Release Notes For GenBank Release 229

GBREL.TXT          Genetic Sequence Data Bank
                         December 15 2018

               NCBI-GenBank Flat File Release 229.0

                    Distribution Release Notes

 211281415 loci, 285688542186 bases, from 211281415 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 229.0
1.2 Cutoff Date
1.3 Important Changes in Release 229.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 229.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 229.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 229.0, incorporates data processed by the INSDC databases
as of Saturday December 15 2018 at approximately 1:33AM EST. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 229.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 55 with this release:

  - the BCT division is now composed of 566 files (+24)
  - the CON division is now composed of 375 files (+3)
  - the ENV division is now composed of 105 files (+2)
  - the EST division is now composed of 489 files (+3)
  - the INV division is now composed of 117 files (+5)
  - the PAT division is now composed of 347 files (+7)
  - the PLN division is now composed of 241 files (+9)
  - the VRL division is now composed of  59 files (+1)
  - the VRT division is now composed of  95 files (+1)

1.3.2 GSS File Header Problem

  GSS sequences at GenBank are maintained in two different systems, depending
on their origin, and the dumps from those systems occur in parallel. Because
the second dump (for example) has no prior knowledge of exactly how many GSS
files will be dumped by the first, it does not know how to number its own
output files.

  There is thus a discrepancy between the filenames and file headers for 130
of the GSS flatfiles in Release 229.0. Consider gbgss179.seq :

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2018

                NCBI-GenBank Flat File Release 229.0

                           GSS Sequences (Part 1)

   87375 loci,    64103840 bases, from    87375 reported sequences

  Here, the filename and part number in the header is "1", though the file
has been renamed as "179" based on the number of files dumped from the other
system. Files gbgss179.seq.gz through gbgss308.seq.gz are affected. We hope
to resolve this discrepancy at some point, but the priority is certainly
much lower than many other tasks.

1.4 Upcoming Changes

1.4.1 Changes to nucleotide and protein accession formats

  The accession format used for Whole Genome Shotgun (WGS), Transcriptome
Shotgun Assembly (TSA), and Targeted Locus Study (TLS) sequencing projects
consists of a four-letter Project Code prefix, a two-digit Assembly-Version
number, followed by 6, 7, or 8 digits (depending on the number of sequences
in the project).

  By the end of 2018 the INSDC members plan to expand this format, using
a six-letter Project Code prefix, two-digit Assembly-Version number, followed
by 7, 8, or 9 digits. An example of such an accession is AAAAAA020000001 .

  Non-WGS/TLS/TSA nucleotide sequences currently make use of a "2+6"
accession format, consisting of a two-letter prefix followed by six digits.
This format will be expanded to make use of eight digits, allowing accession
ranges that have been exhausted (eg: JG000001-JG999999) to be "re-opened"
(eg: JG00000001-JG99999999).

  Protein sequences currently make use of a "3+5" accession format, consisting
of a three-letter prefix followed by five digits. This format will be expanded
to make use of seven digits, allowing exhausted protein accession ranges such
as EZZ00001-EZZ99999 to be re-opened as EZZ0000001-EZZ9999999.

