253997
EST178       21103      12984726
EST179       171661     103705274
EST18        195671     119599573
EST180       182535     120344935
EST181       144523     116575465
EST182       195086     100059024
EST183       153518     105316008
EST184       153546     99036742
EST185       142345     82797600
EST186       179089     73129847
EST187       150397     83235126
EST188       157503     100797361
EST189       160815     98386351
EST19        160161     113596975
EST190       141680     86064120
EST191       149200     89038558
EST192       147352     94376905
EST193       132174     91879327
EST194       142344     87476663
EST195       138322     90275699
EST196       133567     93949260
EST197       164847     88017113
EST198       175501     96470799
EST199       174857     97279984
EST2         162871     61822652
EST20        190578     100881430
EST200       172548     96905466
EST201       169978     95254867
EST202       173438     96373173
EST203       174883     95831686
EST204       175407     96456876
EST205       4775       2495378
EST206       190346     105932551
EST207       207615     105884500
EST208       172756     103038308
EST209       181827     103024656
EST21        220912     107200518
EST210       201946     122678856
EST211       198533     114015988
EST212       194118     125093798
EST213       137588     92190085
EST214       220966     141059025
EST215       237978     119318683
EST216       149164     101380634
EST217       183390     101249253
EST218       203514     99789075
EST219       132275     95254621
EST22        185128     59870904
EST220       147801     87105669
EST221       211162     117057019
EST222       160596     104249607
EST223       105069     110365443
EST224       155125     103380179
EST225       162683     97781883
EST226       142122     101631189
EST227       223708     106872422
EST228       137162     99238905
EST229       115393     82181202
EST23        137281     39307645
EST230       138516     98354330
EST231       123250     88289472
EST232       144459     90212136
EST233       130138     88896722
EST234       140886     105535617
EST235       132400     93272758
EST236       125283     84806084
EST237       142639     88354505
EST238       160215     121970184
EST239       124218     118266393
EST24        102671     27775748
EST240       139885     103644282
EST241       178424     107971971
EST242       164402     102202712
EST243       159384     100676096
EST244       75891      44367483
EST245       167493     126123545
EST246       144026     106367602
EST247       156978     100611692
EST248       215080     97859272
EST249       184900     113202576
EST25        119343     50179586
EST250       156515     84388967
EST251       219284     30190715
EST252       218143     87935505
EST253       163724     122131772
EST254       174626     102464406
EST255       163652     108618359
EST256       108193     67124651
EST257       156111     114047682
EST258       185578     112456151
EST259       189788     98479590
EST26        215597     98196770
EST260       177164     111125477
EST261       163777     111637842
EST262       233555     109778956
EST263       279455     121774786
EST264       189047     113915505
EST265       188640     37182159
EST266       260625     125121193
EST267       56231      36767783
EST268       153853     98124293
EST269       166625     102596812
EST27        220492     110846129
EST270       167415     114833308
EST271       197918     103281779
EST272       159035     107906579
EST273       195644     114569285
EST274       199130     46998202
EST275       204979     45162287
EST276       183737     103089955
EST277       177319     119112592
EST278       181996     115071929
EST279       116960     66635340
EST28        190463     88174037
EST280       176217     114708471
EST281       172195     75100832
EST282       132664     82987108
EST283       132774     86102936
EST284       157009     101433953
EST285       262659     27693908
EST286       266657     24517587
EST287       145336     107847650
EST288       170009     111142289
EST289       160932     101309673
EST29        158671     69282845
EST290       163185     89629068
EST291       138806     12695219
EST292       210501     74869326
EST293       166662     107911009
EST294       177580     107021191
EST295       154640     100183393
EST296       201879     108676888
EST297       153471     110804474
EST298       168028     101793377
EST299       188064     115370494
EST3         152180     53993352
EST30        172598     69769494
EST300       180708     104175918
EST301       188051     98075104
EST302       184124     64333687
EST303       117605     41461556
EST304       183963     71375308
EST305       184618     69638708
EST306       186671     97014211
EST307       183234     131694109
EST308       145942     84849772
EST309       153075     92926921
EST31        152071     64359458
EST310       132121     100752381
EST311       162234     97322203
EST312       173158     99117409
EST313       150440     97327423
EST314       167765     94897617
EST315       161113     107786562
EST316       95237      67549347
EST317       165803     108822684
EST318       158176     109514445
EST319       179778     152478011
EST32        167645     76276053
EST320       171142     111562200
EST321       142636     76713111
EST322       143985     98171725
EST323       147340     100921563
EST324       135644     91409969
EST325       149938     100207391
EST326       150848     101458128
EST327       178607     109580151
EST328       148867     84399419
EST329       149378     85210495
EST33        179325     70551740
EST330       57858      35973118
EST331       151263     108835754
EST332       162137     97435229
EST333       144247     91767218
EST334       142547     89683370
EST335       206354     111979262
EST336       136412     74615499
EST337       91280      54622222
EST338       131546     86728456
EST339       137986     87636476
EST34        113631     37382087
EST340       125504     80141957
EST341       162666     86531002
EST342       217675     84783652
EST343       169122     88375422
EST344       100514     59145414
EST345       166184     104019393
EST346       147236     90049028
EST347       133515     88935793
EST348       136754     89158889
EST349       187835     122643692
EST35        96454      29605296
EST350       160545     97260165
EST351       155658     78629261
EST352       188302     128992901
EST353       115629     79838367
EST354       73586      44058118
EST355       139350     77013696
EST356       131084     78409475
EST357       149582     56426390
EST358       159292     32704820
EST359       34555      6981021
EST36        96819      30306406
EST360       156188     43022651
EST361       191917     121844217
EST362       240678     114276822
EST363       249170     113821254
EST364       185992     103182520
EST365       141533     91310959
EST366       137342     86969407
EST367       155348     91517590
EST368       194144     119915532
EST369       227319     62377244
EST37        95746      29047541
EST370       182711     111495967
EST371       16750      9146498
EST372       215642     118406995
EST373       205665     122189413
EST374       204384     116386066
EST375       144884     69973602
EST376       197247     121780081
EST377       163470     103507720
EST378       163251     125628143
EST379       182851     147568908
EST38        97637      29501522
EST380       158158     91281457
EST381       164857     106433894
EST382       186658     106365842
EST383       89134      52217241
EST384       206160     112270892
EST385       196702     109558692
EST386       193945     119409651
EST387       190499     124725522
EST388       202823     133472148
EST389       221516     133918646
EST39        98182      30986559
EST390       208032     133291454
EST391       198739     150717239
EST392       213365     164852874
EST393       201061     121608391
EST394       45730      28137426
EST395       181585     95311949
EST396       173718     69818141
EST397       168619     13121700
EST398       155905     15730754
EST399       159239     32814476
EST4         172157     67669214
EST40        24669      6294373
EST400       159354     32540008
EST401       157881     40969745
EST402       150290     94535669
EST403       186243     115940489
EST404       164917     107442369
EST405       166387     106960366
EST406       146126     98222989
EST407       101507     71048942
EST408       145489     95031564
EST409       172930     118517167
EST41        101644     53117804
EST410       142850     99404102
EST411       177649     105057916
EST412       173294     36436805
EST413       166550     59203794
EST414       156490     110537725
EST415       162927     104405343
EST416       162470     100680934
EST417       159257     92228453
EST418       189720     124554576
EST419       145150     95875018
EST42        119850     50999334
EST420       125136     85917687
EST421       154595     95675648
EST422       156698     93990115
EST423       175419     93997427
EST424       160420     96759653
EST425       168217     97079622
EST426       172743     106129137
EST427       139867     88154655
EST428       102045     72875364
EST429       80598      61979950
EST43        167628     92700573
EST430       106304     69993377
EST431       157034     86243362
EST432       127050     77255258
EST433       139474     91485829
EST434       141976     83468680
EST435       43348      29376939
EST436       167978     97903809
EST437       179641     93681250
EST438       164651     105851493
EST439       155812     96875299
EST44        170940     72053236
EST440       172932     77586656
EST441       195335     107727066
EST442       154042     83676678
EST443       169932     99264330
EST444       221081     129209617
EST445       157147     107630438
EST446       168930     103364640
EST447       140300     91329141
EST448       17024      11154256
EST449       136219     91246615
EST45        167906     85551756
EST450       198951     74886070
EST451       181780     86174886
EST452       207404     88811782
EST453       201299     81703743
EST454       182783     107371906
EST455       184083     112220820
EST456       191001     109975474
EST457       196099     116662497
EST458       200240     127527034
EST459       189614     88444859
EST46        169830     87305091
EST460       10231      4886385
EST461       187975     114845578
EST462       219461     131825576
EST463       216437     134464960
EST464       205130     118026354
EST465       195523     118996390
EST466       174824     104277134
EST467       202027     125281412
EST468       149606     92009231
EST469       151572     110648758
EST47        164100     88235606
EST470       162769     88689123
EST471       184247     94594507
EST472       2114       1149908
EST473       152743     81492178
EST474       152197     82782768
EST475       189632     102789855
EST476       167751     108125889
EST477       185775     109141645
EST478       177340     116547318
EST479       185113     122303759
EST48        163278     83096993
EST480       181936     117484137
EST481       177971     105686287
EST482       191963     118583595
EST483       163827     64176558
EST484       151808     54273780
EST485       89450      35074948
EST49        160395     91732739
EST5         170269     66699829
EST50        163000     90583767
EST51        158733     97369611
EST52        159959     71225707
EST53        149269     83467140
EST54        63468      43180316
EST55        168244     70343814
EST56        165799     75339034
EST57        166079     91732673
EST58        159189     96879802
EST59        157539     103343270
EST6         172395     67097226
EST60        165687     99686836
EST61        161235     109135389
EST62        172961     78953430
EST63        174722     94940161
EST64        155662     84600852
EST65        148990     82946174
EST66        160916     97872837
EST67        122976     70718839
EST68        150499     92245213
EST69        197246     109654079
EST7         171605     73615629
EST70        182460     95233294
EST71        221159     121407286
EST72        187912     112680485
EST73        203972     120642358
EST74        165087     90581872
EST75        132345     60725811
EST76        137274     67678818
EST77        160021     101671867
EST78        157876     95080747
EST79        143664     79193696
EST8         181590     73741462
EST80        40470      18764890
EST81        164986     100910715
EST82        213947     115981040
EST83        226435     124844633
EST84        201694     95139616
EST85        213087     93823849
EST86        159912     92072512
EST87        145148     88664987
EST88        164669     80710808
EST89        160926     81087645
EST9         168728     69372860
EST90        153049     102320055
EST91        152417     91786191
EST92        123675     78024727
EST93        156660     113327358
EST94        141747     103763150
EST95        142590     101967009
EST96        141873     98038907
EST97        148159     81652909
EST98        179762     111987939
EST99        227655     137794479
GSS1         201766     88393856
GSS10        133596     61507253
GSS100       145752     114883362
GSS101       142374     116383703
GSS102       144252     117844834
GSS103       170442     129092802
GSS104       137462     74724457
GSS105       192307     121414098
GSS106       169508     113262635
GSS107       200407     117641233
GSS108       206386     135347324
GSS109       210697     139059339
GSS11        137308     73395422
GSS110       209782     139915832
GSS111       205659     145151288
GSS112       206482     144071055
GSS113       205585     145388417
GSS114       203091     147406672
GSS115       181515     137762119
GSS116       7065       3521482
GSS117       133694     84579411
GSS118       171023     80545119
GSS119       184853     80314741
GSS12        148972     76163483
GSS120       170777     148859728
GSS121       178615     120950657
GSS122       179814     146312880
GSS123       188809     121900493
GSS124       188230     138834959
GSS125       192938     128112712
GSS126       192138     95339365
GSS127       167147     153994892
GSS128       164887     116197024
GSS129       52506      30038767
GSS13        146064     69710606
GSS130       171707     156104939
GSS131       173052     155052994
GSS132       173062     155788741
GSS133       174512     154746062
GSS134       172801     155173032
GSS135       180861     139411352
GSS136       179835     146149855
GSS137       164919     119078037
GSS138       195643     96164774
GSS139       258703     40816077
GSS14        173103     86498862
GSS140       258654     39866805
GSS141       83884      12897935
GSS142       256943     59253960
GSS143       266393     55281989
GSS144       191914     88034620
GSS145       197994     66795031
GSS146       185657     147613870
GSS147       182069     150420083
GSS148       168207     155391153
GSS149       171791     158498832
GSS15        163025     97568665
GSS150       238050     73460917
GSS151       229183     82169753
GSS152       120032     51403657
GSS153       214491     54787615
GSS154       158716     98266954
GSS155       182698     113509138
GSS156       136354     87245672
GSS157       166453     132065964
GSS158       185087     162317718
GSS159       195022     160337766
GSS16        173381     88660958
GSS160       191959     125531212
GSS161       218403     139097019
GSS162       222684     133651856
GSS163       158870     97289281
GSS164       149740     87227774
GSS165       29488      22408545
GSS166       212908     158795737
GSS167       193254     101973605
GSS168       173554     69983241
GSS169       207351     160784759
GSS17        185330     116094978
GSS170       209369     162938000
GSS171       207741     164583308
GSS172       206667     132851990
GSS173       204154     147795107
GSS174       146756     89335047
GSS175       87375      64103840
GSS176       83926      63074443
GSS177       103736     48659056
GSS178       68877      58698888
GSS179       7313       6756990
GSS18        191379     111940154
GSS180       68904      58160721
GSS181       69534      56898519
GSS182       69772      56433485
GSS183       71622      56290743
GSS184       67206      50842980
GSS185       76238      58461130
GSS186       86639      74399035
GSS187       81831      44658448
GSS188       92736      45153832
GSS189       63725      47847900
GSS19        100782     45011755
GSS190       78081      61893846
GSS191       70457      59382827
GSS192       68395      63565679
GSS193       63332      52838738
GSS194       94982      42020100
GSS195       18216      4260634
GSS196       113554     71279902
GSS197       206        156931
GSS198       23226      28867035
GSS199       109723     71097090
GSS2         183363     92903519
GSS20        181573     101608444
GSS200       84797      34832316
GSS201       34871      21614135
GSS202       103993     62903048
GSS203       102976     64217927
GSS204       105147     68151070
GSS205       79884      39912713