  The earliest date on which these new accessions could begin to appear for
GenBank sequences is December 21st 2018.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 3291 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct513.seq - Bacterial sequence entries, part 513.
462. gbbct514.seq - Bacterial sequence entries, part 514.
463. gbbct515.seq - Bacterial sequence entries, part 515.
464. gbbct516.seq - Bacterial sequence entries, part 516.
465. gbbct517.seq - Bacterial sequence entries, part 517.
466. gbbct518.seq - Bacterial sequence entries, part 518.
467. gbbct519.seq - Bacterial sequence entries, part 519.
468. gbbct52.seq - Bacterial sequence entries, part 52.
469. gbbct520.seq - Bacterial sequence entries, part 520.
470. gbbct521.seq - Bacterial sequence entries, part 521.
471. gbbct522.seq - Bacterial sequence entries, part 522.
472. gbbct523.seq - Bacterial sequence entries, part 523.
473. gbbct524.seq - Bacterial sequence entries, part 524.
474. gbbct525.seq - Bacterial sequence entries, part 525.
475. gbbct526.seq - Bacterial sequence entries, part 526.
476. gbbct527.seq - Bacterial sequence entries, part 527.
477. gbbct528.seq - Bacterial sequence entries, part 528.
478. gbbct529.seq - Bacterial sequence entries, part 529.
479. gbbct53.seq - Bacterial sequence entries, part 53.
480. gbbct530.seq - Bacterial sequence entries, part 530.
481. gbbct531.seq - Bacterial sequence entries, part 531.
482. gbbct532.seq - Bacterial sequence entries, part 532.
483. gbbct533.seq - Bacterial sequence entries, part 533.
484. gbbct534.seq - Bacterial sequence entries, part 534.
485. gbbct535.seq - Bacterial sequence entries, part 535.
486. gbbct536.seq - Bacterial sequence entries, part 536.
487. gbbct537.seq - Bacterial sequence entries, part 537.
488. gbbct538.seq - Bacterial sequence entries, part 538.
489. gbbct539.seq - Bacterial sequence entries, part 539.
490. gbbct54.seq - Bacterial sequence entries, part 54.
491. gbbct540.seq - Bacterial sequence entries, part 540.
492. gbbct541.seq - Bacterial sequence entries, part 541.
493. gbbct542.seq - Bacterial sequence entries, part 542.
494. gbbct543.seq - Bacterial sequence entries, part 543.
495. gbbct544.seq - Bacterial sequence entries, part 544.
496. gbbct545.seq - Bacterial sequence entries, part 545.
497. gbbct546.seq - Bacterial sequence entries, part 546.
498. gbbct547.seq - Bacterial sequence entries, part 547.
499. gbbct548.seq - Bacterial sequence entries, part 548.
500. gbbct549.seq - Bacterial sequence entries, part 549.
501. gbbct55.seq - Bacterial sequence entries, part 55.
502. gbbct550.seq - Bacterial sequence entries, part 550.
503. gbbct551.seq - Bacterial sequence entries, part 551.
504. gbbct552.seq - Bacterial sequence entries, part 552.
505. gbbct553.seq - Bacterial sequence entries, part 553.
506. gbbct554.seq - Bacterial sequence entries, part 554.
507. gbbct555.seq - Bacterial sequence entries, part 555.
508. gbbct556.seq - Bacterial sequence entries, part 556.
509. gbbct557.seq - Bacterial sequence entries, part 557.
510. gbbct558.seq - Bacterial sequence entries, part 558.
511. gbbct559.seq - Bacterial sequence entries, part 559.
512. gbbct56.seq - Bacterial sequence entries, part 56.
513. gbbct560.seq - Bacterial sequence entries, part 560.
514. gbbct561.seq - Bacterial sequence entries, part 561.
515. gbbct562.seq - Bacterial sequence entries, part 562.
516. gbbct563.seq - Bacterial sequence entries, part 563.
517. gbbct564.seq - Bacterial sequence entries, part 564.
518. gbbct565.seq - Bacterial sequence entries, part 565.
519. gbbct566.seq - Bacterial sequence entries, part 566.
520. gbbct57.seq - Bacterial sequence entries, part 57.
521. gbbct58.seq - Bacterial sequence entries, part 58.
522. gbbct59.seq - Bacterial sequence entries, part 59.
523. gbbct6.seq - Bacterial sequence entries, part 6.
524. gbbct60.seq - Bacterial sequence entries, part 60.
525. gbbct61.seq - Bacterial sequence entries, part 61.
526. gbbct62.seq - Bacterial sequence entries, part 62.
527. gbbct63.seq - Bacterial sequence entries, part 63.
528. gbbct64.seq - Bacterial sequence entries, part 64.
529. gbbct65.seq - Bacterial sequence entries, part 65.
530. gbbct66.seq - Bacterial sequence entries, part 66.
531. gbbct67.seq - Bacterial sequence entries, part 67.
532. gbbct68.seq - Bacterial sequence entries, part 68.
533. gbbct69.seq - Bacterial sequence entries, part 69.
534. gbbct7.seq - Bacterial sequence entries, part 7.
535. gbbct70.seq - Bacterial sequence entries, part 70.
536. gbbct71.seq - Bacterial sequence entries, part 71.
537. gbbct72.seq - Bacterial sequence entries, part 72.
538. gbbct73.seq - Bacterial sequence entries, part 73.
539. gbbct74.seq - Bacterial sequence entries, part 74.
540. gbbct75.seq - Bacterial sequence entries, part 75.
541. gbbct76.seq - Bacterial sequence entries, part 76.
542. gbbct77.seq - Bacterial sequence entries, part 77.
543. gbbct78.seq - Bacterial sequence entries, part 78.
544. gbbct79.seq - Bacterial sequence entries, part 79.
545. gbbct8.seq - Bacterial sequence entries, part 8.
546. gbbct80.seq - Bacterial sequence entries, part 80.
547. gbbct81.seq - Bacterial sequence entries, part 81.
548. gbbct82.seq - Bacterial sequence entries, part 82.
549. gbbct83.seq - Bacterial sequence entries, part 83.
550. gbbct84.seq - Bacterial sequence entries, part 84.
551. gbbct85.seq - Bacterial sequence entries, part 85.
552. gbbct86.seq - Bacterial sequence entries, part 86.
553. gbbct87.seq - Bacterial sequence entries, part 87.
554. gbbct88.seq - Bacterial sequence entries, part 88.
555. gbbct89.seq - Bacterial sequence entries, part 89.
556. gbbct9.seq - Bacterial sequence entries, part 9.
557. gbbct90.seq - Bacterial sequence entries, part 90.
558. gbbct91.seq - Bacterial sequence entries, part 91.
559. gbbct92.seq - Bacterial sequence entries, part 92.
560. gbbct93.seq - Bacterial sequence entries, part 93.
561. gbbct94.seq - Bacterial sequence entries, part 94.
562. gbbct95.seq - Bacterial sequence entries, part 95.
563. gbbct96.seq - Bacterial sequence entries, part 96.
564. gbbct97.seq - Bacterial sequence entries, part 97.
565. gbbct98.seq - Bacterial sequence entries, part 98.
566. gbbct99.seq - Bacterial sequence entries, part 99.
567. gbchg.txt - Accession numbers of entries updated since the previous release.
568. gbcon1.seq - Constructed sequence entries, part 1.
569. gbcon10.seq - Constructed sequence entries, part 10.
570. gbcon100.seq - Constructed sequence entries, part 100.
571. gbcon101.seq - Constructed sequence entries, part 101.
572. gbcon102.seq - Constructed sequence entries, part 102.
573. gbcon103.seq - Constructed sequence entries, part 103.
574. gbcon104.seq - Constructed sequence entries, part 104.
575. gbcon105.seq - Constructed sequence entries, part 105.
576. gbcon106.seq - Constructed sequence entries, part 106.
577. gbcon107.seq - Constructed sequence entries, part 107.
578. gbcon108.seq - Constructed sequence entries, part 108.
579. gbcon109.seq - Constructed sequence entries, part 109.
580. gbcon11.seq - Constructed sequence entries, part 11.
581. gbcon110.seq - Constructed sequence entries, part 110.
582. gbcon111.seq - Constructed sequence entries, part 111.
583. gbcon112.seq - Constructed sequence entries, part 112.
584. gbcon113.seq - Constructed sequence entries, part 113.
585. gbcon114.seq - Constructed sequence entries, part 114.
586. gbcon115.seq - Constructed sequence entries, part 115.
587. gbcon116.seq - Constructed sequence entries, part 116.
588. gbcon117.seq - Constructed sequence entries, part 117.
589. gbcon118.seq - Constructed sequence entries, part 118.
590. gbcon119.seq - Constructed sequence entries, part 119.
591. gbcon12.seq - Constructed sequence entries, part 12.
592. gbcon120.seq - Constructed sequence entries, part 120.
593. gbcon121.seq - Constructed sequence entries, part 121.
594. gbcon122.seq - Constructed sequence entries, part 122.
595. gbcon123.seq - Constructed sequence entries, part 123.
596. gbcon124.seq - Constructed sequence entries, part 124.
597. gbcon125.seq - Constructed sequence entries, part 125.
598. gbcon126.seq - Constructed sequence entries, part 126.
599. gbcon127.seq - Constructed sequence entries, part 127.
600. gbcon128.seq - Constructed sequence entries, part 128.
601. gbcon129.seq - Constructed sequence entries, part 129.
602. gbcon13.seq - Constructed sequence entries, part 13.
603. gbcon130.seq - Constructed sequence entries, part 130.
604. gbcon131.seq - Constructed sequence entries, part 131.
605. gbcon132.seq - Constructed sequence entries, part 132.
606. gbcon133.seq - Constructed sequence entries, part 133.
607. gbcon134.seq - Constructed sequence entries, part 134.
608. gbcon135.seq - Constructed sequence entries, part 135.
609. gbcon136.seq - Constructed sequence entries, part 136.
610. gbcon137.seq - Constructed sequence entries, part 137.
611. gbcon138.seq - Constructed sequence entries, part 138.
612. gbcon139.seq - Constructed sequence entries, part 139.
613. gbcon14.seq - Constructed sequence entries, part 14.
614. gbcon140.seq - Constructed sequence entries, part 140.
615. gbcon141.seq - Constructed sequence entries, part 141.
616. gbcon142.seq - Constructed sequence entries, part 142.
617. gbcon143.seq - Constructed sequence entries, part 143.
618. gbcon144.seq - Constructed sequence entries, part 144.
619. gbcon145.seq - Constructed sequence entries, part 145.
620. gbcon146.seq - Constructed sequence entries, part 146.
621. gbcon147.seq - Constructed sequence entries, part 147.
622. gbcon148.seq - Constructed sequence entries, part 148.
623. gbcon149.seq - Constructed sequence entries, part 149.
624. gbcon15.seq - Constructed sequence entries, part 15.
625. gbcon150.seq - Constructed sequence entries, part 150.
626. gbcon151.seq - Constructed sequence entries, part 151.
627. gbcon152.seq - Constructed sequence entries, part 152.
628. gbcon153.seq - Constructed sequence entries, part 153.
629. gbcon154.seq - Constructed sequence entries, part 154.
630. gbcon155.seq - Constructed sequence entries, part 155.
631. gbcon156.seq - Constructed sequence entries, part 156.
632. gbcon157.seq - Constructed sequence entries, part 157.
633. gbcon158.seq - Constructed sequence entries, part 158.
634. gbcon159.seq - Constructed sequence entries, part 159.
635. gbcon16.seq - Constructed sequence entries, part 16.
636. gbcon160.seq - Constructed sequence entries, part 160.
637. gbcon161.seq - Constructed sequence entries, part 161.
638. gbcon162.seq - Constructed sequence entries, part 162.
639. gbcon163.seq - Constructed sequence entries, part 163.
640. gbcon164.seq - Constructed sequence entries, part 164.
641. gbcon165.seq - Constructed sequence entries, part 165.
642. gbcon166.seq - Constructed sequence entries, part 166.
643. gbcon167.seq - Constructed sequence entries, part 167.
644. gbcon168.seq - Constructed sequence entries, part 168.
645. gbcon169.seq - Constructed sequence entries, part 169.
646. gbcon17.seq - Constructed sequence entries, part 17.
647. gbcon170.seq - Constructed sequence entries, part 170.
648. gbcon171.seq - Constructed sequence entries, part 171.
649. gbcon172.seq - Constructed sequence entries, part 172.
650. gbcon173.seq - Constructed sequence entries, part 173.
651. gbcon174.seq - Constructed sequence entries, part 174.
652. gbcon175.seq - Constructed sequence entries, part 175.
653. gbcon176.seq - Constructed sequence entries, part 176.
654. gbcon177.seq - Constructed sequence entries, part 177.
655. gbcon178.seq - Constructed sequence entries, part 178.
656. gbcon179.seq - Constructed sequence entries, part 179.
657. gbcon18.seq - Constructed sequence entries, part 18.
658. gbcon180.seq - Constructed sequence entries, part 180.
659. gbcon181.seq - Constructed sequence entries, part 181.
660. gbcon182.seq - Constructed sequence entries, part 182.
661. gbcon183.seq - Constructed sequence entries, part 183.
662. gbcon184.seq - Constructed sequence entries, part 184.
663. gbcon185.seq - Constructed sequence entries, part 185.
664. gbcon186.seq - Constructed sequence entries, part 186.
665. gbcon187.seq - Constructed sequence entries, part 187.
666. gbcon188.seq - Constructed sequence entries, part 188.
667. gbcon189.seq - Constructed sequence entries, part 189.
668. gbcon19.seq - Constructed sequence entries, part 19.
669. gbcon190.seq - Constructed sequence entries, part 190.
670. gbcon191.seq - Constructed sequence entries, part 191.
671. gbcon192.seq - Constructed sequence entries, part 192.
672. gbcon193.seq - Constructed sequence entries, part 193.
673. gbcon194.seq - Constructed sequence entries, part 194.
674. gbcon195.seq - Constructed sequence entries, part 195.
675. gbcon196.seq - Constructed sequence entries, part 196.
676. gbcon197.seq - Constructed sequence entries, part 197.
677. gbcon198.seq - Constructed sequence entries, part 198.
678. gbcon199.seq - Constructed sequence entries, part 199.
679. gbcon2.seq - Constructed sequence entries, part 2.
680. gbcon20.seq - Constructed sequence entries, part 20.
681. gbcon200.seq - Constructed sequence entries, part 200.
682. gbcon201.seq - Constructed sequence entries, part 201.
683. gbcon202.seq - Constructed sequence entries, part 202.
684. gbcon203.seq - Constructed sequence entries, part 203.
685. gbcon204.seq - Constructed sequence entries, part 204.
686. gbcon205.seq - Constructed sequence entries, part 205.
687. gbcon206.seq - Constructed sequence entries, part 206.
688. gbcon207.seq - Constructed sequence entries, part 207.
689. gbcon208.seq - Constructed sequence entries, part 208.
690. gbcon209.seq - Constructed sequence entries, part 209.
691. gbcon21.seq - Constructed sequence entries, part 21.
692. gbcon210.seq - Constructed sequence entries, part 210.
693. gbcon211.seq - Constructed sequence entries, part 211.
694. gbcon212.seq - Constructed sequence entries, part 212.
695. gbcon213.seq - Constructed sequence entries, part 213.
696. gbcon214.seq - Constructed sequence entries, part 214.
697. gbcon215.seq - Constructed sequence entries, part 215.
698. gbcon216.seq - Constructed sequence entries, part 216.
699. gbcon217.seq - Constructed sequence entries, part 217.
700. gbcon218.seq - Constructed sequence entries, part 218.
701. gbcon219.seq - Constructed sequence entries, part 219.
702. gbcon22.seq - Constructed sequence entries, part 22.
703. gbcon220.seq - Constructed sequence entries, part 220.
704. gbcon221.seq - Constructed sequence entries, part 221.
705. gbcon222.seq - Constructed sequence entries, part 222.
706. gbcon223.seq - Constructed sequence entries, part 223.
707. gbcon224.seq - Constructed sequence entries, part 224.
708. gbcon225.seq - Constructed sequence entries, part 225.
709. gbcon226.seq - Constructed sequence entries, part 226.
710. gbcon227.seq - Constructed sequence entries, part 227.
711. gbcon228.seq - Constructed sequence entries, part 228.
712. gbcon229.seq - Constructed sequence entries, part 229.
713. gbcon23.seq - Constructed sequence entries, part 23.
714. gbcon230.seq - Constructed sequence entries, part 230.
715. gbcon231.seq - Constructed sequence entries, part 231.
716. gbcon232.seq - Constructed sequence entries, part 232.
717. gbcon233.seq - Constructed sequence entries, part 233.
718. gbcon234.seq - Constructed sequence entries, part 234.
719. gbcon235.seq - Constructed sequence entries, part 235.
720. gbcon236.seq - Constructed sequence entries, part 236.
721. gbcon237.seq - Constructed sequence entries, part 237.
722. gbcon238.seq - Constructed sequence entries, part 238.
723. gbcon239.seq - Constructed sequence entries, part 239.
724. gbcon24.seq - Constructed sequence entries, part 24.
725. gbcon240.seq - Constructed sequence entries, part 240.
726. gbcon241.seq - Constructed sequence entries, part 241.
727. gbcon242.seq - Constructed sequence entries, part 242.
728. gbcon243.seq - Constructed sequence entries, part 243.
729. gbcon244.seq - Constructed sequence entries, part 244.
730. gbcon245.seq - Constructed sequence entries, part 245.
731. gbcon246.seq - Constructed sequence entries, part 246.
732. gbcon247.seq - Constructed sequence entries, part 247.
733. gbcon248.seq - Constructed sequence entries, part 248.
734. gbcon249.seq - Constructed sequence entries, part 249.
735. gbcon25.seq - Constructed sequence entries, part 25.
736. gbcon250.seq - Constructed sequence entries, part 250.
737. gbcon251.seq - Constructed sequence entries, part 251.
738. gbcon252.seq - Constructed sequence entries, part 252.
739. gbcon253.seq - Constructed sequence entries, part 253.
740. gbcon254.seq - Constructed sequence entries, part 254.
741. gbcon255.seq - Constructed sequence entries, part 255.
742. gbcon256.seq - Constructed sequence entries, part 256.
743. gbcon257.seq - Constructed sequence entries, part 257.
744. gbcon258.seq - Constructed sequence entries, part 258.
745. gbcon259.seq - Constructed sequence entries, part 259.
746. gbcon26.seq - Constructed sequence entries, part 26.
747. gbcon260.seq - Constructed sequence entries, part 260.
748. gbcon261.seq - Constructed sequence entries, part 261.
749. gbcon262.seq - Constructed sequence entries, part 262.
750. gbcon263.seq - Constructed sequence entries, part 263.
751. gbcon264.seq - Constructed sequence entries, part 264.
752. gbcon265.seq - Constructed sequence entries, part 265.
753. gbcon266.seq - Constructed sequence entries, part 266.
754. gbcon267.seq - Constructed sequence entries, part 267.
755. gbcon268.seq - Constructed sequence entries, part 268.
756. gbcon269.seq - Constructed sequence entries, part 269.
757. gbcon27.seq - Constructed sequence entries, part 27.
758. gbcon270.seq - Constructed sequence entries, part 270.
759. gbcon271.seq - Constructed sequence entries, part 271.
760. gbcon272.seq - Constructed sequence entries, part 272.
761. gbcon273.seq - Constructed sequence entries, part 273.
762. gbcon274.seq - Constructed sequence entries, part 274.
763. gbcon275.seq - Constructed sequence entries, part 275.
764. gbcon276.seq - Constructed sequence entries, part 276.
765. gbcon277.seq - Constructed sequence entries, part 277.
766. gbcon278.seq - Constructed sequence entries, part 278.
767. gbcon279.seq - Constructed sequence entries, part 279.
768. gbcon28.seq - Constructed sequence entries, part 28.
769. gbcon280.seq - Constructed sequence entries, part 280.
770. gbcon281.seq - Constructed sequence entries, part 281.
771. gbcon282.seq - Constructed sequence entries, part 282.
772. gbcon283.seq - Constructed sequence entries, part 283.
773. gbcon284.seq - Constructed sequence entries, part 284.
774. gbcon285.seq - Constructed sequence entries, part 285.
775. gbcon286.seq - Constructed sequence entries, part 286.
776. gbcon287.seq - Constructed sequence entries, part 287.
777. gbcon288.seq - Constructed sequence entries, part 288.
778. gbcon289.seq - Constructed sequence entries, part 289.
779. gbcon29.seq - Constructed sequence entries, part 29.
780. gbcon290.seq - Constructed sequence entries, part 290.
781. gbcon291.seq - Constructed sequence entries, part 291.
782. gbcon292.seq - Constructed sequence entries, part 292.
783. gbcon293.seq - Constructed sequence entries, part 293.
784. gbcon294.seq - Constructed sequence entries, part 294.
785. gbcon295.seq - Constructed sequence entries, part 295.
786. gbcon296.seq - Constructed sequence entries, part 296.
787. gbcon297.seq - Constructed sequence entries, part 297.
788. gbcon298.seq - Constructed sequence entries, part 298.
789. gbcon299.seq - Constructed sequence entries, part 299.
790. gbcon3.seq - Constructed sequence entries, part 3.
791. gbcon30.seq - Constructed sequence entries, part 30.
792. gbcon300.seq - Constructed sequence entries, part 300.
793. gbcon301.seq - Constructed sequence entries, part 301.
794. gbcon302.seq - Constructed sequence entries, part 302.
795. gbcon303.seq - Constructed sequence entries, part 303.
796. gbcon304.seq - Constructed sequence entries, part 304.
797. gbcon305.seq - Constructed sequence entries, part 305.
798. gbcon306.seq - Constructed sequence entries, part 306.
799. gbcon307.seq - Constructed sequence entries, part 307.
800. gbcon308.seq - Constructed sequence entries, part 308.
801. gbcon309.seq - Constructed sequence entries, part 309.
802. gbcon31.seq - Constructed sequence entries, part 31.
803. gbcon310.seq - Constructed sequence entries, part 310.
804. gbcon311.seq - Constructed sequence entries, part 311.
805. gbcon312.seq - Constructed sequence entries, part 312.
806. gbcon313.seq - Constructed sequence entries, part 313.
807. gbcon314.seq - Constructed sequence entries, part 314.
808. gbcon315.seq - Constructed sequence entries, part 315.
809. gbcon316.seq - Constructed sequence entries, part 316.
810. gbcon317.seq - Constructed sequence entries, part 317.
811. gbcon318.seq - Constructed sequence entries, part 318.
812. gbcon319.seq - Constructed sequence entries, part 319.
813. gbcon32.seq - Constructed sequence entries, part 32.
814. gbcon320.seq - Constructed sequence entries, part 320.
815. gbcon321.seq - Constructed sequence entries, part 321.
816. gbcon322.seq - Constructed sequence entries, part 322.
817. gbcon323.seq - Constructed sequence entries, part 323.
818. gbcon324.seq - Constructed sequence entries, part 324.
819. gbcon325.seq - Constructed sequence entries, part 325.
820. gbcon326.seq - Constructed sequence entries, part 326.
821. gbcon327.seq - Constructed sequence entries, part 327.
822. gbcon328.seq - Constructed sequence entries, part 328.
823. gbcon329.seq - Constructed sequence entries, part 329.
824. gbcon33.seq - Constructed sequence entries, part 33.
825. gbcon330.seq - Constructed sequence entries, part 330.
826. gbcon331.seq - Constructed sequence entries, part 331.
827. gbcon332.seq - Constructed sequence entries, part 332.
828. gbcon333.seq - Constructed sequence entries, part 333.
829. gbcon334.seq - Constructed sequence entries, part 334.
830. gbcon335.seq - Constructed sequence entries, part 335.
831. gbcon336.seq - Constructed sequence entries, part 336.
832. gbcon337.seq - Constructed sequence entries, part 337.
833. gbcon338.seq - Constructed sequence entries, part 338.
834. gbcon339.seq - Constructed sequence entries, part 339.
835. gbcon34.seq - Constructed sequence entries, part 34.
836. gbcon340.seq - Constructed sequence entries, part 340.
837. gbcon341.seq - Constructed sequence entries, part 341.
838. gbcon342.seq - Constructed sequence entries, part 342.
839. gbcon343.seq - Constructed sequence entries, part 343.
840. gbcon344.seq - Constructed sequence entries, part 344.
841. gbcon345.seq - Constructed sequence entries, part 345.
842. gbcon346.seq - Constructed sequence entries, part 346.
843. gbcon347.seq - Constructed sequence entries, part 347.
844. gbcon348.seq - Constructed sequence entries, part 348.
845. gbcon349.seq - Constructed sequence entries, part 349.
846. gbcon35.seq - Constructed sequence entries, part 35.
847. gbcon350.seq - Constructed sequence entries, part 350.
848. gbcon351.seq - Constructed sequence entries, part 351.
849. gbcon352.seq - Constructed sequence entries, part 352.
850. gbcon353.seq - Constructed sequence entries, part 353.
851. gbcon354.seq - Constructed sequence entries, part 354.
852. gbcon355.seq - Constructed sequence entries, part 355.
853. gbcon356.seq - Constructed sequence entries, part 356.
854. gbcon357.seq - Constructed sequence entries, part 357.
855. gbcon358.seq - Constructed sequence entries, part 358.
856. gbcon359.seq - Constructed sequence entries, part 359.
857. gbcon36.seq - Constructed sequence entries, part 36.
858. gbcon360.seq - Constructed sequence entries, part 360.
859. gbcon361.seq - Constructed sequence entries, part 361.
860. gbcon362.seq - Constructed sequence entries, part 362.