GSS206       83527      54888563
GSS207       96136      61753164
GSS208       108044     78945540
GSS209       104766     75631871
GSS21        167017     114735606
GSS210       106686     80430314
GSS211       104248     80117974
GSS212       76721      51115479
GSS213       103345     62631542
GSS214       110548     66826634
GSS215       106057     59212883
GSS216       68304      37406646
GSS217       69501      38677774
GSS218       36760      17562257
GSS219       86142      46401696
GSS22        170222     97985782
GSS220       98449      56764845
GSS221       94892      49440300
GSS222       97262      56462367
GSS223       39255      21997076
GSS224       114855     43716251
GSS225       117293     39460437
GSS226       109075     53490846
GSS227       108949     67746338
GSS228       101533     78141049
GSS229       54696      32336729
GSS23        187042     127122154
GSS230       97424      37123873
GSS231       96927      37873906
GSS232       98284      35637304
GSS233       95520      40185769
GSS234       31845      14945615
GSS235       104191     66442509
GSS236       95150      61604354
GSS237       95766      60724103
GSS238       95367      61293700
GSS239       75595      70600991
GSS24        193924     129702672
GSS240       81979      69067111
GSS241       33571      32440711
GSS242       82831      27918196
GSS243       83303      27045179
GSS244       83897      25794921
GSS245       17701      5153013
GSS246       16547      7508221
GSS247       94605      60908245
GSS248       96103      64610709
GSS249       95270      65040443
GSS25        177770     105056567
GSS250       106528     70066025
GSS251       92475      46091116
GSS252       91780      49886764
GSS253       76121      41539409
GSS254       91399      57345117
GSS255       90265      62185096
GSS256       88936      64255670
GSS257       89858      62824607
GSS258       7578       5429987
GSS259       88518      64189595
GSS26        186329     108415447
GSS260       91219      63097213
GSS261       94711      59499098
GSS262       75614      65245817
GSS263       84994      78968925
GSS264       83445      81047461
GSS265       66441      49326047
GSS266       115710     63345042
GSS267       109508     55806767
GSS268       107863     52276734
GSS269       97634      43692152
GSS27        169889     151347424
GSS270       110146     49201977
GSS271       98861      46183314
GSS272       81078      63156364
GSS273       73131      73078884
GSS274       64591      55602017
GSS275       60949      47151330
GSS276       35630      26902277
GSS277       61051      46897110
GSS278       62318      49766268
GSS279       84463      87124836
GSS28        189745     145297056
GSS280       82870      89025174
GSS281       76621      72751886
GSS282       84728      65179968
GSS283       60336      48552561
GSS284       60281      48723318
GSS285       80187      51874172
GSS286       82184      61367380
GSS287       44416      26577232
GSS288       95284      57518679
GSS289       94047      59336854
GSS29        152221     107266725
GSS290       94416      58789547
GSS291       95209      57626971
GSS292       81805      50093018
GSS293       104332     69608616
GSS294       104890     74782057
GSS295       110042     68759043
GSS296       107586     71626914
GSS297       36263      24826247
GSS298       112024     66445708
GSS299       98068      61328228
GSS3         176506     88394950
GSS30        191518     131384057
GSS300       107603     56999080
GSS301       93293      73291771
GSS302       82737      88820842
GSS303       78908      94250347
GSS304       50490      28148542
GSS31        13275      8548576
GSS32        196267     127436164
GSS33        218975     117370716
GSS34        220856     114826209
GSS35        221954     113335961
GSS36        214691     124261741
GSS37        197227     155401496
GSS38        193934     145875067
GSS39        191420     69063559
GSS4         167759     85518632
GSS40        185204     97582662
GSS41        189723     125940109
GSS42        173659     160895094
GSS43        6071       3984289
GSS44        183966     100311532
GSS45        173274     121807446
GSS46        184128     124082945
GSS47        189635     121468909
GSS48        72701      63946125
GSS49        170766     101351050
GSS5         48508      29143102
GSS50        166917     102544217
GSS51        167103     101960328
GSS52        182672     120780882
GSS53        185111     116752809
GSS54        181953     122997714
GSS55        187091     113030685
GSS56        189341     135273025
GSS57        178747     104460436
GSS58        194235     119688007
GSS59        180404     132124880
GSS6         162428     84847761
GSS60        6966       6333297
GSS61        172439     138674275
GSS62        162915     112375740
GSS63        162938     112418280
GSS64        156417     105997128
GSS65        156671     129032996
GSS66        170937     143092903
GSS67        176929     115278128
GSS68        203419     127438135
GSS69        194390     110914174
GSS7         166528     79923105
GSS70        245897     127170846
GSS71        160709     106726664
GSS72        159975     120169190
GSS73        163425     125119710
GSS74        163390     125180213
GSS75        176013     109445038
GSS76        191298     140385789
GSS77        9289       5458698
GSS78        197588     125566653
GSS79        169883     110988116
GSS8         166565     89352425
GSS80        200250     131232619
GSS81        213076     87887393
GSS82        189429     98964353
GSS83        132406     92512991
GSS84        147250     118257570
GSS85        140219     117487656
GSS86        143489     114780229
GSS87        144607     120324157
GSS88        142692     116459674
GSS89        102511     85343353
GSS9         138313     67423895
GSS90        150146     122847619
GSS91        148368     118147832
GSS92        144647     113643750
GSS93        143499     116030455
GSS94        144993     120382205
GSS95        149051     121556637
GSS96        148092     118941752
GSS97        146794     121586406
GSS98        146798     121584299
GSS99        147330     120524395
HTC1         25101      27117357
HTC10        68990      83670735
HTC11        68112      69612981
HTC12        56776      53120259
HTC13        67768      60782734
HTC14        69853      69983020
HTC15        52471      41296733
HTC2         16105      36288852
HTC3         16046      36677221
HTC4         16271      35595400
HTC5         15996      40356923
HTC6         16084      37533163
HTC7         54286      32155873
HTC8         30551      18495385
HTC9         60910      77896619
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1053       190176019
HTG107       1392       191740916
HTG108       1294       191609595
HTG109       1641       191150380
HTG11        4          606452
HTG110       1331       192003621
HTG111       886        128541061
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1591       179505523
HTG121       1587       179611588
HTG122       1580       179575648
HTG123       1598       179580959
HTG124       1603       179513131
HTG125       1581       180746555
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1485       187625796
HTG129       1262       189779112
HTG13        875        191786413
HTG130       1060       185477678
HTG131       523        83741214
HTG132       1558       186647331
HTG133       1862       178854359
HTG134       987        187982440
HTG135       1085       193367281
HTG136       1091       193164785
HTG137       578        105203883
HTG138       1032       189666580
HTG139       1055       192668594
HTG14        754        192249622
HTG140       1164       191966294
HTG141       1079       192247965
HTG142       1083       192977959
HTG143       588        103686357
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2126       191583375
HTG149       1096       192456765
HTG15        746        192098155
HTG150       1077       192049291
HTG151       1088       192458469
HTG152       1037       190364444
HTG153       1998       182650634
HTG154       1809       184776483
HTG16        785        191953105
HTG17        796        191820344
HTG18        776        191918138
HTG19        2070       170867394
HTG2         2464       186026155
HTG20        1105       187256821
HTG21        874        179202862
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2516       185249883
HTG30        911        190941779
HTG31        841        171449145
HTG32        876        191233060
HTG33        967        189366255
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2553       188400147
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1257       188207454
HTG43        1169       188143648
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1268       190550291
HTG47        1175       190762525
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        969        190260546
HTG53        1105       190197636
HTG54        1046       190176357
HTG55        1014       189806472
HTG56        968        189013700
HTG57        80         14074619
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1169       188886612
HTG66        1179       187436132
HTG67        1283       184477002
HTG68        90         11586390
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         94384      48931041
INV10        81162      72343571
INV100       66269      109992870
INV101       93107      113729954
INV102       14323      174104346
INV103       29550      160266502
INV104       67580      129992426
INV105       37742      163849195
INV106       37941      155798158
INV107       48583      147979160
INV108       30062      33600034
INV109       41268      162665496
INV11        47985      93510232
INV110       8696       189081319
INV111       14504      181734293
INV112       5314       188812993
INV113       18728      176915367
INV114       34148      159145860
INV115       14531      172156000
INV116       23343      44749451
INV117       16800      180501882
INV118       21023      172479762
INV119       4900       191095260
INV12        36         176944197
INV120       26090      174310173
INV121       14623      181115063
INV122       44330      155961142
INV123       27158      171848114
INV124       19628      174135131
INV125       49409      139105235
INV126       28688      82885203
INV127       96941      109016144
INV128       35406      167752675
INV129       23689      177133477
INV13        171        169829817
INV130       21926      171277525
INV131       4820       190701562
INV132       29469      152201061
INV133       55399      123739171
INV134       565        34477095
INV135       7360       190715808
INV136       51899      153647552
INV137       5654       188079557
INV138       35203      162586890
INV139       3198       18041487
INV14        9          195252378
INV140       39923      160004572
INV141       62778      141980869
INV142       19018      29478718
INV143       105390     107166795
INV144       73947      121461718
INV145       12195      167796087
INV146       18372      163847824
INV147       13545      92747660
INV148       29318      156008826
INV149       38723      149357093
INV15        59176      100872401
INV150       51920      140051234
INV151       71367      126811786
INV152       64375      76908791
INV153       118449     93189348
INV154       62122      144117104
INV155       1743       177545896
INV156       19399      132383733
INV157       2463       151499585
INV158       6376       152875536
INV159       64438      78622226
INV16        78511      63961373
INV160       63770      85333593
INV161       1208       10656584
INV17        15391      13144093
INV18        85666      66960771
INV19        81736      67556911
INV2         59469      92784313
INV20        79217      68610016
INV21        47223      43399177
INV22        36854      122809002
INV23        283        150449073
INV24        51752      102161553
INV25        78073      57539712
INV26        69646      59182640
INV27        23154      127363289
INV28        6          133712559
INV29        57402      102364495
INV3         1370       188389428
INV30        75304      50952645
INV31        68523      49826727
INV32        77842      55704131
INV33        76392      57776490
INV34        77662      59854619
INV35        74693      52836441
INV36        51160      34155813
INV37        79678      57480755
INV38        75620      56227228
INV39        75099      61732567
INV4         858        123896883
INV40        78712      58713679
INV41        52439      35155003
INV42        78731      56895398
INV43        74711      52881824
INV44        75603      57741363
INV45        78266      58053016
INV46        35790      31127977
INV47        76871      49086373
INV48        74279      45425471
INV49        76685      46658543
INV5         26937      110546155
INV50        77415      54851103
INV51        27507      19354507
INV52        77438      54931793
INV53        75392      44940754
INV54        74764      43998780
INV55        75041      43291046
INV56        70647      42792824
INV57        70038      41335596
INV58        69685      42105241
INV59        69876      41019268
INV6         78679      72099749
INV60        70118      45960480
INV61        6101       3386327
INV62        70233      40994740
INV63        71706      44244411
INV64        68158      50824561
INV65        68548      49133590
INV66        64334      50524769
INV67        69427      54379489
INV68        74411      55022607
INV69        75769      61942602
INV7         53871      96393140
INV70        77028      57617886
INV71        75011      60026017
INV72        40284      126161499
INV73        31612      73928938
INV74        81899      126749699
INV75        101136     110191760
INV76        116939     96644568
INV77        99289      69232818
INV78        35246      167082089
INV79        30784      171928044
INV8         7535       172993465
INV80        27689      171878890
INV81        2670       191216364
INV82        6193       191203895
INV83        17813      180380779
INV84        15388      184897353
INV85        6812       164358105
INV86        8880       189597154
INV87        15686      184336589
INV88        30825      171780128
INV89        66120      142501460
INV9         34082      40083586
INV90        20986      21881179
INV91        50231      154102086
INV92        4106       191144025
INV93        11236      184725560
INV94        29087      169091322
INV95        3330       189370323
INV96        6354       186214262
INV97        12432      180552662
INV98        40321      157085197
INV99        61631      142103282
MAM1         21071      155376538
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         14513      164534272
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        9          136550477
MAM26        54         7614329
MAM27        215        34073042
MAM28        431        71272130
MAM29        861        68509101
MAM3         19899      31667172
MAM30        1706       2411269
MAM31        6836       6159435
MAM32        80287      75311049
MAM33        30238      118089017
MAM34        76918      63014712
MAM35        69815      72741207
MAM36        65594      78803251
MAM37        52454      89922396
MAM38        14377      143130786
MAM39        15121      63689468
MAM4         26813      24993629
MAM5         13731      20581304
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         225426     70993955
PAT10        126650     101608710
PAT100       180490     3429310
PAT101       180135     3422565
PAT102       179993     3419867
PAT103       179981     3419639
PAT104       125419     2711863
PAT105       349650     8741250
PAT106       186050     91875274
PAT107       107513     135541957
PAT108       3843       194691476
PAT109       137991     108090545
PAT11        90439      62784009
PAT110       151783     50730134
PAT111       227882     34313993
PAT112       253630     16070281
PAT113       177600     67409226
PAT114       48026      21887625
PAT115       115737     110547338
PAT116       139353     84265875
PAT117       161024     103163220
PAT118       167185     100849156
PAT119       134737     117530952
PAT12        142880     63395362
PAT120       36618      23041490
PAT121       194814     83178152
PAT122       155047     107550529
PAT123       364428     11160383
PAT124       248176     64617758
PAT125       132887     40797313
PAT126       328269     22915988
PAT127       155764     104210281
PAT128       126354     109119371
PAT129       128479     122630735
PAT13        104574     59133164
PAT130       21689      184619586
PAT131       149967     111615722
PAT132       168658     100093679
PAT133       43844      172281111
PAT134       8038       42566337
PAT135       33730      178662375
PAT136       155435     110345001
PAT137       180818     91511668
PAT138       137025     116369121
PAT139       119019     125218305
PAT14        103239     50080053
PAT140       4849       4475753
PAT141       158424     101541724
PAT142       184327     90868267
PAT143       185136     85636854
PAT144       177480     94577577
PAT145       20467      17346132