861. gbcon363.seq - Constructed sequence entries, part 363.
862. gbcon364.seq - Constructed sequence entries, part 364.
863. gbcon365.seq - Constructed sequence entries, part 365.
864. gbcon366.seq - Constructed sequence entries, part 366.
865. gbcon367.seq - Constructed sequence entries, part 367.
866. gbcon368.seq - Constructed sequence entries, part 368.
867. gbcon369.seq - Constructed sequence entries, part 369.
868. gbcon37.seq - Constructed sequence entries, part 37.
869. gbcon370.seq - Constructed sequence entries, part 370.
870. gbcon371.seq - Constructed sequence entries, part 371.
871. gbcon372.seq - Constructed sequence entries, part 372.
872. gbcon373.seq - Constructed sequence entries, part 373.
873. gbcon374.seq - Constructed sequence entries, part 374.
874. gbcon375.seq - Constructed sequence entries, part 375.
875. gbcon38.seq - Constructed sequence entries, part 38.
876. gbcon39.seq - Constructed sequence entries, part 39.
877. gbcon4.seq - Constructed sequence entries, part 4.
878. gbcon40.seq - Constructed sequence entries, part 40.
879. gbcon41.seq - Constructed sequence entries, part 41.
880. gbcon42.seq - Constructed sequence entries, part 42.
881. gbcon43.seq - Constructed sequence entries, part 43.
882. gbcon44.seq - Constructed sequence entries, part 44.
883. gbcon45.seq - Constructed sequence entries, part 45.
884. gbcon46.seq - Constructed sequence entries, part 46.
885. gbcon47.seq - Constructed sequence entries, part 47.
886. gbcon48.seq - Constructed sequence entries, part 48.
887. gbcon49.seq - Constructed sequence entries, part 49.
888. gbcon5.seq - Constructed sequence entries, part 5.
889. gbcon50.seq - Constructed sequence entries, part 50.
890. gbcon51.seq - Constructed sequence entries, part 51.
891. gbcon52.seq - Constructed sequence entries, part 52.
892. gbcon53.seq - Constructed sequence entries, part 53.
893. gbcon54.seq - Constructed sequence entries, part 54.
894. gbcon55.seq - Constructed sequence entries, part 55.
895. gbcon56.seq - Constructed sequence entries, part 56.
896. gbcon57.seq - Constructed sequence entries, part 57.
897. gbcon58.seq - Constructed sequence entries, part 58.
898. gbcon59.seq - Constructed sequence entries, part 59.
899. gbcon6.seq - Constructed sequence entries, part 6.
900. gbcon60.seq - Constructed sequence entries, part 60.
901. gbcon61.seq - Constructed sequence entries, part 61.
902. gbcon62.seq - Constructed sequence entries, part 62.
903. gbcon63.seq - Constructed sequence entries, part 63.
904. gbcon64.seq - Constructed sequence entries, part 64.
905. gbcon65.seq - Constructed sequence entries, part 65.
906. gbcon66.seq - Constructed sequence entries, part 66.
907. gbcon67.seq - Constructed sequence entries, part 67.
908. gbcon68.seq - Constructed sequence entries, part 68.
909. gbcon69.seq - Constructed sequence entries, part 69.
910. gbcon7.seq - Constructed sequence entries, part 7.
911. gbcon70.seq - Constructed sequence entries, part 70.
912. gbcon71.seq - Constructed sequence entries, part 71.
913. gbcon72.seq - Constructed sequence entries, part 72.
914. gbcon73.seq - Constructed sequence entries, part 73.
915. gbcon74.seq - Constructed sequence entries, part 74.
916. gbcon75.seq - Constructed sequence entries, part 75.
917. gbcon76.seq - Constructed sequence entries, part 76.
918. gbcon77.seq - Constructed sequence entries, part 77.
919. gbcon78.seq - Constructed sequence entries, part 78.
920. gbcon79.seq - Constructed sequence entries, part 79.
921. gbcon8.seq - Constructed sequence entries, part 8.
922. gbcon80.seq - Constructed sequence entries, part 80.
923. gbcon81.seq - Constructed sequence entries, part 81.
924. gbcon82.seq - Constructed sequence entries, part 82.
925. gbcon83.seq - Constructed sequence entries, part 83.
926. gbcon84.seq - Constructed sequence entries, part 84.
927. gbcon85.seq - Constructed sequence entries, part 85.
928. gbcon86.seq - Constructed sequence entries, part 86.
929. gbcon87.seq - Constructed sequence entries, part 87.
930. gbcon88.seq - Constructed sequence entries, part 88.
931. gbcon89.seq - Constructed sequence entries, part 89.
932. gbcon9.seq - Constructed sequence entries, part 9.
933. gbcon90.seq - Constructed sequence entries, part 90.
934. gbcon91.seq - Constructed sequence entries, part 91.
935. gbcon92.seq - Constructed sequence entries, part 92.
936. gbcon93.seq - Constructed sequence entries, part 93.
937. gbcon94.seq - Constructed sequence entries, part 94.
938. gbcon95.seq - Constructed sequence entries, part 95.
939. gbcon96.seq - Constructed sequence entries, part 96.
940. gbcon97.seq - Constructed sequence entries, part 97.
941. gbcon98.seq - Constructed sequence entries, part 98.
942. gbcon99.seq - Constructed sequence entries, part 99.
943. gbdel.txt - Accession numbers of entries deleted since the previous release.
944. gbenv1.seq - Environmental sampling sequence entries, part 1.
945. gbenv10.seq - Environmental sampling sequence entries, part 10.
946. gbenv100.seq - Environmental sampling sequence entries, part 100.
947. gbenv101.seq - Environmental sampling sequence entries, part 101.
948. gbenv102.seq - Environmental sampling sequence entries, part 102.
949. gbenv103.seq - Environmental sampling sequence entries, part 103.
950. gbenv104.seq - Environmental sampling sequence entries, part 104.
951. gbenv105.seq - Environmental sampling sequence entries, part 105.
952. gbenv11.seq - Environmental sampling sequence entries, part 11.
953. gbenv12.seq - Environmental sampling sequence entries, part 12.
954. gbenv13.seq - Environmental sampling sequence entries, part 13.
955. gbenv14.seq - Environmental sampling sequence entries, part 14.
956. gbenv15.seq - Environmental sampling sequence entries, part 15.
957. gbenv16.seq - Environmental sampling sequence entries, part 16.
958. gbenv17.seq - Environmental sampling sequence entries, part 17.
959. gbenv18.seq - Environmental sampling sequence entries, part 18.
960. gbenv19.seq - Environmental sampling sequence entries, part 19.
961. gbenv2.seq - Environmental sampling sequence entries, part 2.
962. gbenv20.seq - Environmental sampling sequence entries, part 20.
963. gbenv21.seq - Environmental sampling sequence entries, part 21.
964. gbenv22.seq - Environmental sampling sequence entries, part 22.
965. gbenv23.seq - Environmental sampling sequence entries, part 23.
966. gbenv24.seq - Environmental sampling sequence entries, part 24.
967. gbenv25.seq - Environmental sampling sequence entries, part 25.
968. gbenv26.seq - Environmental sampling sequence entries, part 26.
969. gbenv27.seq - Environmental sampling sequence entries, part 27.
970. gbenv28.seq - Environmental sampling sequence entries, part 28.
971. gbenv29.seq - Environmental sampling sequence entries, part 29.
972. gbenv3.seq - Environmental sampling sequence entries, part 3.
973. gbenv30.seq - Environmental sampling sequence entries, part 30.
974. gbenv31.seq - Environmental sampling sequence entries, part 31.
975. gbenv32.seq - Environmental sampling sequence entries, part 32.
976. gbenv33.seq - Environmental sampling sequence entries, part 33.
977. gbenv34.seq - Environmental sampling sequence entries, part 34.
978. gbenv35.seq - Environmental sampling sequence entries, part 35.
979. gbenv36.seq - Environmental sampling sequence entries, part 36.
980. gbenv37.seq - Environmental sampling sequence entries, part 37.
981. gbenv38.seq - Environmental sampling sequence entries, part 38.
982. gbenv39.seq - Environmental sampling sequence entries, part 39.
983. gbenv4.seq - Environmental sampling sequence entries, part 4.
984. gbenv40.seq - Environmental sampling sequence entries, part 40.
985. gbenv41.seq - Environmental sampling sequence entries, part 41.
986. gbenv42.seq - Environmental sampling sequence entries, part 42.
987. gbenv43.seq - Environmental sampling sequence entries, part 43.
988. gbenv44.seq - Environmental sampling sequence entries, part 44.
989. gbenv45.seq - Environmental sampling sequence entries, part 45.
990. gbenv46.seq - Environmental sampling sequence entries, part 46.
991. gbenv47.seq - Environmental sampling sequence entries, part 47.
992. gbenv48.seq - Environmental sampling sequence entries, part 48.
993. gbenv49.seq - Environmental sampling sequence entries, part 49.
994. gbenv5.seq - Environmental sampling sequence entries, part 5.
995. gbenv50.seq - Environmental sampling sequence entries, part 50.
996. gbenv51.seq - Environmental sampling sequence entries, part 51.
997. gbenv52.seq - Environmental sampling sequence entries, part 52.
998. gbenv53.seq - Environmental sampling sequence entries, part 53.
999. gbenv54.seq - Environmental sampling sequence entries, part 54.
1000. gbenv55.seq - Environmental sampling sequence entries, part 55.
1001. gbenv56.seq - Environmental sampling sequence entries, part 56.
1002. gbenv57.seq - Environmental sampling sequence entries, part 57.
1003. gbenv58.seq - Environmental sampling sequence entries, part 58.
1004. gbenv59.seq - Environmental sampling sequence entries, part 59.
1005. gbenv6.seq - Environmental sampling sequence entries, part 6.
1006. gbenv60.seq - Environmental sampling sequence entries, part 60.
1007. gbenv61.seq - Environmental sampling sequence entries, part 61.
1008. gbenv62.seq - Environmental sampling sequence entries, part 62.
1009. gbenv63.seq - Environmental sampling sequence entries, part 63.
1010. gbenv64.seq - Environmental sampling sequence entries, part 64.
1011. gbenv65.seq - Environmental sampling sequence entries, part 65.
1012. gbenv66.seq - Environmental sampling sequence entries, part 66.
1013. gbenv67.seq - Environmental sampling sequence entries, part 67.
1014. gbenv68.seq - Environmental sampling sequence entries, part 68.
1015. gbenv69.seq - Environmental sampling sequence entries, part 69.
1016. gbenv7.seq - Environmental sampling sequence entries, part 7.
1017. gbenv70.seq - Environmental sampling sequence entries, part 70.
1018. gbenv71.seq - Environmental sampling sequence entries, part 71.
1019. gbenv72.seq - Environmental sampling sequence entries, part 72.
1020. gbenv73.seq - Environmental sampling sequence entries, part 73.
1021. gbenv74.seq - Environmental sampling sequence entries, part 74.
1022. gbenv75.seq - Environmental sampling sequence entries, part 75.
1023. gbenv76.seq - Environmental sampling sequence entries, part 76.
1024. gbenv77.seq - Environmental sampling sequence entries, part 77.
1025. gbenv78.seq - Environmental sampling sequence entries, part 78.
1026. gbenv79.seq - Environmental sampling sequence entries, part 79.
1027. gbenv8.seq - Environmental sampling sequence entries, part 8.
1028. gbenv80.seq - Environmental sampling sequence entries, part 80.
1029. gbenv81.seq - Environmental sampling sequence entries, part 81.
1030. gbenv82.seq - Environmental sampling sequence entries, part 82.
1031. gbenv83.seq - Environmental sampling sequence entries, part 83.
1032. gbenv84.seq - Environmental sampling sequence entries, part 84.
1033. gbenv85.seq - Environmental sampling sequence entries, part 85.
1034. gbenv86.seq - Environmental sampling sequence entries, part 86.
1035. gbenv87.seq - Environmental sampling sequence entries, part 87.
1036. gbenv88.seq - Environmental sampling sequence entries, part 88.
1037. gbenv89.seq - Environmental sampling sequence entries, part 89.
1038. gbenv9.seq - Environmental sampling sequence entries, part 9.
1039. gbenv90.seq - Environmental sampling sequence entries, part 90.
1040. gbenv91.seq - Environmental sampling sequence entries, part 91.
1041. gbenv92.seq - Environmental sampling sequence entries, part 92.
1042. gbenv93.seq - Environmental sampling sequence entries, part 93.
1043. gbenv94.seq - Environmental sampling sequence entries, part 94.
1044. gbenv95.seq - Environmental sampling sequence entries, part 95.
1045. gbenv96.seq - Environmental sampling sequence entries, part 96.
1046. gbenv97.seq - Environmental sampling sequence entries, part 97.
1047. gbenv98.seq - Environmental sampling sequence entries, part 98.
1048. gbenv99.seq - Environmental sampling sequence entries, part 99.
1049. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
1050. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
1051. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
1052. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
1053. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
1054. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
1055. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
1056. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
1057. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
1058. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
1059. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
1060. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
1061. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
1062. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
1063. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
1064. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
1065. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
1066. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
1067. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
1068. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
1069. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
1070. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
1071. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
1072. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
1073. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
1074. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
1075. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
1076. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
1077. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
1078. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
1079. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
1080. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
1081. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
1082. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
1083. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
1084. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
1085. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
1086. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
1087. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
1088. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
1089. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
1090. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
1091. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
1092. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
1093. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
1094. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
1095. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
1096. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
1097. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
1098. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
1099. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
1100. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
1101. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
1102. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
1103. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
1104. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
1105. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
1106. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
1107. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
1108. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
1109. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
1110. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
1111. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
1112. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
1113. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
1114. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
1115. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
1116. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
1117. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
1118. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
1119. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
1120. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
1121. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
1122. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
1123. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
1124. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
1125. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
1126. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
1127. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
1128. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
1129. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
1130. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
1131. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
1132. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
1133. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
1134. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
1135. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
1136. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
1137. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
1138. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
1139. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
1140. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
1141. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
1142. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
1143. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
1144. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
1145. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
1146. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
1147. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
1148. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
1149. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
1150. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
1151. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
1152. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
1153. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
1154. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
1155. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
1156. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
1157. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
1158. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
1159. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
1160. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
1161. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
1162. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
1163. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
1164. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
1165. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
1166. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
1167. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
1168. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
1169. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
1170. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
1171. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
1172. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
1173. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
1174. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
1175. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
1176. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
1177. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
1178. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
1179. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
1180. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
1181. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
1182. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
1183. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
1184. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
1185. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
1186. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
1187. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
1188. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
1189. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
1190. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
1191. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
1192. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
1193. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
1194. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
1195. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
1196. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
1197. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
1198. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
1199. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
1200. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
1201. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
1202. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
1203. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
1204. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
1205. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
1206. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
1207. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
1208. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
1209. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
1210. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
1211. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
1212. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
1213. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
1214. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
1215. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
1216. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
1217. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
1218. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
1219. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
1220. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
1221. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
1222. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
1223. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
1224. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
1225. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
1226. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
1227. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
1228. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
1229. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
1230. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
1231. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
1232. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
1233. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
1234. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
1235. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
1236. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
1237. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
1238. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
1239. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
1240. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
1241. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
1242. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
1243. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
1244. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
1245. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
1246. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