PAT146       149543     109199294
PAT147       161593     103400312
PAT148       186330     92436086
PAT149       228368     45729382
PAT15        121140     53107703
PAT150       205276     48281754
PAT151       283466     9264744
PAT152       224633     46570735
PAT153       95243      2594242
PAT154       274370     21772171
PAT155       186798     63026679
PAT156       111649     105352037
PAT157       41637      8368740
PAT158       88148      89406799
PAT159       79146      97084598
PAT16        113081     61313692
PAT160       152807     75259742
PAT161       163972     75813831
PAT162       125687     90269002
PAT163       98236      89703503
PAT164       160476     39720523
PAT165       274167     5209173
PAT166       274122     5208318
PAT167       274122     5208318
PAT168       225455     4283645
PAT169       273522     5196918
PAT17        40104      16656638
PAT170       235900     27314616
PAT171       209160     45687253
PAT172       2061       71829
PAT173       165888     75954920
PAT174       91807      127288620
PAT175       177920     70072673
PAT176       210427     71386703
PAT177       39406      44066854
PAT178       236689     61271332
PAT179       125083     125590832
PAT18        147938     53119339
PAT180       217679     68931191
PAT181       197384     85491224
PAT182       192799     86183567
PAT183       160052     103142924
PAT184       158485     104252941
PAT185       152376     102303293
PAT186       153284     104821004
PAT187       108066     120931232
PAT188       131010     97456392
PAT189       129357     120521145
PAT19        156198     77748072
PAT190       175044     97302491
PAT191       144298     115604482
PAT192       132490     120416967
PAT193       99092      135657342
PAT194       156484     107532837
PAT195       187757     62538940
PAT196       31550      29445733
PAT197       93826      87469183
PAT198       91784      80783259
PAT199       85389      91256512
PAT2         194676     86398557
PAT20        105064     119277426
PAT200       109494     54259504
PAT201       97905      55962097
PAT202       151406     25025002
PAT203       92604      85288661
PAT204       27031      161947013
PAT205       116076     64442611
PAT206       78456      27182019
PAT207       3632       191904545
PAT208       84658      79944634
PAT209       147803     24785549
PAT21        131153     98542671
PAT210       77115      100107466
PAT211       95461      72396032
PAT212       130092     32530803
PAT213       1387       4387387
PAT214       107202     62296760
PAT215       140563     13376529
PAT216       152488     23320938
PAT217       78288      10420708
PAT218       53299      70147281
PAT219       41588      53257148
PAT22        83266      74943590
PAT220       60912      55078171
PAT221       37663      64678945
PAT222       41773      60415230
PAT223       40163      55397856
PAT224       87860      55688969
PAT225       115384     52029988
PAT226       26006      9048648
PAT227       105881     53605089
PAT228       97872      46919625
PAT229       86046      71865688
PAT23        124774     103847682
PAT230       97456      8893306
PAT231       117394     19496337
PAT232       87918      130066340
PAT233       161761     78738364
PAT234       211966     49799578
PAT235       174306     64860620
PAT236       52278      7524891
PAT237       162448     79722768
PAT238       121563     100427675
PAT239       85467      130876202
PAT24        118221     108124614
PAT240       38098      167518403
PAT241       35869      169133881
PAT242       74294      134044692
PAT243       256650     29271966
PAT244       136543     93162338
PAT245       150104     82887201
PAT246       140944     76153760
PAT247       12260      8251363
PAT248       142939     87445786
PAT249       144203     95212885
PAT25        150175     84692661
PAT250       264977     9686438
PAT251       144382     4340696
PAT252       240761     24361869
PAT253       256037     8953305
PAT254       262605     3939075
PAT255       262605     3939075
PAT256       153472     3896783
PAT257       225731     30138510
PAT258       151701     93683972
PAT259       172305     96419302
PAT26        178517     63567420
PAT260       73385      9861487
PAT261       132237     118204122
PAT262       127658     120598622
PAT263       3357       195490777
PAT264       1277       196638191
PAT265       113842     128323979
PAT266       77057      79485375
PAT267       207306     76888680
PAT268       101163     43549091
PAT269       93045      17617696
PAT27        63313      1582825
PAT270       47484      136138512
PAT271       6430       91690961
PAT272       76636      105127353
PAT273       101249     76175895
PAT274       37393      112049357
PAT275       34156      73068233
PAT276       37959      57714870
PAT277       37837      58070712
PAT278       37921      57726864
PAT279       37833      58048870
PAT28        102489     77951993
PAT280       46229      38674255
PAT281       129929     18053062
PAT282       115666     50591436
PAT283       124999     25113741
PAT284       76619      37966262
PAT285       133959     31130348
PAT286       130625     26677385
PAT287       143447     9914585
PAT288       166159     74060037
PAT289       261571     3923565
PAT29        95014      87382724
PAT290       197120     50753581
PAT291       107022     44870927
PAT292       202591     51164728
PAT293       144302     69701913
PAT294       133040     3992595
PAT295       132977     3990074
PAT296       44635      1339164
PAT297       133140     6548394
PAT298       96159      70667857
PAT299       103123     49989409
PAT3         173714     96696797
PAT30        120009     62059315
PAT300       125140     22774974
PAT301       144928     3764734
PAT302       136103     15294700
PAT303       63878      6660079
PAT304       101573     43643229
PAT305       51811      126591837
PAT306       39633      58326691
PAT307       33784      76648155
PAT308       36089      65668851
PAT309       38049      57760917
PAT31        97921      79760122
PAT310       37899      58196841
PAT311       99327      26077467
PAT312       145180     2177700
PAT313       30015      450225
PAT314       87992      80740079
PAT315       141876     19436515
PAT316       38032      57705780
PAT317       37795      61199204
PAT318       78019      45477727
PAT319       132881     52951168
PAT32        129214     55155060
PAT320       165566     100094329
PAT321       125110     118422111
PAT322       206465     51107951
PAT323       38446      15816782
PAT33        88488      49386396
PAT34        118747     69220772
PAT35        120170     36360207
PAT36        122826     44471256
PAT37        94730      87320632
PAT38        150578     21220142
PAT39        147082     34845298
PAT4         156010     106306269
PAT40        110910     55386930
PAT41        33841      36793621
PAT42        96351      83600457
PAT43        99709      72323829
PAT44        138998     37627662
PAT45        143760     37193283
PAT46        125073     64720407
PAT47        100399     86321912
PAT48        99428      68548842
PAT49        111862     67345341
PAT5         50111      20254509
PAT50        60374      52824381
PAT51        136399     108802801
PAT52        168265     98178509
PAT53        119298     126920074
PAT54        201754     75944942
PAT55        69600      127456544
PAT56        27795      181082835
PAT57        189418     92960765
PAT58        277142     6928550
PAT59        122390     31451008
PAT6         171986     92903236
PAT60        162935     78473973
PAT61        92867      90600323
PAT62        109251     73716654
PAT63        123341     64227958
PAT64        62041      29215516
PAT65        70923      110313258
PAT66        88692      82810627
PAT67        93124      79739812
PAT68        94118      72274536
PAT69        94231      74769308
PAT7         157691     87492076
PAT70        118843     59763989
PAT71        96798      9793333
PAT72        177632     10656303
PAT73        173172     10978125
PAT74        173161     10971235
PAT75        94835      96316767
PAT76        101        195797548
PAT77        66         196768687
PAT78        104        196327400
PAT79        12309      182633014
PAT8         127556     101553182
PAT80        86423      5090841
PAT81        152298     9718010
PAT82        152308     9704500
PAT83        152313     9703390
PAT84        152308     9704292
PAT85        95141      89656500
PAT86        93068      93878198
PAT87        31086      33386746
PAT88        83471      94698793
PAT89        16516      179586411
PAT9         134763     98530663
PAT90        167160     18621902