1247. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
1248. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
1249. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
1250. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
1251. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
1252. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
1253. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1254. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1255. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1256. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1257. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1258. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1259. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1260. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1261. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1262. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1263. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1264. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1265. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1266. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1267. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1268. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1269. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1270. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1271. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1272. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1273. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1274. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1275. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1276. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1277. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1278. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1279. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1280. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1281. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1282. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1283. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1284. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1285. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1286. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1287. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1288. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1289. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1290. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1291. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1292. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1293. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1294. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1295. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1296. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1297. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1298. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1299. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1300. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1301. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1302. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1303. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1304. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1305. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1306. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1307. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1308. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1309. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1310. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1311. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1312. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1313. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1314. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1315. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1316. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1317. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1318. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1319. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1320. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1321. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1322. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1323. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1324. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1325. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1326. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1327. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1328. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1329. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1330. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1331. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1332. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1333. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1334. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1335. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1336. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1337. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1338. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1339. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1340. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1341. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1342. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1343. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1344. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1345. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1346. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1347. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1348. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1349. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1350. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1351. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1352. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1353. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1354. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1355. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1356. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1357. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1358. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1359. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1360. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1361. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1362. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1363. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1364. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1365. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1366. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1367. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1368. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1369. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1370. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1371. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1372. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1373. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1374. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1375. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1376. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1377. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1378. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1379. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1380. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1381. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1382. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1383. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1384. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1385. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1386. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1387. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1388. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1389. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1390. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1391. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1392. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1393. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1394. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1395. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1396. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1397. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1398. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1399. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1400. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1401. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1402. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1403. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1404. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1405. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1406. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1407. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1408. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1409. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1410. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1411. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1412. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1413. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1414. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1415. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1416. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1417. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1418. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1419. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1420. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1421. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1422. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1423. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1424. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1425. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1426. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1427. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1428. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1429. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1430. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1431. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1432. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1433. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1434. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1435. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1436. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1437. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1438. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1439. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1440. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1441. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1442. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1443. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1444. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1445. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1446. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1447. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1448. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1449. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1450. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1451. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1452. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1453. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1454. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1455. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1456. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1457. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1458. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1459. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1460. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1461. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1462. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1463. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1464. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1465. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1466. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1467. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1468. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1469. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1470. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1471. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1472. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1473. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1474. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1475. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1476. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1477. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1478. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1479. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1480. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1481. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1482. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1483. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1484. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1485. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1486. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1487. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1488. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1489. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1490. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1491. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1492. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1493. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1494. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1495. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1496. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1497. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1498. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1499. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1500. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1501. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1502. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1503. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1504. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1505. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1506. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1507. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1508. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1509. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1510. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1511. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1512. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1513. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1514. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1515. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1516. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1517. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1518. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1519. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1520. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1521. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1522. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1523. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1524. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1525. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1526. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1527. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1528. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1529. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1530. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1531. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1532. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1533. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1534. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1535. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1536. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1537. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1538. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1539. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1540. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1541. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1542. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1543. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1544. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1545. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1546. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1547. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1548. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1549. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1550. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1551. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1552. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1553. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1554. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1555. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1556. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1557. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1558. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1559. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1560. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1561. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1562. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1563. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1564. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1565. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1566. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1567. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1568. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1569. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1570. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1571. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1572. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1573. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1574. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1575. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1576. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1577. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1578. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1579. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1580. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1581. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1582. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1583. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1584. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1585. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1586. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1587. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1588. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1589. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1590. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1591. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1592. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1593. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1594. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1595. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1596. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1597. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1598. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1599. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1600. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1601. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1602. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1603. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1604. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1605. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1606. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1607. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1608. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1609. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1610. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1611. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1612. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1613. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1614. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1615. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1616. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1617. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1618. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1619. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1620. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1621. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1622. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1623. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1624. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1625. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1626. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1627. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1628. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1629. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1630. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1631. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1632. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1633. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1634. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1635. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1636. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1637. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1638. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1639. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1640. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1641. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1642. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1643. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1644. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1645. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1646. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1647. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1648. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1649. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1650. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1651. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1652. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1653. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1654. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1655. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1656. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1657. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1658. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1659. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1660. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1661. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1662. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1663. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1664. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1665. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1666. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1667. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1668. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1669. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1670. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1671. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1672. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1673. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1674. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1675. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1676. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1677. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1678. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1679. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1680. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1681. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1682. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1683. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1684. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1685. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1686. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1687. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1688. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1689. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1690. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1691. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1692. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1693. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1694. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1695. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1696. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1697. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1698. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1699. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1700. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1701. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1702. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1703. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1704. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1705. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1706. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1707. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1708. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1709. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1710. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1711. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1712. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1713. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1714. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1715. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1716. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1717. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1718. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1719. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1720. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1721. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1722. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1723. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1724. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1725. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1726. gbgss269.seq - GSS (genome survey sequence) sequence entries, part 269.
1727. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1728. gbgss270.seq - GSS (genome survey sequence) sequence entries, part 270.
1729. gbgss271.seq - GSS (genome survey sequence) sequence entries, part 271.
1730. gbgss272.seq - GSS (genome survey sequence) sequence entries, part 272.
1731. gbgss273.seq - GSS (genome survey sequence) sequence entries, part 273.
1732. gbgss274.seq - GSS (genome survey sequence) sequence entries, part 274.
1733. gbgss275.seq - GSS (genome survey sequence) sequence entries, part 275.
1734. gbgss276.seq - GSS (genome survey sequence) sequence entries, part 276.
1735. gbgss277.seq - GSS (genome survey sequence) sequence entries, part 277.
1736. gbgss278.seq - GSS (genome survey sequence) sequence entries, part 278.
1737. gbgss279.seq - GSS (genome survey sequence) sequence entries, part 279.
1738. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1739. gbgss280.seq - GSS (genome survey sequence) sequence entries, part 280.
1740. gbgss281.seq - GSS (genome survey sequence) sequence entries, part 281.
1741. gbgss282.seq - GSS (genome survey sequence) sequence entries, part 282.
1742. gbgss283.seq - GSS (genome survey sequence) sequence entries, part 283.
1743. gbgss284.seq - GSS (genome survey sequence) sequence entries, part 284.
1744. gbgss285.seq - GSS (genome survey sequence) sequence entries, part 285.
1745. gbgss286.seq - GSS (genome survey sequence) sequence entries, part 286.
1746. gbgss287.seq - GSS (genome survey sequence) sequence entries, part 287.
1747. gbgss288.seq - GSS (genome survey sequence) sequence entries, part 288.
1748. gbgss289.seq - GSS (genome survey sequence) sequence entries, part 289.
1749. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1750. gbgss290.seq - GSS (genome survey sequence) sequence entries, part 290.
1751. gbgss291.seq - GSS (genome survey sequence) sequence entries, part 291.
1752. gbgss292.seq - GSS (genome survey sequence) sequence entries, part 292.
1753. gbgss293.seq - GSS (genome survey sequence) sequence entries, part 293.
1754. gbgss294.seq - GSS (genome survey sequence) sequence entries, part 294.
1755. gbgss295.seq - GSS (genome survey sequence) sequence entries, part 295.
1756. gbgss296.seq - GSS (genome survey sequence) sequence entries, part 296.
1757. gbgss297.seq - GSS (genome survey sequence) sequence entries, part 297.
1758. gbgss298.seq - GSS (genome survey sequence) sequence entries, part 298.
1759. gbgss299.seq - GSS (genome survey sequence) sequence entries, part 299.
1760. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1761. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1762. gbgss300.seq - GSS (genome survey sequence) sequence entries, part 300.
1763. gbgss301.seq - GSS (genome survey sequence) sequence entries, part 301.
1764. gbgss302.seq - GSS (genome survey sequence) sequence entries, part 302.
1765. gbgss303.seq - GSS (genome survey sequence) sequence entries, part 303.
1766. gbgss304.seq - GSS (genome survey sequence) sequence entries, part 304.
1767. gbgss305.seq - GSS (genome survey sequence) sequence entries, part 305.
1768. gbgss306.seq - GSS (genome survey sequence) sequence entries, part 306.
1769. gbgss307.seq - GSS (genome survey sequence) sequence entries, part 307.
1770. gbgss308.seq - GSS (genome survey sequence) sequence entries, part 308.
1771. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1772. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1773. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1774. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1775. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1776. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1777. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1778. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1779. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1780. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1781. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1782. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1783. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1784. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1785. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1786. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1787. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1788. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1789. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1790. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1791. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1792. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1793. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1794. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1795. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1796. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1797. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1798. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1799. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1800. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1801. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1802. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1803. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1804. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1805. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1806. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1807. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1808. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1809. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1810. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1811. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1812. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1813. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1814. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1815. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1816. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1817. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1818. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1819. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1820. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1821. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1822. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1823. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1824. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1825. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1826. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1827. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1828. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1829. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1830. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1831. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1832. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1833. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1834. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1835. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1836. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1837. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1838. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1839. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1840. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1841. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1842. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1843. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1844. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1845. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1846. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1847. gbhtc10.seq - HTC (high throughput cDNA sequencing) sequence entries, part 10.
1848. gbhtc11.seq - HTC (high throughput cDNA sequencing) sequence entries, part 11.
1849. gbhtc12.seq - HTC (high throughput cDNA sequencing) sequence entries, part 12.
1850. gbhtc13.seq - HTC (high throughput cDNA sequencing) sequence entries, part 13.
1851. gbhtc14.seq - HTC (high throughput cDNA sequencing) sequence entries, part 14.
1852. gbhtc15.seq - HTC (high throughput cDNA sequencing) sequence entries, part 15.
1853. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1854. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1855. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1856. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1857. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1858. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1859. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1860. gbhtc9.seq - HTC (high throughput cDNA sequencing) sequence entries, part 9.
1861. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1862. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1863. gbhtg100.seq - HTGS (high throughput genomic sequencing) sequence entries, part 100.
1864. gbhtg101.seq - HTGS (high throughput genomic sequencing) sequence entries, part 101.
1865. gbhtg102.seq - HTGS (high throughput genomic sequencing) sequence entries, part 102.
1866. gbhtg103.seq - HTGS (high throughput genomic sequencing) sequence entries, part 103.
1867. gbhtg104.seq - HTGS (high throughput genomic sequencing) sequence entries, part 104.
1868. gbhtg105.seq - HTGS (high throughput genomic sequencing) sequence entries, part 105.
1869. gbhtg106.seq - HTGS (high throughput genomic sequencing) sequence entries, part 106.
1870. gbhtg107.seq - HTGS (high throughput genomic sequencing) sequence entries, part 107.
1871. gbhtg108.seq - HTGS (high throughput genomic sequencing) sequence entries, part 108.
1872. gbhtg109.seq - HTGS (high throughput genomic sequencing) sequence entries, part 109.
1873. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1874. gbhtg110.seq - HTGS (high throughput genomic sequencing) sequence entries, part 110.
1875. gbhtg111.seq - HTGS (high throughput genomic sequencing) sequence entries, part 111.
1876. gbhtg112.seq - HTGS (high throughput genomic sequencing) sequence entries, part 112.
1877. gbhtg113.seq - HTGS (high throughput genomic sequencing) sequence entries, part 113.
1878. gbhtg114.seq - HTGS (high throughput genomic sequencing) sequence entries, part 114.
1879. gbhtg115.seq - HTGS (high throughput genomic sequencing) sequence entries, part 115.
1880. gbhtg116.seq - HTGS (high throughput genomic sequencing) sequence entries, part 116.
1881. gbhtg117.seq - HTGS (high throughput genomic sequencing) sequence entries, part 117.
1882. gbhtg118.seq - HTGS (high throughput genomic sequencing) sequence entries, part 118.
1883. gbhtg119.seq - HTGS (high throughput genomic sequencing) sequence entries, part 119.
1884. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1885. gbhtg120.seq - HTGS (high throughput genomic sequencing) sequence entries, part 120.
1886. gbhtg121.seq - HTGS (high throughput genomic sequencing) sequence entries, part 121.
1887. gbhtg122.seq - HTGS (high throughput genomic sequencing) sequence entries, part 122.
1888. gbhtg123.seq - HTGS (high throughput genomic sequencing) sequence entries, part 123.
1889. gbhtg124.seq - HTGS (high throughput genomic sequencing) sequence entries, part 124.
1890. gbhtg125.seq - HTGS (high throughput genomic sequencing) sequence entries, part 125.
1891. gbhtg126.seq - HTGS (high throughput genomic sequencing) sequence entries, part 126.
1892. gbhtg127.seq - HTGS (high throughput genomic sequencing) sequence entries, part 127.
1893. gbhtg128.seq - HTGS (high throughput genomic sequencing) sequence entries, part 128.
1894. gbhtg129.seq - HTGS (high throughput genomic sequencing) sequence entries, part 129.
1895. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1896. gbhtg130.seq - HTGS (high throughput genomic sequencing) sequence entries, part 130.
1897. gbhtg131.seq - HTGS (high throughput genomic sequencing) sequence entries, part 131.
1898. gbhtg132.seq - HTGS (high throughput genomic sequencing) sequence entries, part 132.
1899. gbhtg133.seq - HTGS (high throughput genomic sequencing) sequence entries, part 133.
1900. gbhtg134.seq - HTGS (high throughput genomic sequencing) sequence entries, part 134.
1901. gbhtg135.seq - HTGS (high throughput genomic sequencing) sequence entries, part 135.
1902. gbhtg136.seq - HTGS (high throughput genomic sequencing) sequence entries, part 136.
1903. gbhtg137.seq - HTGS (high throughput genomic sequencing) sequence entries, part 137.
1904. gbhtg138.seq - HTGS (high throughput genomic sequencing) sequence entries, part 138.
1905. gbhtg139.seq - HTGS (high throughput genomic sequencing) sequence entries, part 139.
1906. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1907. gbhtg140.seq - HTGS (high throughput genomic sequencing) sequence entries, part 140.
1908. gbhtg141.seq - HTGS (high throughput genomic sequencing) sequence entries, part 141.
1909. gbhtg142.seq - HTGS (high throughput genomic sequencing) sequence entries, part 142.
1910. gbhtg143.seq - HTGS (high throughput genomic sequencing) sequence entries, part 143.
1911. gbhtg144.seq - HTGS (high throughput genomic sequencing) sequence entries, part 144.
1912. gbhtg145.seq - HTGS (high throughput genomic sequencing) sequence entries, part 145.
1913. gbhtg146.seq - HTGS (high throughput genomic sequencing) sequence entries, part 146.
1914. gbhtg147.seq - HTGS (high throughput genomic sequencing) sequence entries, part 147.
1915. gbhtg148.seq - HTGS (high throughput genomic sequencing) sequence entries, part 148.
1916. gbhtg149.seq - HTGS (high throughput genomic sequencing) sequence entries, part 149.
1917. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1918. gbhtg150.seq - HTGS (high throughput genomic sequencing) sequence entries, part 150.
1919. gbhtg151.seq - HTGS (high throughput genomic sequencing) sequence entries, part 151.
1920. gbhtg152.seq - HTGS (high throughput genomic sequencing) sequence entries, part 152.
1921. gbhtg153.seq - HTGS (high throughput genomic sequencing) sequence entries, part 153.
1922. gbhtg154.seq - HTGS (high throughput genomic sequencing) sequence entries, part 154.
1923. gbhtg155.seq - HTGS (high throughput genomic sequencing) sequence entries, part 155.
1924. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1925. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1926. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1927. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1928. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1929. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1930. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1931. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1932. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1933. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1934. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1935. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1936. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1937. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1938. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1939. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1940. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1941. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1942. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1943. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1944. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1945. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1946. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1947. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1948. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1949. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1950. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1951. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1952. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1953. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1954. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1955. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1956. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1957. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1958. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1959. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1960. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1961. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1962. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1963. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1964. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1965. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1966. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1967. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1968. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1969. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1970. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1971. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1972. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1973. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1974. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1975. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1976. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1977. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1978. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1979. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1980. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1981. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1982. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1983. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1984. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1985. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1986. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1987. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1988. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1989. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1990. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1991. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1992. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1993. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1994. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1995. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1996. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1997. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1998. gbhtg83.seq - HTGS (high throughput genomic sequencing) sequence entries, part 83.
1999. gbhtg84.seq - HTGS (high throughput genomic sequencing) sequence entries, part 84.
2000. gbhtg85.seq - HTGS (high throughput genomic sequencing) sequence entries, part 85.
2001. gbhtg86.seq - HTGS (high throughput genomic sequencing) sequence entries, part 86.
2002. gbhtg87.seq - HTGS (high throughput genomic sequencing) sequence entries, part 87.
2003. gbhtg88.seq - HTGS (high throughput genomic sequencing) sequence entries, part 88.
2004. gbhtg89.seq - HTGS (high throughput genomic sequencing) sequence entries, part 89.
2005. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
2006. gbhtg90.seq - HTGS (high throughput genomic sequencing) sequence entries, part 90.
2007. gbhtg91.seq - HTGS (high throughput genomic sequencing) sequence entries, part 91.
2008. gbhtg92.seq - HTGS (high throughput genomic sequencing) sequence entries, part 92.
2009. gbhtg93.seq - HTGS (high throughput genomic sequencing) sequence entries, part 93.
2010. gbhtg94.seq - HTGS (high throughput genomic sequencing) sequence entries, part 94.
2011. gbhtg95.seq - HTGS (high throughput genomic sequencing) sequence entries, part 95.