PAT91        180755     3434345
PAT92        179225     3405275
PAT93        177411     3370809
PAT94        92463      1756797
PAT95        170988     12446769
PAT96        180501     3429519
PAT97        180495     3429405
PAT98        180484     3429196
PAT99        133550     2537450
PHG1         5914       107062912
PHG2         3055       109180706
PHG3         2187       110024993
PHG4         2307       83154871
PLN1         60432      94042123
PLN10        47115      47571607
PLN100       8305       28494037
PLN101       1858       148969943
PLN102       2          135217911
PLN103       2          155188403
PLN104       2          140023111
PLN105       2          154604167
PLN106       2          148753627
PLN107       3          173772618
PLN108       3          178836778
PLN109       3          176344173
PLN11        72063      77517554
PLN110       3          195539469
PLN111       12431      129466187
PLN112       82817      66178354
PLN113       94009      58018975
PLN114       20324      14671097
PLN115       78043      71613363
PLN116       70806      84955524
PLN117       77800      68076762
PLN118       71875      77263684
PLN119       80678      67005526
PLN12        39652      50608365
PLN120       4101       3783188
PLN121       78819      64032423
PLN122       75350      68539039
PLN123       82655      59021261
PLN124       81731      59642288
PLN125       22185      25367133
PLN126       74549      63578328
PLN127       72524      71639357
PLN128       63532      85248780
PLN129       57425      66188451
PLN13        39364      63980764
PLN130       92625      52862745
PLN131       75083      68609454
PLN132       72078      68827006
PLN133       41219      49639005
PLN134       71279      71561929
PLN135       62392      79221223
PLN136       62728      82614746
PLN137       37884      35924409
PLN138       70697      73050556
PLN139       65037      77188443
PLN14        24732      121021270
PLN140       66310      79112726
PLN141       59127      86081280
PLN142       61726      83358496
PLN143       60487      80920477
PLN144       6223       5715774
PLN145       59282      85954113
PLN146       62378      79439324
PLN147       54266      88540907
PLN148       62236      80694616
PLN149       49023      94044173
PLN15        21159      106162909
PLN150       1356       2604922
PLN151       50508      97706858
PLN152       66475      78812605
PLN153       20365      113425219
PLN154       9151       170784091
PLN155       81         188747955
PLN156       18820      41235315
PLN157       12512      154597097
PLN158       6          176139136
PLN159       21205      122893521
PLN16        17587      144956899
PLN160       5          186225412
PLN161       3095       183521946
PLN162       31         190984103
PLN163       4340       184497600
PLN164       2110       152449230
PLN165       33412      111263826
PLN166       58213      83791863
PLN167       60520      80654010
PLN168       12852      28008210
PLN17        17646      146317509
PLN18        17565      146440300
PLN19        1356       10854690
PLN2         75120      78286679
PLN20        23259      121287391
PLN21        6083       151149287
PLN22        1184       166859751
PLN23        1484       166774036
PLN24        33         165555096
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        21982      112057004
PLN3         37339      104809315
PLN30        67652      70400159
PLN31        28875      30908664
PLN32        77500      76702552
PLN33        35622      40580669
PLN34        57312      72147331
PLN35        28689      28923384
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        282        133858659
PLN4         1378       179309602
PLN40        99         129632256
PLN41        285        131701927
PLN42        157        130226554
PLN43        90         71965224
PLN44        157        128672551
PLN45        141        130200994
PLN46        173        129439941
PLN47        166        136053947
PLN48        211        155822577
PLN49        273        194773389
PLN5         1846       186139026
PLN50        113        80920130
PLN51        273        194661068
PLN52        182        184910473
PLN53        121        183815870
PLN54        5          168777512
PLN55        24         192004664
PLN56        68         76006381
PLN57        71         185395548
PLN58        28         139366021
PLN59        5          169521320
PLN6         1849       194371041
PLN60        12         191290805
PLN61        105        184590114
PLN62        128        90595192
PLN63        124        164191456
PLN64        5          176674019
PLN65        6          180429558
PLN66        8          174193523
PLN67        18         165687913
PLN68        4          195022507
PLN69        3          192615638
PLN7         1688       194246488
PLN70        3          183683931
PLN71        2          138356491
PLN72        6          196214810
PLN73        245        68825394
PLN74        2469       93786416
PLN75        7181       18795412
PLN76        14346      29953091
PLN77        19350      134329049
PLN78        78618      75193021
PLN79        98946      57606161
PLN8         1830       193254699
PLN80        30222      32276169
PLN81        81007      72156367
PLN82        78267      76477677
PLN83        80733      70937107
PLN84        82121      76003551
PLN85        57108      30549438
PLN86        99620      56066631
PLN87        81996      69951930
PLN88        46545      98329769
PLN89        3040       158069334
PLN9         49589      107288598
PLN90        11879      166061017
PLN91        29884      120801782
PLN92        59193      98669653
PLN93        11546      7934214
PLN94        81749      72860461
PLN95        16718      12435352
PLN96        49498      72633238
PLN97        25061      110565816
PLN98        13564      89766260
PLN99        1          774434471
PRI1         23034      59762327
PRI10        1253       178780857
PRI11        860        104346432
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22394      144967612
PRI20        1737       191814810
PRI21        2631       189865971
PRI22        2079       192522927
PRI23        1206       195380396
PRI24        16063      72553978
PRI25        27929      79132585
PRI26        59941      84371445
PRI27        36109      81894692
PRI28        8761       172362823
PRI29        2264       191585097
PRI3         1438       174353221
PRI30        1666       190931151
PRI31        2074       192118866
PRI32        2196       191069594
PRI33        13104      162575570
PRI34        2098       170891945
PRI35        57042      89265100
PRI36        3822       7514956
PRI37        33760      66543687
PRI38        19382      127313918
PRI39        20385      148361481
PRI4         1278       185868863
PRI40        67598      84508402
PRI41        51511      91784353
PRI42        38584      73711396
PRI43        47896      96566360
PRI44        26428      103373869
PRI45        29289      110643765
PRI46        25143      104923782
PRI47        29526      101888259
PRI48        5090       42436304
PRI49        39419      104772749
PRI5         1335       184501516
PRI50        34380      107229126
PRI51        34773      98338022
PRI52        1978       4360985
PRI53        1          229594237
PRI54        1          190673448
PRI55        1          197221778
PRI56        11228      168209425
PRI57        24017      110722578
PRI58        36700      65594263
PRI6         1179       179994692
PRI7         1229       180208989
PRI8         1221       179042773
PRI9         1372       174851936
ROD1         37508      133642525
ROD10        989        182010602
ROD11        307        58052732
ROD12        1034       185475616
ROD13        941        182878681
ROD14        1040       189304693
ROD15        950        180388993
ROD16        967        181966557
ROD17        991        185834465
ROD18        1190       190611728
ROD19        15160      158963325
ROD2         908        176070435
ROD20        20997      153967461
ROD21        1216       193771265
ROD22        1003       157974000
ROD23        15427      168556538
ROD24        38050      70187046
ROD25        19428      118458613
ROD26        2242       191892851
ROD27        152507     18065127
ROD28        75943      79169740
ROD29        84557      53143365
ROD3         910        173108361
ROD30        63485      74756522
ROD4         900        173849398
ROD5         919        174488736
ROD6         965        177341176
ROD7         974        179555511
ROD8         969        181372318
ROD9         1001       181665338
STS1         85559      36896329
STS10        58083      44552041
STS11        48085      36873197
STS12        58099      43769473
STS13        64422      42856172
STS14        93857      34186170
STS15        104888     26688384
STS16        8950       2430284
STS17        104293     27679407
STS18        97854      33659726
STS19        97350      34711104
STS2         85035      49980125
STS20        69630      24719701
STS3         66345      26281661
STS4         77125      37068775
STS5         8191       4810172
STS6         54412      31740785
STS7         54312      31932091
STS8         54469      32048894
STS9         55909      37990705
SYN1         53376      71688468
SYN10        19957      54273121
SYN2         43610      81487243
SYN3         23537      126614368
SYN4         4594       176470186
SYN5         4588       176368680
SYN6         4594       176442615
SYN7         11367      161092342
SYN8         57221      74559451
SYN9         52348      84898287
TSA1         119867     38078881
TSA10        15758      19457445
TSA100       84628      38647321
TSA101       76860      53168945
TSA102       66230      68312035
TSA103       64656      75546157
TSA104       88788      55755865
TSA105       48310      25539654
TSA106       74550      86726411
TSA107       80730      75604381
TSA108       85476      72848266
TSA109       77395      84130963
TSA11        134601     34776357
TSA110       95638      51743388
TSA111       98577      70641670
TSA112       57552      94582727
TSA113       109914     49593061
TSA114       63991      68743855
TSA115       81365      89245306
TSA116       70500      72924301
TSA117       57286      120848369
TSA118       3694       3387893
TSA119       107244     68283732
TSA12        59950      20118999
TSA120       93864      83831193
TSA121       99424      76800693
TSA122       86215      66900549
TSA123       85137      59406979
TSA124       78341      62345274
TSA125       82329      77771081
TSA126       99805      59600144
TSA127       94858      42440076
TSA128       75839      55282740
TSA129       40596      38103163
TSA13        64437      60230317
TSA130       59842      61355677
TSA131       59222      61956330
TSA132       59447      62201688
TSA133       72514      79237539
TSA134       88241      50637266
TSA135       63416      65296736
TSA136       832        252551
TSA137       78109      34727398
TSA138       74879      67607515
TSA139       81463      78932809
TSA14        93892      60774882
TSA140       75039      64606512
TSA141       40597      33646913
TSA142       87917      70744689
TSA143       89637      68264227
TSA144       84723      77981171
TSA145       77299      81247994
TSA146       10512      8596527
TSA147       104870     53942459
TSA148       80798      61849074
TSA149       70761      78288377
TSA15        91383      65106730
TSA150       72668      69649300
TSA151       88477      74130296
TSA152       89281      71320562
TSA153       63447      101767938
TSA154       95795      75263071
TSA155       16998      11858365
TSA156       83362      63896652
TSA157       83862      64153636
TSA158       79385      73616320
TSA159       77070      76639823
TSA16        6713       3516114
TSA160       93994      58998624
TSA161       101042     66808521
TSA162       33299      23300565
TSA163       102259     63715273
TSA164       94026      74723592
TSA165       80955      64132522
TSA166       32032      49058197
TSA167       51993      98573117
TSA168       46992      108059536
TSA169       45060      111729686
TSA17        76328      86345063
TSA170       42052      117437639
TSA171       39600      122092043
TSA172       37741      125627862
TSA173       30097      107288374
TSA174       79278      65831927
TSA175       61766      78801121
TSA176       65943      56757743
TSA177       40135      19854948
TSA178       38520      26931630
TSA179       35906      38483420
TSA18        79571      72873999
TSA180       33719      32835987
TSA181       31723      56974521
TSA182       31529      57827756
TSA183       39360      23153642
TSA184       40480      18197417
TSA185       41160      15188692
TSA186       41560      13420160
TSA187       41798      12369266
TSA188       25925      7379156
TSA189       41988      11531997
TSA19        87122      45676818
TSA190       42033      11331256
TSA191       42081      11121330
TSA192       42155      10791502
TSA193       42199      10594518
TSA194       42246      10386471
TSA195       44469      10970414
TSA196       89574      35651580
TSA197       85248      64327814
TSA198       71514      85727361
TSA199       104370     34591482
TSA2         113513     41575102
TSA20        74112      88789066
TSA200       79480      68069082
TSA201       46133      105547678
TSA202       89741      47774789
TSA203       47189      118699045
TSA204       87176      55356978
TSA205       79486      69671475
TSA206       52801      112476082
TSA207       44638      125583658
TSA208       38073      136130006
TSA209       61544      98133552
TSA21        65190      48723008
TSA210       12102      5800279
TSA211       58652      100603319
TSA212       75646      71894803
TSA213       50457      112947945
TSA214       77365      67441564
TSA215       53726      106980439
TSA216       75926      70339630
TSA217       59610      97707887
TSA218       61369      69985665
TSA219       74428      72821943
TSA22        81439      82281132
TSA220       87323      50951603
TSA221       50899      111127179
TSA222       71562      76448065
TSA223       62951      91534461
TSA224       85139      53774514
TSA225       83387      56083879
TSA226       10763      4953843
TSA227       64419      91116089
TSA228       71926      77423316
TSA229       70933      78656816
TSA23        63006      84596593
TSA230       88398      46498714
TSA231       63160      89037236
TSA232       93507      36784395
TSA233       65147      85307235
TSA234       57907      35845393
TSA24        84650      73530871
TSA25        100183     53491077
TSA26        61504      18876109
TSA27        86234      70407370
TSA28        121324     38862791
TSA29        135063     35310894
TSA3         110421     41064860
TSA30        51855      68718843
TSA31        47829      62910692
TSA32        1549       2253596
TSA33        61314      82147786
TSA34        93472      67491932
TSA35        110655     50015529
TSA36        106345     50201806
TSA37        102307     54388700
TSA38        103560     49787675
TSA39        22637      12494687
TSA4         112137     47720377
TSA40        66642      59388549
TSA41        92820      68251805
TSA42        93446      62442749
TSA43        79794      86536802
TSA44        100835     49268702
TSA45        114271     34482783
TSA46        94903      69055916
TSA47        10363      5895735
TSA48        94696      35577587
TSA49        78213      36138263
TSA5         74536      22525878
TSA50        106962     43690670
TSA51        114967     46107338
TSA52        26890      19148939
TSA53        104334     51655152
TSA54        101776     54365987
TSA55        97582      60662772
TSA56        82228      86008299
TSA57        67802      29059764
TSA58        90828      71678131
TSA59        97915      54906712
TSA6         112164     59299839
TSA60        60403      105707789
TSA61        86807      66091831
TSA62        79380      70604487
TSA63        83881      71955670
TSA64        82692      73138164
TSA65        66480      87984245
TSA66        91172      67099618
TSA67        76182      84986777
TSA68        72161      72968018
TSA69        69193      61162967
TSA7         87942      58097196
TSA70        85674      78551372
TSA71        85110      79390602
TSA72        68164      94940592
TSA73        86359      70218089
TSA74        85532      52029253
TSA75        103092     68803181
TSA76        87069      60219812
TSA77        103531     57122474
TSA78        75996      72532642
TSA79        74667      42478724
TSA8         105281     73053535
TSA80        88020      79406904
TSA81        91816      69554168
TSA82        78643      53628715
TSA83        78975      56799054
TSA84        97227      61708495
TSA85        37388      33674257
TSA86        89459      77100280
TSA87        95713      55692877
TSA88        111184     45067626
TSA89        97283      59077752
TSA9         110108     61261039
TSA90        65710      96700007
TSA91        13351      13164463
TSA92        101868     55796774
TSA93        91582      53917306
TSA94        94202      43888098
TSA95        85593      75399941
TSA96        73247      71810899
TSA97        38585      45011146