2012. gbhtg96.seq - HTGS (high throughput genomic sequencing) sequence entries, part 96.
2013. gbhtg97.seq - HTGS (high throughput genomic sequencing) sequence entries, part 97.
2014. gbhtg98.seq - HTGS (high throughput genomic sequencing) sequence entries, part 98.
2015. gbhtg99.seq - HTGS (high throughput genomic sequencing) sequence entries, part 99.
2016. gbinv1.seq - Invertebrate sequence entries, part 1.
2017. gbinv10.seq - Invertebrate sequence entries, part 10.
2018. gbinv100.seq - Invertebrate sequence entries, part 100.
2019. gbinv101.seq - Invertebrate sequence entries, part 101.
2020. gbinv102.seq - Invertebrate sequence entries, part 102.
2021. gbinv103.seq - Invertebrate sequence entries, part 103.
2022. gbinv104.seq - Invertebrate sequence entries, part 104.
2023. gbinv105.seq - Invertebrate sequence entries, part 105.
2024. gbinv106.seq - Invertebrate sequence entries, part 106.
2025. gbinv107.seq - Invertebrate sequence entries, part 107.
2026. gbinv108.seq - Invertebrate sequence entries, part 108.
2027. gbinv109.seq - Invertebrate sequence entries, part 109.
2028. gbinv11.seq - Invertebrate sequence entries, part 11.
2029. gbinv110.seq - Invertebrate sequence entries, part 110.
2030. gbinv111.seq - Invertebrate sequence entries, part 111.
2031. gbinv112.seq - Invertebrate sequence entries, part 112.
2032. gbinv113.seq - Invertebrate sequence entries, part 113.
2033. gbinv114.seq - Invertebrate sequence entries, part 114.
2034. gbinv115.seq - Invertebrate sequence entries, part 115.
2035. gbinv116.seq - Invertebrate sequence entries, part 116.
2036. gbinv117.seq - Invertebrate sequence entries, part 117.
2037. gbinv12.seq - Invertebrate sequence entries, part 12.
2038. gbinv13.seq - Invertebrate sequence entries, part 13.
2039. gbinv14.seq - Invertebrate sequence entries, part 14.
2040. gbinv15.seq - Invertebrate sequence entries, part 15.
2041. gbinv16.seq - Invertebrate sequence entries, part 16.
2042. gbinv17.seq - Invertebrate sequence entries, part 17.
2043. gbinv18.seq - Invertebrate sequence entries, part 18.
2044. gbinv19.seq - Invertebrate sequence entries, part 19.
2045. gbinv2.seq - Invertebrate sequence entries, part 2.
2046. gbinv20.seq - Invertebrate sequence entries, part 20.
2047. gbinv21.seq - Invertebrate sequence entries, part 21.
2048. gbinv22.seq - Invertebrate sequence entries, part 22.
2049. gbinv23.seq - Invertebrate sequence entries, part 23.
2050. gbinv24.seq - Invertebrate sequence entries, part 24.
2051. gbinv25.seq - Invertebrate sequence entries, part 25.
2052. gbinv26.seq - Invertebrate sequence entries, part 26.
2053. gbinv27.seq - Invertebrate sequence entries, part 27.
2054. gbinv28.seq - Invertebrate sequence entries, part 28.
2055. gbinv29.seq - Invertebrate sequence entries, part 29.
2056. gbinv3.seq - Invertebrate sequence entries, part 3.
2057. gbinv30.seq - Invertebrate sequence entries, part 30.
2058. gbinv31.seq - Invertebrate sequence entries, part 31.
2059. gbinv32.seq - Invertebrate sequence entries, part 32.
2060. gbinv33.seq - Invertebrate sequence entries, part 33.
2061. gbinv34.seq - Invertebrate sequence entries, part 34.
2062. gbinv35.seq - Invertebrate sequence entries, part 35.
2063. gbinv36.seq - Invertebrate sequence entries, part 36.
2064. gbinv37.seq - Invertebrate sequence entries, part 37.
2065. gbinv38.seq - Invertebrate sequence entries, part 38.
2066. gbinv39.seq - Invertebrate sequence entries, part 39.
2067. gbinv4.seq - Invertebrate sequence entries, part 4.
2068. gbinv40.seq - Invertebrate sequence entries, part 40.
2069. gbinv41.seq - Invertebrate sequence entries, part 41.
2070. gbinv42.seq - Invertebrate sequence entries, part 42.
2071. gbinv43.seq - Invertebrate sequence entries, part 43.
2072. gbinv44.seq - Invertebrate sequence entries, part 44.
2073. gbinv45.seq - Invertebrate sequence entries, part 45.
2074. gbinv46.seq - Invertebrate sequence entries, part 46.
2075. gbinv47.seq - Invertebrate sequence entries, part 47.
2076. gbinv48.seq - Invertebrate sequence entries, part 48.
2077. gbinv49.seq - Invertebrate sequence entries, part 49.
2078. gbinv5.seq - Invertebrate sequence entries, part 5.
2079. gbinv50.seq - Invertebrate sequence entries, part 50.
2080. gbinv51.seq - Invertebrate sequence entries, part 51.
2081. gbinv52.seq - Invertebrate sequence entries, part 52.
2082. gbinv53.seq - Invertebrate sequence entries, part 53.
2083. gbinv54.seq - Invertebrate sequence entries, part 54.
2084. gbinv55.seq - Invertebrate sequence entries, part 55.
2085. gbinv56.seq - Invertebrate sequence entries, part 56.
2086. gbinv57.seq - Invertebrate sequence entries, part 57.
2087. gbinv58.seq - Invertebrate sequence entries, part 58.
2088. gbinv59.seq - Invertebrate sequence entries, part 59.
2089. gbinv6.seq - Invertebrate sequence entries, part 6.
2090. gbinv60.seq - Invertebrate sequence entries, part 60.
2091. gbinv61.seq - Invertebrate sequence entries, part 61.
2092. gbinv62.seq - Invertebrate sequence entries, part 62.
2093. gbinv63.seq - Invertebrate sequence entries, part 63.
2094. gbinv64.seq - Invertebrate sequence entries, part 64.
2095. gbinv65.seq - Invertebrate sequence entries, part 65.
2096. gbinv66.seq - Invertebrate sequence entries, part 66.
2097. gbinv67.seq - Invertebrate sequence entries, part 67.
2098. gbinv68.seq - Invertebrate sequence entries, part 68.
2099. gbinv69.seq - Invertebrate sequence entries, part 69.
2100. gbinv7.seq - Invertebrate sequence entries, part 7.
2101. gbinv70.seq - Invertebrate sequence entries, part 70.
2102. gbinv71.seq - Invertebrate sequence entries, part 71.
2103. gbinv72.seq - Invertebrate sequence entries, part 72.
2104. gbinv73.seq - Invertebrate sequence entries, part 73.
2105. gbinv74.seq - Invertebrate sequence entries, part 74.
2106. gbinv75.seq - Invertebrate sequence entries, part 75.
2107. gbinv76.seq - Invertebrate sequence entries, part 76.
2108. gbinv77.seq - Invertebrate sequence entries, part 77.
2109. gbinv78.seq - Invertebrate sequence entries, part 78.
2110. gbinv79.seq - Invertebrate sequence entries, part 79.
2111. gbinv8.seq - Invertebrate sequence entries, part 8.
2112. gbinv80.seq - Invertebrate sequence entries, part 80.
2113. gbinv81.seq - Invertebrate sequence entries, part 81.
2114. gbinv82.seq - Invertebrate sequence entries, part 82.
2115. gbinv83.seq - Invertebrate sequence entries, part 83.
2116. gbinv84.seq - Invertebrate sequence entries, part 84.
2117. gbinv85.seq - Invertebrate sequence entries, part 85.
2118. gbinv86.seq - Invertebrate sequence entries, part 86.
2119. gbinv87.seq - Invertebrate sequence entries, part 87.
2120. gbinv88.seq - Invertebrate sequence entries, part 88.
2121. gbinv89.seq - Invertebrate sequence entries, part 89.
2122. gbinv9.seq - Invertebrate sequence entries, part 9.
2123. gbinv90.seq - Invertebrate sequence entries, part 90.
2124. gbinv91.seq - Invertebrate sequence entries, part 91.
2125. gbinv92.seq - Invertebrate sequence entries, part 92.
2126. gbinv93.seq - Invertebrate sequence entries, part 93.
2127. gbinv94.seq - Invertebrate sequence entries, part 94.
2128. gbinv95.seq - Invertebrate sequence entries, part 95.
2129. gbinv96.seq - Invertebrate sequence entries, part 96.
2130. gbinv97.seq - Invertebrate sequence entries, part 97.
2131. gbinv98.seq - Invertebrate sequence entries, part 98.
2132. gbinv99.seq - Invertebrate sequence entries, part 99.
2133. gbmam1.seq - Other mammalian sequence entries, part 1.
2134. gbmam10.seq - Other mammalian sequence entries, part 10.
2135. gbmam11.seq - Other mammalian sequence entries, part 11.
2136. gbmam12.seq - Other mammalian sequence entries, part 12.
2137. gbmam13.seq - Other mammalian sequence entries, part 13.
2138. gbmam14.seq - Other mammalian sequence entries, part 14.
2139. gbmam15.seq - Other mammalian sequence entries, part 15.
2140. gbmam16.seq - Other mammalian sequence entries, part 16.
2141. gbmam17.seq - Other mammalian sequence entries, part 17.
2142. gbmam18.seq - Other mammalian sequence entries, part 18.
2143. gbmam19.seq - Other mammalian sequence entries, part 19.
2144. gbmam2.seq - Other mammalian sequence entries, part 2.
2145. gbmam20.seq - Other mammalian sequence entries, part 20.
2146. gbmam21.seq - Other mammalian sequence entries, part 21.
2147. gbmam22.seq - Other mammalian sequence entries, part 22.
2148. gbmam23.seq - Other mammalian sequence entries, part 23.
2149. gbmam24.seq - Other mammalian sequence entries, part 24.
2150. gbmam25.seq - Other mammalian sequence entries, part 25.
2151. gbmam26.seq - Other mammalian sequence entries, part 26.
2152. gbmam27.seq - Other mammalian sequence entries, part 27.
2153. gbmam28.seq - Other mammalian sequence entries, part 28.
2154. gbmam29.seq - Other mammalian sequence entries, part 29.
2155. gbmam3.seq - Other mammalian sequence entries, part 3.
2156. gbmam30.seq - Other mammalian sequence entries, part 30.
2157. gbmam31.seq - Other mammalian sequence entries, part 31.
2158. gbmam32.seq - Other mammalian sequence entries, part 32.
2159. gbmam33.seq - Other mammalian sequence entries, part 33.
2160. gbmam34.seq - Other mammalian sequence entries, part 34.
2161. gbmam35.seq - Other mammalian sequence entries, part 35.
2162. gbmam36.seq - Other mammalian sequence entries, part 36.
2163. gbmam37.seq - Other mammalian sequence entries, part 37.
2164. gbmam38.seq - Other mammalian sequence entries, part 38.
2165. gbmam39.seq - Other mammalian sequence entries, part 39.
2166. gbmam4.seq - Other mammalian sequence entries, part 4.
2167. gbmam40.seq - Other mammalian sequence entries, part 40.
2168. gbmam41.seq - Other mammalian sequence entries, part 41.
2169. gbmam42.seq - Other mammalian sequence entries, part 42.
2170. gbmam43.seq - Other mammalian sequence entries, part 43.
2171. gbmam44.seq - Other mammalian sequence entries, part 44.
2172. gbmam45.seq - Other mammalian sequence entries, part 45.
2173. gbmam46.seq - Other mammalian sequence entries, part 46.
2174. gbmam47.seq - Other mammalian sequence entries, part 47.
2175. gbmam48.seq - Other mammalian sequence entries, part 48.
2176. gbmam49.seq - Other mammalian sequence entries, part 49.
2177. gbmam5.seq - Other mammalian sequence entries, part 5.
2178. gbmam50.seq - Other mammalian sequence entries, part 50.
2179. gbmam51.seq - Other mammalian sequence entries, part 51.
2180. gbmam52.seq - Other mammalian sequence entries, part 52.
2181. gbmam53.seq - Other mammalian sequence entries, part 53.
2182. gbmam54.seq - Other mammalian sequence entries, part 54.
2183. gbmam55.seq - Other mammalian sequence entries, part 55.
2184. gbmam6.seq - Other mammalian sequence entries, part 6.
2185. gbmam7.seq - Other mammalian sequence entries, part 7.
2186. gbmam8.seq - Other mammalian sequence entries, part 8.
2187. gbmam9.seq - Other mammalian sequence entries, part 9.
2188. gbnew.txt - Accession numbers of entries new since the previous release.
2189. gbpat1.seq - Patent sequence entries, part 1.
2190. gbpat10.seq - Patent sequence entries, part 10.
2191. gbpat100.seq - Patent sequence entries, part 100.
2192. gbpat101.seq - Patent sequence entries, part 101.
2193. gbpat102.seq - Patent sequence entries, part 102.
2194. gbpat103.seq - Patent sequence entries, part 103.
2195. gbpat104.seq - Patent sequence entries, part 104.
2196. gbpat105.seq - Patent sequence entries, part 105.
2197. gbpat106.seq - Patent sequence entries, part 106.
2198. gbpat107.seq - Patent sequence entries, part 107.
2199. gbpat108.seq - Patent sequence entries, part 108.
2200. gbpat109.seq - Patent sequence entries, part 109.
2201. gbpat11.seq - Patent sequence entries, part 11.
2202. gbpat110.seq - Patent sequence entries, part 110.
2203. gbpat111.seq - Patent sequence entries, part 111.
2204. gbpat112.seq - Patent sequence entries, part 112.
2205. gbpat113.seq - Patent sequence entries, part 113.
2206. gbpat114.seq - Patent sequence entries, part 114.
2207. gbpat115.seq - Patent sequence entries, part 115.
2208. gbpat116.seq - Patent sequence entries, part 116.
2209. gbpat117.seq - Patent sequence entries, part 117.
2210. gbpat118.seq - Patent sequence entries, part 118.
2211. gbpat119.seq - Patent sequence entries, part 119.
2212. gbpat12.seq - Patent sequence entries, part 12.
2213. gbpat120.seq - Patent sequence entries, part 120.
2214. gbpat121.seq - Patent sequence entries, part 121.
2215. gbpat122.seq - Patent sequence entries, part 122.
2216. gbpat123.seq - Patent sequence entries, part 123.
2217. gbpat124.seq - Patent sequence entries, part 124.
2218. gbpat125.seq - Patent sequence entries, part 125.
2219. gbpat126.seq - Patent sequence entries, part 126.
2220. gbpat127.seq - Patent sequence entries, part 127.
2221. gbpat128.seq - Patent sequence entries, part 128.
2222. gbpat129.seq - Patent sequence entries, part 129.
2223. gbpat13.seq - Patent sequence entries, part 13.
2224. gbpat130.seq - Patent sequence entries, part 130.
2225. gbpat131.seq - Patent sequence entries, part 131.
2226. gbpat132.seq - Patent sequence entries, part 132.
2227. gbpat133.seq - Patent sequence entries, part 133.
2228. gbpat134.seq - Patent sequence entries, part 134.
2229. gbpat135.seq - Patent sequence entries, part 135.
2230. gbpat136.seq - Patent sequence entries, part 136.
2231. gbpat137.seq - Patent sequence entries, part 137.
2232. gbpat138.seq - Patent sequence entries, part 138.
2233. gbpat139.seq - Patent sequence entries, part 139.
2234. gbpat14.seq - Patent sequence entries, part 14.
2235. gbpat140.seq - Patent sequence entries, part 140.
2236. gbpat141.seq - Patent sequence entries, part 141.
2237. gbpat142.seq - Patent sequence entries, part 142.
2238. gbpat143.seq - Patent sequence entries, part 143.
2239. gbpat144.seq - Patent sequence entries, part 144.
2240. gbpat145.seq - Patent sequence entries, part 145.
2241. gbpat146.seq - Patent sequence entries, part 146.
2242. gbpat147.seq - Patent sequence entries, part 147.
2243. gbpat148.seq - Patent sequence entries, part 148.
2244. gbpat149.seq - Patent sequence entries, part 149.
2245. gbpat15.seq - Patent sequence entries, part 15.
2246. gbpat150.seq - Patent sequence entries, part 150.
2247. gbpat151.seq - Patent sequence entries, part 151.
2248. gbpat152.seq - Patent sequence entries, part 152.
2249. gbpat153.seq - Patent sequence entries, part 153.
2250. gbpat154.seq - Patent sequence entries, part 154.
2251. gbpat155.seq - Patent sequence entries, part 155.
2252. gbpat156.seq - Patent sequence entries, part 156.
2253. gbpat157.seq - Patent sequence entries, part 157.
2254. gbpat158.seq - Patent sequence entries, part 158.
2255. gbpat159.seq - Patent sequence entries, part 159.
2256. gbpat16.seq - Patent sequence entries, part 16.
2257. gbpat160.seq - Patent sequence entries, part 160.
2258. gbpat161.seq - Patent sequence entries, part 161.
2259. gbpat162.seq - Patent sequence entries, part 162.
2260. gbpat163.seq - Patent sequence entries, part 163.
2261. gbpat164.seq - Patent sequence entries, part 164.
2262. gbpat165.seq - Patent sequence entries, part 165.
2263. gbpat166.seq - Patent sequence entries, part 166.
2264. gbpat167.seq - Patent sequence entries, part 167.
2265. gbpat168.seq - Patent sequence entries, part 168.
2266. gbpat169.seq - Patent sequence entries, part 169.
2267. gbpat17.seq - Patent sequence entries, part 17.
2268. gbpat170.seq - Patent sequence entries, part 170.
2269. gbpat171.seq - Patent sequence entries, part 171.
2270. gbpat172.seq - Patent sequence entries, part 172.
2271. gbpat173.seq - Patent sequence entries, part 173.
2272. gbpat174.seq - Patent sequence entries, part 174.
2273. gbpat175.seq - Patent sequence entries, part 175.
2274. gbpat176.seq - Patent sequence entries, part 176.
2275. gbpat177.seq - Patent sequence entries, part 177.
2276. gbpat178.seq - Patent sequence entries, part 178.
2277. gbpat179.seq - Patent sequence entries, part 179.
2278. gbpat18.seq - Patent sequence entries, part 18.
2279. gbpat180.seq - Patent sequence entries, part 180.
2280. gbpat181.seq - Patent sequence entries, part 181.
2281. gbpat182.seq - Patent sequence entries, part 182.
2282. gbpat183.seq - Patent sequence entries, part 183.
2283. gbpat184.seq - Patent sequence entries, part 184.
2284. gbpat185.seq - Patent sequence entries, part 185.
2285. gbpat186.seq - Patent sequence entries, part 186.
2286. gbpat187.seq - Patent sequence entries, part 187.
2287. gbpat188.seq - Patent sequence entries, part 188.
2288. gbpat189.seq - Patent sequence entries, part 189.
2289. gbpat19.seq - Patent sequence entries, part 19.
2290. gbpat190.seq - Patent sequence entries, part 190.
2291. gbpat191.seq - Patent sequence entries, part 191.
2292. gbpat192.seq - Patent sequence entries, part 192.
2293. gbpat193.seq - Patent sequence entries, part 193.
2294. gbpat194.seq - Patent sequence entries, part 194.
2295. gbpat195.seq - Patent sequence entries, part 195.
2296. gbpat196.seq - Patent sequence entries, part 196.
2297. gbpat197.seq - Patent sequence entries, part 197.
2298. gbpat198.seq - Patent sequence entries, part 198.
2299. gbpat199.seq - Patent sequence entries, part 199.
2300. gbpat2.seq - Patent sequence entries, part 2.
2301. gbpat20.seq - Patent sequence entries, part 20.
2302. gbpat200.seq - Patent sequence entries, part 200.
2303. gbpat201.seq - Patent sequence entries, part 201.
2304. gbpat202.seq - Patent sequence entries, part 202.
2305. gbpat203.seq - Patent sequence entries, part 203.
2306. gbpat204.seq - Patent sequence entries, part 204.
2307. gbpat205.seq - Patent sequence entries, part 205.
2308. gbpat206.seq - Patent sequence entries, part 206.
2309. gbpat207.seq - Patent sequence entries, part 207.
2310. gbpat208.seq - Patent sequence entries, part 208.
2311. gbpat209.seq - Patent sequence entries, part 209.
2312. gbpat21.seq - Patent sequence entries, part 21.
2313. gbpat210.seq - Patent sequence entries, part 210.
2314. gbpat211.seq - Patent sequence entries, part 211.
2315. gbpat212.seq - Patent sequence entries, part 212.
2316. gbpat213.seq - Patent sequence entries, part 213.
2317. gbpat214.seq - Patent sequence entries, part 214.
2318. gbpat215.seq - Patent sequence entries, part 215.
2319. gbpat216.seq - Patent sequence entries, part 216.
2320. gbpat217.seq - Patent sequence entries, part 217.
2321. gbpat218.seq - Patent sequence entries, part 218.
2322. gbpat219.seq - Patent sequence entries, part 219.
2323. gbpat22.seq - Patent sequence entries, part 22.
2324. gbpat220.seq - Patent sequence entries, part 220.
2325. gbpat221.seq - Patent sequence entries, part 221.
2326. gbpat222.seq - Patent sequence entries, part 222.
2327. gbpat223.seq - Patent sequence entries, part 223.
2328. gbpat224.seq - Patent sequence entries, part 224.
2329. gbpat225.seq - Patent sequence entries, part 225.
2330. gbpat226.seq - Patent sequence entries, part 226.
2331. gbpat227.seq - Patent sequence entries, part 227.
2332. gbpat228.seq - Patent sequence entries, part 228.
2333. gbpat229.seq - Patent sequence entries, part 229.
2334. gbpat23.seq - Patent sequence entries, part 23.
2335. gbpat230.seq - Patent sequence entries, part 230.
2336. gbpat231.seq - Patent sequence entries, part 231.
2337. gbpat232.seq - Patent sequence entries, part 232.
2338. gbpat233.seq - Patent sequence entries, part 233.
2339. gbpat234.seq - Patent sequence entries, part 234.
2340. gbpat235.seq - Patent sequence entries, part 235.
2341. gbpat236.seq - Patent sequence entries, part 236.
2342. gbpat237.seq - Patent sequence entries, part 237.
2343. gbpat238.seq - Patent sequence entries, part 238.
2344. gbpat239.seq - Patent sequence entries, part 239.
2345. gbpat24.seq - Patent sequence entries, part 24.
2346. gbpat240.seq - Patent sequence entries, part 240.
2347. gbpat241.seq - Patent sequence entries, part 241.
2348. gbpat242.seq - Patent sequence entries, part 242.
2349. gbpat243.seq - Patent sequence entries, part 243.
2350. gbpat244.seq - Patent sequence entries, part 244.
2351. gbpat245.seq - Patent sequence entries, part 245.
2352. gbpat246.seq - Patent sequence entries, part 246.
2353. gbpat247.seq - Patent sequence entries, part 247.
2354. gbpat248.seq - Patent sequence entries, part 248.
2355. gbpat249.seq - Patent sequence entries, part 249.
2356. gbpat25.seq - Patent sequence entries, part 25.
2357. gbpat250.seq - Patent sequence entries, part 250.
2358. gbpat251.seq - Patent sequence entries, part 251.
2359. gbpat252.seq - Patent sequence entries, part 252.
2360. gbpat253.seq - Patent sequence entries, part 253.
2361. gbpat254.seq - Patent sequence entries, part 254.
2362. gbpat255.seq - Patent sequence entries, part 255.
2363. gbpat256.seq - Patent sequence entries, part 256.
2364. gbpat257.seq - Patent sequence entries, part 257.
2365. gbpat258.seq - Patent sequence entries, part 258.
2366. gbpat259.seq - Patent sequence entries, part 259.
2367. gbpat26.seq - Patent sequence entries, part 26.
2368. gbpat260.seq - Patent sequence entries, part 260.
2369. gbpat261.seq - Patent sequence entries, part 261.
2370. gbpat262.seq - Patent sequence entries, part 262.
2371. gbpat263.seq - Patent sequence entries, part 263.
2372. gbpat264.seq - Patent sequence entries, part 264.
2373. gbpat265.seq - Patent sequence entries, part 265.
2374. gbpat266.seq - Patent sequence entries, part 266.
2375. gbpat267.seq - Patent sequence entries, part 267.
2376. gbpat268.seq - Patent sequence entries, part 268.
2377. gbpat269.seq - Patent sequence entries, part 269.
2378. gbpat27.seq - Patent sequence entries, part 27.
2379. gbpat270.seq - Patent sequence entries, part 270.
2380. gbpat271.seq - Patent sequence entries, part 271.
2381. gbpat272.seq - Patent sequence entries, part 272.
2382. gbpat273.seq - Patent sequence entries, part 273.
2383. gbpat274.seq - Patent sequence entries, part 274.
2384. gbpat275.seq - Patent sequence entries, part 275.
2385. gbpat276.seq - Patent sequence entries, part 276.
2386. gbpat277.seq - Patent sequence entries, part 277.
2387. gbpat278.seq - Patent sequence entries, part 278.
2388. gbpat279.seq - Patent sequence entries, part 279.
2389. gbpat28.seq - Patent sequence entries, part 28.
2390. gbpat280.seq - Patent sequence entries, part 280.
2391. gbpat281.seq - Patent sequence entries, part 281.
2392. gbpat282.seq - Patent sequence entries, part 282.
2393. gbpat283.seq - Patent sequence entries, part 283.
2394. gbpat284.seq - Patent sequence entries, part 284.
2395. gbpat285.seq - Patent sequence entries, part 285.
2396. gbpat286.seq - Patent sequence entries, part 286.
2397. gbpat287.seq - Patent sequence entries, part 287.
2398. gbpat288.seq - Patent sequence entries, part 288.
2399. gbpat289.seq - Patent sequence entries, part 289.
2400. gbpat29.seq - Patent sequence entries, part 29.
2401. gbpat290.seq - Patent sequence entries, part 290.
2402. gbpat291.seq - Patent sequence entries, part 291.
2403. gbpat292.seq - Patent sequence entries, part 292.
2404. gbpat293.seq - Patent sequence entries, part 293.
2405. gbpat294.seq - Patent sequence entries, part 294.
2406. gbpat295.seq - Patent sequence entries, part 295.
2407. gbpat296.seq - Patent sequence entries, part 296.
2408. gbpat297.seq - Patent sequence entries, part 297.
2409. gbpat298.seq - Patent sequence entries, part 298.
2410. gbpat299.seq - Patent sequence entries, part 299.
2411. gbpat3.seq - Patent sequence entries, part 3.
2412. gbpat30.seq - Patent sequence entries, part 30.
2413. gbpat300.seq - Patent sequence entries, part 300.
2414. gbpat301.seq - Patent sequence entries, part 301.
2415. gbpat302.seq - Patent sequence entries, part 302.
2416. gbpat303.seq - Patent sequence entries, part 303.
2417. gbpat304.seq - Patent sequence entries, part 304.
2418. gbpat305.seq - Patent sequence entries, part 305.
2419. gbpat306.seq - Patent sequence entries, part 306.
2420. gbpat307.seq - Patent sequence entries, part 307.
2421. gbpat308.seq - Patent sequence entries, part 308.
2422. gbpat309.seq - Patent sequence entries, part 309.
2423. gbpat31.seq - Patent sequence entries, part 31.
2424. gbpat310.seq - Patent sequence entries, part 310.
2425. gbpat311.seq - Patent sequence entries, part 311.
2426. gbpat312.seq - Patent sequence entries, part 312.
2427. gbpat313.seq - Patent sequence entries, part 313.
2428. gbpat314.seq - Patent sequence entries, part 314.
2429. gbpat315.seq - Patent sequence entries, part 315.
2430. gbpat316.seq - Patent sequence entries, part 316.
2431. gbpat317.seq - Patent sequence entries, part 317.
2432. gbpat318.seq - Patent sequence entries, part 318.
2433. gbpat319.seq - Patent sequence entries, part 319.
2434. gbpat32.seq - Patent sequence entries, part 32.
2435. gbpat320.seq - Patent sequence entries, part 320.
2436. gbpat321.seq - Patent sequence entries, part 321.
2437. gbpat322.seq - Patent sequence entries, part 322.
2438. gbpat323.seq - Patent sequence entries, part 323.
2439. gbpat324.seq - Patent sequence entries, part 324.
2440. gbpat325.seq - Patent sequence entries, part 325.
2441. gbpat326.seq - Patent sequence entries, part 326.
2442. gbpat327.seq - Patent sequence entries, part 327.
2443. gbpat328.seq - Patent sequence entries, part 328.
2444. gbpat329.seq - Patent sequence entries, part 329.
2445. gbpat33.seq - Patent sequence entries, part 33.
2446. gbpat330.seq - Patent sequence entries, part 330.
2447. gbpat331.seq - Patent sequence entries, part 331.
2448. gbpat332.seq - Patent sequence entries, part 332.
2449. gbpat333.seq - Patent sequence entries, part 333.
2450. gbpat334.seq - Patent sequence entries, part 334.
2451. gbpat335.seq - Patent sequence entries, part 335.
2452. gbpat336.seq - Patent sequence entries, part 336.
2453. gbpat337.seq - Patent sequence entries, part 337.
2454. gbpat338.seq - Patent sequence entries, part 338.
2455. gbpat339.seq - Patent sequence entries, part 339.
2456. gbpat34.seq - Patent sequence entries, part 34.
2457. gbpat340.seq - Patent sequence entries, part 340.
2458. gbpat341.seq - Patent sequence entries, part 341.
2459. gbpat342.seq - Patent sequence entries, part 342.
2460. gbpat343.seq - Patent sequence entries, part 343.
2461. gbpat344.seq - Patent sequence entries, part 344.
2462. gbpat345.seq - Patent sequence entries, part 345.
2463. gbpat346.seq - Patent sequence entries, part 346.
2464. gbpat347.seq - Patent sequence entries, part 347.
2465. gbpat35.seq - Patent sequence entries, part 35.
2466. gbpat36.seq - Patent sequence entries, part 36.
2467. gbpat37.seq - Patent sequence entries, part 37.
2468. gbpat38.seq - Patent sequence entries, part 38.
2469. gbpat39.seq - Patent sequence entries, part 39.
2470. gbpat4.seq - Patent sequence entries, part 4.
2471. gbpat40.seq - Patent sequence entries, part 40.
2472. gbpat41.seq - Patent sequence entries, part 41.
2473. gbpat42.seq - Patent sequence entries, part 42.
2474. gbpat43.seq - Patent sequence entries, part 43.
2475. gbpat44.seq - Patent sequence entries, part 44.
2476. gbpat45.seq - Patent sequence entries, part 45.
2477. gbpat46.seq - Patent sequence entries, part 46.
2478. gbpat47.seq - Patent sequence entries, part 47.
2479. gbpat48.seq - Patent sequence entries, part 48.
2480. gbpat49.seq - Patent sequence entries, part 49.
2481. gbpat5.seq - Patent sequence entries, part 5.
2482. gbpat50.seq - Patent sequence entries, part 50.
2483. gbpat51.seq - Patent sequence entries, part 51.
2484. gbpat52.seq - Patent sequence entries, part 52.
2485. gbpat53.seq - Patent sequence entries, part 53.
2486. gbpat54.seq - Patent sequence entries, part 54.
2487. gbpat55.seq - Patent sequence entries, part 55.
2488. gbpat56.seq - Patent sequence entries, part 56.
2489. gbpat57.seq - Patent sequence entries, part 57.
2490. gbpat58.seq - Patent sequence entries, part 58.
2491. gbpat59.seq - Patent sequence entries, part 59.
2492. gbpat6.seq - Patent sequence entries, part 6.
2493. gbpat60.seq - Patent sequence entries, part 60.
2494. gbpat61.seq - Patent sequence entries, part 61.
2495. gbpat62.seq - Patent sequence entries, part 62.
2496. gbpat63.seq - Patent sequence entries, part 63.
2497. gbpat64.seq - Patent sequence entries, part 64.
2498. gbpat65.seq - Patent sequence entries, part 65.
2499. gbpat66.seq - Patent sequence entries, part 66.
2500. gbpat67.seq - Patent sequence entries, part 67.
2501. gbpat68.seq - Patent sequence entries, part 68.
2502. gbpat69.seq - Patent sequence entries, part 69.
2503. gbpat7.seq - Patent sequence entries, part 7.
2504. gbpat70.seq - Patent sequence entries, part 70.
2505. gbpat71.seq - Patent sequence entries, part 71.
2506. gbpat72.seq - Patent sequence entries, part 72.
2507. gbpat73.seq - Patent sequence entries, part 73.
2508. gbpat74.seq - Patent sequence entries, part 74.
2509. gbpat75.seq - Patent sequence entries, part 75.
2510. gbpat76.seq - Patent sequence entries, part 76.
2511. gbpat77.seq - Patent sequence entries, part 77.
2512. gbpat78.seq - Patent sequence entries, part 78.
2513. gbpat79.seq - Patent sequence entries, part 79.
2514. gbpat8.seq - Patent sequence entries, part 8.
2515. gbpat80.seq - Patent sequence entries, part 80.
2516. gbpat81.seq - Patent sequence entries, part 81.
2517. gbpat82.seq - Patent sequence entries, part 82.
2518. gbpat83.seq - Patent sequence entries, part 83.
2519. gbpat84.seq - Patent sequence entries, part 84.
2520. gbpat85.seq - Patent sequence entries, part 85.
2521. gbpat86.seq - Patent sequence entries, part 86.
2522. gbpat87.seq - Patent sequence entries, part 87.
2523. gbpat88.seq - Patent sequence entries, part 88.
2524. gbpat89.seq - Patent sequence entries, part 89.
2525. gbpat9.seq - Patent sequence entries, part 9.
2526. gbpat90.seq - Patent sequence entries, part 90.
2527. gbpat91.seq - Patent sequence entries, part 91.
2528. gbpat92.seq - Patent sequence entries, part 92.
2529. gbpat93.seq - Patent sequence entries, part 93.
2530. gbpat94.seq - Patent sequence entries, part 94.
2531. gbpat95.seq - Patent sequence entries, part 95.
2532. gbpat96.seq - Patent sequence entries, part 96.
2533. gbpat97.seq - Patent sequence entries, part 97.
2534. gbpat98.seq - Patent sequence entries, part 98.
2535. gbpat99.seq - Patent sequence entries, part 99.
2536. gbphg1.seq - Phage sequence entries, part 1.
2537. gbphg2.seq - Phage sequence entries, part 2.
2538. gbphg3.seq - Phage sequence entries, part 3.
2539. gbphg4.seq - Phage sequence entries, part 4.
2540. gbphg5.seq - Phage sequence entries, part 5.
2541. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2542. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2543. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2544. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2545. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2546. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2547. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2548. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2549. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2550. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2551. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2552. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2553. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2554. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2555. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2556. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2557. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2558. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2559. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2560. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2561. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2562. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2563. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2564. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2565. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2566. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2567. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2568. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2569. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2570. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2571. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2572. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2573. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2574. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2575. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2576. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2577. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2578. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2579. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2580. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2581. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2582. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2583. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2584. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2585. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2586. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2587. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2588. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2589. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2590. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2591. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2592. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2593. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2594. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2595. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2596. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2597. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2598. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2599. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2600. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2601. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2602. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2603. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2604. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2605. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2606. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2607. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2608. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2609. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2610. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2611. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2612. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2613. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2614. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2615. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2616. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2617. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2618. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2619. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2620. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2621. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2622. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2623. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2624. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2625. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2626. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2627. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2628. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2629. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2630. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2631. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2632. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2633. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2634. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2635. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2636. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2637. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2638. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2639. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2640. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2641. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2642. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2643. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2644. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2645. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2646. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2647. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2648. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2649. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2650. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2651. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2652. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2653. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2654. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2655. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2656. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2657. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2658. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2659. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2660. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2661. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2662. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2663. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2664. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2665. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2666. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2667. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2668. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2669. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2670. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2671. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2672. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2673. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2674. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2675. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2676. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2677. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2678. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2679. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2680. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2681. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2682. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2683. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2684. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2685. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2686. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2687. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2688. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2689. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2690. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2691. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2692. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2693. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2694. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2695. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2696. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2697. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2698. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2699. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2700. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2701. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2702. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2703. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2704. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2705. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2706. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2707. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2708. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2709. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2710. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2711. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2712. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2713. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2714. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2715. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2716. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2717. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2718. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2719. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2720. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2721. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2722. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2723. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2724. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2725. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2726. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2727. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2728. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2729. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2730. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2731. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2732. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2733. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2734. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2735. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2736. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2737. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2738. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2739. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2740. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2741. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2742. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2743. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2744. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2745. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2746. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2747. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2748. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2749. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2750. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2751. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2752. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2753. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2754. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2755. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2756. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2757. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2758. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2759. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2760. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2761. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2762. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2763. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2764. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2765. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2766. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2767. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2768. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2769. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2770. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2771. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2772. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2773. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2774. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2775. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2776. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2777. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2778. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2779. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2780. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2781. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2782. gbpri1.seq - Primate sequence entries, part 1.
2783. gbpri10.seq - Primate sequence entries, part 10.
2784. gbpri11.seq - Primate sequence entries, part 11.
2785. gbpri12.seq - Primate sequence entries, part 12.
2786. gbpri13.seq - Primate sequence entries, part 13.
2787. gbpri14.seq - Primate sequence entries, part 14.
2788. gbpri15.seq - Primate sequence entries, part 15.
2789. gbpri16.seq - Primate sequence entries, part 16.
2790. gbpri17.seq - Primate sequence entries, part 17.
2791. gbpri18.seq - Primate sequence entries, part 18.
2792. gbpri19.seq - Primate sequence entries, part 19.
2793. gbpri2.seq - Primate sequence entries, part 2.
2794. gbpri20.seq - Primate sequence entries, part 20.
2795. gbpri21.seq - Primate sequence entries, part 21.
2796. gbpri22.seq - Primate sequence entries, part 22.
2797. gbpri23.seq - Primate sequence entries, part 23.
2798. gbpri24.seq - Primate sequence entries, part 24.
2799. gbpri25.seq - Primate sequence entries, part 25.
2800. gbpri26.seq - Primate sequence entries, part 26.
2801. gbpri27.seq - Primate sequence entries, part 27.
2802. gbpri28.seq - Primate sequence entries, part 28.
2803. gbpri29.seq - Primate sequence entries, part 29.
2804. gbpri3.seq - Primate sequence entries, part 3.
2805. gbpri30.seq - Primate sequence entries, part 30.
2806. gbpri31.seq - Primate sequence entries, part 31.
2807. gbpri32.seq - Primate sequence entries, part 32.
2808. gbpri33.seq - Primate sequence entries, part 33.
2809. gbpri34.seq - Primate sequence entries, part 34.
2810. gbpri35.seq - Primate sequence entries, part 35.
2811. gbpri36.seq - Primate sequence entries, part 36.
2812. gbpri37.seq - Primate sequence entries, part 37.
2813. gbpri38.seq - Primate sequence entries, part 38.
2814. gbpri39.seq - Primate sequence entries, part 39.
2815. gbpri4.seq - Primate sequence entries, part 4.
2816. gbpri40.seq - Primate sequence entries, part 40.
2817. gbpri41.seq - Primate sequence entries, part 41.
2818. gbpri42.seq - Primate sequence entries, part 42.
2819. gbpri43.seq - Primate sequence entries, part 43.
2820. gbpri44.seq - Primate sequence entries, part 44.
2821. gbpri45.seq - Primate sequence entries, part 45.
2822. gbpri46.seq - Primate sequence entries, part 46.
2823. gbpri47.seq - Primate sequence entries, part 47.
2824. gbpri48.seq - Primate sequence entries, part 48.
2825. gbpri49.seq - Primate sequence entries, part 49.
2826. gbpri5.seq - Primate sequence entries, part 5.
2827. gbpri50.seq - Primate sequence entries, part 50.
2828. gbpri51.seq - Primate sequence entries, part 51.
2829. gbpri52.seq - Primate sequence entries, part 52.
2830. gbpri53.seq - Primate sequence entries, part 53.
2831. gbpri54.seq - Primate sequence entries, part 54.
2832. gbpri55.seq - Primate sequence entries, part 55.
2833. gbpri56.seq - Primate sequence entries, part 56.
2834. gbpri57.seq - Primate sequence entries, part 57.
2835. gbpri58.seq - Primate sequence entries, part 58.
2836. gbpri59.seq - Primate sequence entries, part 59.
2837. gbpri6.seq - Primate sequence entries, part 6.
2838. gbpri7.seq - Primate sequence entries, part 7.
2839. gbpri8.seq - Primate sequence entries, part 8.
2840. gbpri9.seq - Primate sequence entries, part 9.
2841. gbrel.txt - Release notes (this document).
2842. gbrod1.seq - Rodent sequence entries, part 1.