TSA98        77356      80756171
TSA99        77829      55237291
UNA1         381        224044
VRL1         65955      72118201
VRL10        43873      73774818
VRL11        42987      73673368
VRL12        53123      72135898
VRL13        63984      72692651
VRL14        68131      69368711
VRL15        56171      74385123
VRL16        7390       8955201
VRL17        63256      72339576
VRL18        58741      73096407
VRL19        64063      65679109
VRL2         67688      67389046
VRL20        57701      74221598
VRL21        49045      61758267
VRL22        55431      73612500
VRL23        59314      72310851
VRL24        56533      74685119
VRL25        57025      73699892
VRL26        24669      42829916
VRL27        52775      76282254
VRL28        38623      83172166
VRL29        48743      75770043
VRL3         71671      63915284
VRL30        49303      74955805
VRL31        48017      79701046
VRL32        10968      18041497
VRL33        50155      78991416
VRL34        43004      88029374
VRL35        42130      84078160
VRL36        49131      80641493
VRL37        37714      88652139
VRL38        14301      29110102
VRL39        36887      91059587
VRL4         67943      68191452
VRL40        46737      82670769
VRL41        47123      77875163
VRL42        44385      85725228
VRL43        45487      82853236
VRL44        12704      24056536
VRL45        43543      82374309
VRL46        39959      86500216
VRL47        43042      81600337
VRL48        38859      88316045
VRL49        41022      87112739
VRL5         70084      69113534
VRL50        46555      89219227
VRL51        41763      94543038
VRL52        39416      94393066
VRL53        25191      24629537
VRL6         14836      20901579
VRL7         48737      77996724
VRL8         47057      72917106
VRL9         44222      72168562
VRT1         68569      78889512
VRT10        18698      27611221
VRT11        4665       186998276
VRT12        1320       193372782
VRT13        1392       193166295
VRT14        1972       24043127
VRT15        6178       183306713
VRT16        6          194932281
VRT17        6          188047704
VRT18        6          178272280
VRT19        6          182099228
VRT2         1261       194022973
VRT20        6          190882518
VRT21        6          186613478
VRT22        6          174251486
VRT23        6          171948183
VRT24        6          177736655
VRT25        6          171348580
VRT26        7          183326153
VRT27        3104       119066739
VRT28        13371      172470823
VRT29        5827       185181355
VRT3         48995      120867580
VRT30        3801       188841871
VRT31        50379      115915453
VRT32        80341      70121869
VRT33        78383      67166480
VRT34        17741      13172504
VRT35        71643      78576764
VRT36        46289      121994120
VRT37        78077      64136133
VRT38        80344      62687479
VRT39        82627      58572537
VRT4         23844      150993755
VRT40        31168      21780716
VRT41        103617     66611284
VRT42        82265      57033066
VRT43        86492      59164881
VRT44        60180      45045962
VRT45        91422      54873578
VRT46        76910      58753526
VRT47        7664       6457218
VRT48        75782      59206425
VRT49        55945      45152891
VRT5         39355      101844285
VRT50        81733      57689012
VRT51        76239      60002765
VRT52        78993      60827130
VRT53        55771      21808286
VRT54        110430     53368138
VRT55        77848      66939084
VRT56        94880      53798851
VRT57        5110       3709412
VRT58        85680      53720000
VRT59        78712      62600194
VRT6         73315      67144730
VRT60        80074      59461547
VRT61        17716      159855578
VRT62        50         186377607
VRT63        88         177179294
VRT64        163        181176777
VRT65        300        194496566
VRT66        730        193323130
VRT67        2970       190777490
VRT68        58178      140071746
VRT69        33256      3550473
VRT7         1629       3482614
VRT70        145106     21008965
VRT71        75789      25336814
VRT72        13364      176952840
VRT73        11         188688279
VRT74        8          183427060
VRT75        12         195920558
VRT76        10         189393119
VRT77        243        196418294
VRT78        327        196217075
VRT79        2638       194315601
VRT8         32092      64266030
VRT80        2441       194492035
VRT81        10170      174184678
VRT82        9          179667620
VRT83        9          163877519
VRT84        9231       147980717
VRT85        40592      52444310
VRT9         5304       9776020

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 224.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

25572926 19420058409   Homo sapiens
9891124  10240025321   Mus musculus
2199024   6529732216   Rattus norvegicus
2230139   5430142567   Bos taurus
4209312   5245247130   Zea mays
3300401   5074019908   Sus scrofa
1346814   3236120500   Hordeum vulgare subsp. vulgare
1729281   3191157254   Danio rerio
1239293   2836936978   Oryzias latipes
72        2590574434   Ovis canadensis canadensis
746231    2571921828   Solanum lycopersicum
121977    2389905945   Escherichia coli
1933398   2047779648   Triticum aestivum
205441    1836641418   Cyprinus carpio
1379029   1727571180   Oryza sativa Japonica Group
327068    1595510956   Apteryx australis mantelli
258060    1436171698   Strongylocentrotus purpuratus
1639      1435811340   Bordetella pertussis
1273342   1401612053   Drosophila melanogaster
464315    1345433637   Macaca mulatta

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for release prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2018

                NCBI-GenBank Flat File Release 224.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

  The items of information contained in the LOCUS record are always
found in fixed positions. The locus name (or entry name), which is
always sixteen characters or less, begins in position 13. The locus name
is designed to help group entries with similar sequences: the first
three characters usually designate the organism; the fourth and fifth
characters can be used to show other group designations, such as gene
product; for segmented entries the last character is one of a series
of sequential integers.

  The number of bases or base pairs in the sequence ends in position 40.
The letters `bp' are in positions 42 to 43. Positions 45 to 47 provide
the number of strands of the sequence. Positions 48 to 53 indicate the
type of molecule sequenced. Topology of the molecule is indicated in
positions 56 to 63.

  GenBank sequence entries are divided among many different
'divisions'. Each entry's division is specified by a three-letter code
in positions 65 to 67, and these same three-letter codes are used
in the names of the files that make up a GenBank release.

  Positions 69 to 79 of the record contain the date the entry was
entered or underwent any substantial revisions, such as the addition
of newly published data, in the form dd-MMM-yyyy.

The detailed format for the LOCUS line format is as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus name
29-29      space
30-40      Length of sequence, right-justified
41-41      space
42-43      bp
44-44      space
45-47      spaces, ss- (single-stranded), ds- (double-stranded), or
           ms- (mixed-stranded)
48-53      NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      'linear' followed by two spaces, or 'circular'
64-64      space
65-67      The division code
68-68      space
69-79      Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

Legal values for the division code include:

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  Although each of these data values can be found at column-specific
positions, we encourage those who parse the contents of the LOCUS
line to use a token-based approach. This will prevent the need for
software changes if the spacing of the data values ever has to be
modified.

  Note that all non-coding RNA sequences have a molecule type
of 'RNA'. Further information about the specific type of non-coding
RNA can be obtained from the full-length ncRNA feature that will
be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Benson, D. et al, Nucleic Acids Res. 45(D1):D37-D42 (2017)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Jim Ostell, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

User Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell


Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center