2843. gbrod10.seq - Rodent sequence entries, part 10.
2844. gbrod11.seq - Rodent sequence entries, part 11.
2845. gbrod12.seq - Rodent sequence entries, part 12.
2846. gbrod13.seq - Rodent sequence entries, part 13.
2847. gbrod14.seq - Rodent sequence entries, part 14.
2848. gbrod15.seq - Rodent sequence entries, part 15.
2849. gbrod16.seq - Rodent sequence entries, part 16.
2850. gbrod17.seq - Rodent sequence entries, part 17.
2851. gbrod18.seq - Rodent sequence entries, part 18.
2852. gbrod19.seq - Rodent sequence entries, part 19.
2853. gbrod2.seq - Rodent sequence entries, part 2.
2854. gbrod20.seq - Rodent sequence entries, part 20.
2855. gbrod21.seq - Rodent sequence entries, part 21.
2856. gbrod22.seq - Rodent sequence entries, part 22.
2857. gbrod23.seq - Rodent sequence entries, part 23.
2858. gbrod24.seq - Rodent sequence entries, part 24.
2859. gbrod25.seq - Rodent sequence entries, part 25.
2860. gbrod26.seq - Rodent sequence entries, part 26.
2861. gbrod27.seq - Rodent sequence entries, part 27.
2862. gbrod28.seq - Rodent sequence entries, part 28.
2863. gbrod29.seq - Rodent sequence entries, part 29.
2864. gbrod3.seq - Rodent sequence entries, part 3.
2865. gbrod30.seq - Rodent sequence entries, part 30.
2866. gbrod31.seq - Rodent sequence entries, part 31.
2867. gbrod4.seq - Rodent sequence entries, part 4.
2868. gbrod5.seq - Rodent sequence entries, part 5.
2869. gbrod6.seq - Rodent sequence entries, part 6.
2870. gbrod7.seq - Rodent sequence entries, part 7.
2871. gbrod8.seq - Rodent sequence entries, part 8.
2872. gbrod9.seq - Rodent sequence entries, part 9.
2873. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2874. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2875. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2876. gbsts12.seq - STS (sequence tagged site) sequence entries, part 12.
2877. gbsts13.seq - STS (sequence tagged site) sequence entries, part 13.
2878. gbsts14.seq - STS (sequence tagged site) sequence entries, part 14.
2879. gbsts15.seq - STS (sequence tagged site) sequence entries, part 15.
2880. gbsts16.seq - STS (sequence tagged site) sequence entries, part 16.
2881. gbsts17.seq - STS (sequence tagged site) sequence entries, part 17.
2882. gbsts18.seq - STS (sequence tagged site) sequence entries, part 18.
2883. gbsts19.seq - STS (sequence tagged site) sequence entries, part 19.
2884. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2885. gbsts20.seq - STS (sequence tagged site) sequence entries, part 20.
2886. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2887. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2888. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2889. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2890. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2891. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2892. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2893. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2894. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2895. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2896. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2897. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2898. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2899. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2900. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2901. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2902. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2903. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2904. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2905. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2906. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2907. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2908. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2909. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2910. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2911. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2912. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2913. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2914. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2915. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2916. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2917. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2918. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2919. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2920. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2921. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2922. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2923. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2924. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2925. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2926. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2927. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2928. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2929. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2930. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2931. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2932. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2933. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2934. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2935. gbtsa128.seq - TSA (transcriptome shotgun assembly) sequence entries, part 128.
2936. gbtsa129.seq - TSA (transcriptome shotgun assembly) sequence entries, part 129.
2937. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2938. gbtsa130.seq - TSA (transcriptome shotgun assembly) sequence entries, part 130.
2939. gbtsa131.seq - TSA (transcriptome shotgun assembly) sequence entries, part 131.
2940. gbtsa132.seq - TSA (transcriptome shotgun assembly) sequence entries, part 132.
2941. gbtsa133.seq - TSA (transcriptome shotgun assembly) sequence entries, part 133.
2942. gbtsa134.seq - TSA (transcriptome shotgun assembly) sequence entries, part 134.
2943. gbtsa135.seq - TSA (transcriptome shotgun assembly) sequence entries, part 135.
2944. gbtsa136.seq - TSA (transcriptome shotgun assembly) sequence entries, part 136.
2945. gbtsa137.seq - TSA (transcriptome shotgun assembly) sequence entries, part 137.
2946. gbtsa138.seq - TSA (transcriptome shotgun assembly) sequence entries, part 138.
2947. gbtsa139.seq - TSA (transcriptome shotgun assembly) sequence entries, part 139.
2948. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2949. gbtsa140.seq - TSA (transcriptome shotgun assembly) sequence entries, part 140.
2950. gbtsa141.seq - TSA (transcriptome shotgun assembly) sequence entries, part 141.
2951. gbtsa142.seq - TSA (transcriptome shotgun assembly) sequence entries, part 142.
2952. gbtsa143.seq - TSA (transcriptome shotgun assembly) sequence entries, part 143.
2953. gbtsa144.seq - TSA (transcriptome shotgun assembly) sequence entries, part 144.
2954. gbtsa145.seq - TSA (transcriptome shotgun assembly) sequence entries, part 145.
2955. gbtsa146.seq - TSA (transcriptome shotgun assembly) sequence entries, part 146.
2956. gbtsa147.seq - TSA (transcriptome shotgun assembly) sequence entries, part 147.
2957. gbtsa148.seq - TSA (transcriptome shotgun assembly) sequence entries, part 148.
2958. gbtsa149.seq - TSA (transcriptome shotgun assembly) sequence entries, part 149.
2959. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2960. gbtsa150.seq - TSA (transcriptome shotgun assembly) sequence entries, part 150.
2961. gbtsa151.seq - TSA (transcriptome shotgun assembly) sequence entries, part 151.
2962. gbtsa152.seq - TSA (transcriptome shotgun assembly) sequence entries, part 152.
2963. gbtsa153.seq - TSA (transcriptome shotgun assembly) sequence entries, part 153.
2964. gbtsa154.seq - TSA (transcriptome shotgun assembly) sequence entries, part 154.
2965. gbtsa155.seq - TSA (transcriptome shotgun assembly) sequence entries, part 155.
2966. gbtsa156.seq - TSA (transcriptome shotgun assembly) sequence entries, part 156.
2967. gbtsa157.seq - TSA (transcriptome shotgun assembly) sequence entries, part 157.
2968. gbtsa158.seq - TSA (transcriptome shotgun assembly) sequence entries, part 158.
2969. gbtsa159.seq - TSA (transcriptome shotgun assembly) sequence entries, part 159.
2970. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2971. gbtsa160.seq - TSA (transcriptome shotgun assembly) sequence entries, part 160.
2972. gbtsa161.seq - TSA (transcriptome shotgun assembly) sequence entries, part 161.
2973. gbtsa162.seq - TSA (transcriptome shotgun assembly) sequence entries, part 162.
2974. gbtsa163.seq - TSA (transcriptome shotgun assembly) sequence entries, part 163.
2975. gbtsa164.seq - TSA (transcriptome shotgun assembly) sequence entries, part 164.
2976. gbtsa165.seq - TSA (transcriptome shotgun assembly) sequence entries, part 165.
2977. gbtsa166.seq - TSA (transcriptome shotgun assembly) sequence entries, part 166.
2978. gbtsa167.seq - TSA (transcriptome shotgun assembly) sequence entries, part 167.
2979. gbtsa168.seq - TSA (transcriptome shotgun assembly) sequence entries, part 168.
2980. gbtsa169.seq - TSA (transcriptome shotgun assembly) sequence entries, part 169.
2981. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2982. gbtsa170.seq - TSA (transcriptome shotgun assembly) sequence entries, part 170.
2983. gbtsa171.seq - TSA (transcriptome shotgun assembly) sequence entries, part 171.
2984. gbtsa172.seq - TSA (transcriptome shotgun assembly) sequence entries, part 172.
2985. gbtsa173.seq - TSA (transcriptome shotgun assembly) sequence entries, part 173.
2986. gbtsa174.seq - TSA (transcriptome shotgun assembly) sequence entries, part 174.
2987. gbtsa175.seq - TSA (transcriptome shotgun assembly) sequence entries, part 175.
2988. gbtsa176.seq - TSA (transcriptome shotgun assembly) sequence entries, part 176.
2989. gbtsa177.seq - TSA (transcriptome shotgun assembly) sequence entries, part 177.
2990. gbtsa178.seq - TSA (transcriptome shotgun assembly) sequence entries, part 178.
2991. gbtsa179.seq - TSA (transcriptome shotgun assembly) sequence entries, part 179.
2992. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2993. gbtsa180.seq - TSA (transcriptome shotgun assembly) sequence entries, part 180.
2994. gbtsa181.seq - TSA (transcriptome shotgun assembly) sequence entries, part 181.
2995. gbtsa182.seq - TSA (transcriptome shotgun assembly) sequence entries, part 182.
2996. gbtsa183.seq - TSA (transcriptome shotgun assembly) sequence entries, part 183.
2997. gbtsa184.seq - TSA (transcriptome shotgun assembly) sequence entries, part 184.
2998. gbtsa185.seq - TSA (transcriptome shotgun assembly) sequence entries, part 185.
2999. gbtsa186.seq - TSA (transcriptome shotgun assembly) sequence entries, part 186.
3000. gbtsa187.seq - TSA (transcriptome shotgun assembly) sequence entries, part 187.
3001. gbtsa188.seq - TSA (transcriptome shotgun assembly) sequence entries, part 188.
3002. gbtsa189.seq - TSA (transcriptome shotgun assembly) sequence entries, part 189.
3003. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
3004. gbtsa190.seq - TSA (transcriptome shotgun assembly) sequence entries, part 190.
3005. gbtsa191.seq - TSA (transcriptome shotgun assembly) sequence entries, part 191.
3006. gbtsa192.seq - TSA (transcriptome shotgun assembly) sequence entries, part 192.
3007. gbtsa193.seq - TSA (transcriptome shotgun assembly) sequence entries, part 193.
3008. gbtsa194.seq - TSA (transcriptome shotgun assembly) sequence entries, part 194.
3009. gbtsa195.seq - TSA (transcriptome shotgun assembly) sequence entries, part 195.
3010. gbtsa196.seq - TSA (transcriptome shotgun assembly) sequence entries, part 196.
3011. gbtsa197.seq - TSA (transcriptome shotgun assembly) sequence entries, part 197.
3012. gbtsa198.seq - TSA (transcriptome shotgun assembly) sequence entries, part 198.
3013. gbtsa199.seq - TSA (transcriptome shotgun assembly) sequence entries, part 199.
3014. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
3015. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
3016. gbtsa200.seq - TSA (transcriptome shotgun assembly) sequence entries, part 200.
3017. gbtsa201.seq - TSA (transcriptome shotgun assembly) sequence entries, part 201.
3018. gbtsa202.seq - TSA (transcriptome shotgun assembly) sequence entries, part 202.
3019. gbtsa203.seq - TSA (transcriptome shotgun assembly) sequence entries, part 203.
3020. gbtsa204.seq - TSA (transcriptome shotgun assembly) sequence entries, part 204.
3021. gbtsa205.seq - TSA (transcriptome shotgun assembly) sequence entries, part 205.
3022. gbtsa206.seq - TSA (transcriptome shotgun assembly) sequence entries, part 206.
3023. gbtsa207.seq - TSA (transcriptome shotgun assembly) sequence entries, part 207.
3024. gbtsa208.seq - TSA (transcriptome shotgun assembly) sequence entries, part 208.
3025. gbtsa209.seq - TSA (transcriptome shotgun assembly) sequence entries, part 209.
3026. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
3027. gbtsa210.seq - TSA (transcriptome shotgun assembly) sequence entries, part 210.
3028. gbtsa211.seq - TSA (transcriptome shotgun assembly) sequence entries, part 211.
3029. gbtsa212.seq - TSA (transcriptome shotgun assembly) sequence entries, part 212.
3030. gbtsa213.seq - TSA (transcriptome shotgun assembly) sequence entries, part 213.
3031. gbtsa214.seq - TSA (transcriptome shotgun assembly) sequence entries, part 214.
3032. gbtsa215.seq - TSA (transcriptome shotgun assembly) sequence entries, part 215.
3033. gbtsa216.seq - TSA (transcriptome shotgun assembly) sequence entries, part 216.
3034. gbtsa217.seq - TSA (transcriptome shotgun assembly) sequence entries, part 217.
3035. gbtsa218.seq - TSA (transcriptome shotgun assembly) sequence entries, part 218.
3036. gbtsa219.seq - TSA (transcriptome shotgun assembly) sequence entries, part 219.
3037. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
3038. gbtsa220.seq - TSA (transcriptome shotgun assembly) sequence entries, part 220.
3039. gbtsa221.seq - TSA (transcriptome shotgun assembly) sequence entries, part 221.
3040. gbtsa222.seq - TSA (transcriptome shotgun assembly) sequence entries, part 222.
3041. gbtsa223.seq - TSA (transcriptome shotgun assembly) sequence entries, part 223.
3042. gbtsa224.seq - TSA (transcriptome shotgun assembly) sequence entries, part 224.
3043. gbtsa225.seq - TSA (transcriptome shotgun assembly) sequence entries, part 225.
3044. gbtsa226.seq - TSA (transcriptome shotgun assembly) sequence entries, part 226.
3045. gbtsa227.seq - TSA (transcriptome shotgun assembly) sequence entries, part 227.
3046. gbtsa228.seq - TSA (transcriptome shotgun assembly) sequence entries, part 228.
3047. gbtsa229.seq - TSA (transcriptome shotgun assembly) sequence entries, part 229.
3048. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
3049. gbtsa230.seq - TSA (transcriptome shotgun assembly) sequence entries, part 230.
3050. gbtsa231.seq - TSA (transcriptome shotgun assembly) sequence entries, part 231.
3051. gbtsa232.seq - TSA (transcriptome shotgun assembly) sequence entries, part 232.
3052. gbtsa233.seq - TSA (transcriptome shotgun assembly) sequence entries, part 233.
3053. gbtsa234.seq - TSA (transcriptome shotgun assembly) sequence entries, part 234.
3054. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
3055. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
3056. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
3057. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
3058. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
3059. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
3060. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
3061. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
3062. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
3063. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
3064. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
3065. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
3066. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
3067. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
3068. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
3069. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
3070. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
3071. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
3072. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
3073. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
3074. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
3075. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
3076. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
3077. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
3078. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
3079. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
3080. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
3081. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
3082. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
3083. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
3084. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
3085. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
3086. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
3087. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
3088. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
3089. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
3090. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
3091. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
3092. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
3093. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
3094. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
3095. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
3096. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
3097. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
3098. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
3099. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
3100. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
3101. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
3102. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
3103. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
3104. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
3105. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
3106. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
3107. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
3108. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
3109. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
3110. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
3111. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
3112. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
3113. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
3114. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
3115. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
3116. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
3117. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
3118. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
3119. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
3120. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
3121. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
3122. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
3123. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
3124. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
3125. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
3126. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
3127. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
3128. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
3129. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
3130. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
3131. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
3132. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
3133. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
3134. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
3135. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
3136. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
3137. gbuna1.seq - Unannotated sequence entries, part 1.
3138. gbvrl1.seq - Viral sequence entries, part 1.
3139. gbvrl10.seq - Viral sequence entries, part 10.
3140. gbvrl11.seq - Viral sequence entries, part 11.
3141. gbvrl12.seq - Viral sequence entries, part 12.
3142. gbvrl13.seq - Viral sequence entries, part 13.
3143. gbvrl14.seq - Viral sequence entries, part 14.
3144. gbvrl15.seq - Viral sequence entries, part 15.
3145. gbvrl16.seq - Viral sequence entries, part 16.
3146. gbvrl17.seq - Viral sequence entries, part 17.
3147. gbvrl18.seq - Viral sequence entries, part 18.
3148. gbvrl19.seq - Viral sequence entries, part 19.
3149. gbvrl2.seq - Viral sequence entries, part 2.
3150. gbvrl20.seq - Viral sequence entries, part 20.
3151. gbvrl21.seq - Viral sequence entries, part 21.
3152. gbvrl22.seq - Viral sequence entries, part 22.
3153. gbvrl23.seq - Viral sequence entries, part 23.
3154. gbvrl24.seq - Viral sequence entries, part 24.
3155. gbvrl25.seq - Viral sequence entries, part 25.
3156. gbvrl26.seq - Viral sequence entries, part 26.
3157. gbvrl27.seq - Viral sequence entries, part 27.
3158. gbvrl28.seq - Viral sequence entries, part 28.
3159. gbvrl29.seq - Viral sequence entries, part 29.
3160. gbvrl3.seq - Viral sequence entries, part 3.
3161. gbvrl30.seq - Viral sequence entries, part 30.
3162. gbvrl31.seq - Viral sequence entries, part 31.
3163. gbvrl32.seq - Viral sequence entries, part 32.
3164. gbvrl33.seq - Viral sequence entries, part 33.
3165. gbvrl34.seq - Viral sequence entries, part 34.
3166. gbvrl35.seq - Viral sequence entries, part 35.
3167. gbvrl36.seq - Viral sequence entries, part 36.
3168. gbvrl37.seq - Viral sequence entries, part 37.
3169. gbvrl38.seq - Viral sequence entries, part 38.
3170. gbvrl39.seq - Viral sequence entries, part 39.
3171. gbvrl4.seq - Viral sequence entries, part 4.
3172. gbvrl40.seq - Viral sequence entries, part 40.
3173. gbvrl41.seq - Viral sequence entries, part 41.
3174. gbvrl42.seq - Viral sequence entries, part 42.
3175. gbvrl43.seq - Viral sequence entries, part 43.
3176. gbvrl44.seq - Viral sequence entries, part 44.
3177. gbvrl45.seq - Viral sequence entries, part 45.
3178. gbvrl46.seq - Viral sequence entries, part 46.
3179. gbvrl47.seq - Viral sequence entries, part 47.
3180. gbvrl48.seq - Viral sequence entries, part 48.
3181. gbvrl49.seq - Viral sequence entries, part 49.
3182. gbvrl5.seq - Viral sequence entries, part 5.
3183. gbvrl50.seq - Viral sequence entries, part 50.
3184. gbvrl51.seq - Viral sequence entries, part 51.
3185. gbvrl52.seq - Viral sequence entries, part 52.
3186. gbvrl53.seq - Viral sequence entries, part 53.
3187. gbvrl54.seq - Viral sequence entries, part 54.
3188. gbvrl55.seq - Viral sequence entries, part 55.
3189. gbvrl56.seq - Viral sequence entries, part 56.
3190. gbvrl57.seq - Viral sequence entries, part 57.
3191. gbvrl58.seq - Viral sequence entries, part 58.
3192. gbvrl59.seq - Viral sequence entries, part 59.
3193. gbvrl6.seq - Viral sequence entries, part 6.
3194. gbvrl7.seq - Viral sequence entries, part 7.
3195. gbvrl8.seq - Viral sequence entries, part 8.
3196. gbvrl9.seq - Viral sequence entries, part 9.
3197. gbvrt1.seq - Other vertebrate sequence entries, part 1.
3198. gbvrt10.seq - Other vertebrate sequence entries, part 10.
3199. gbvrt11.seq - Other vertebrate sequence entries, part 11.
3200. gbvrt12.seq - Other vertebrate sequence entries, part 12.
3201. gbvrt13.seq - Other vertebrate sequence entries, part 13.
3202. gbvrt14.seq - Other vertebrate sequence entries, part 14.
3203. gbvrt15.seq - Other vertebrate sequence entries, part 15.
3204. gbvrt16.seq - Other vertebrate sequence entries, part 16.
3205. gbvrt17.seq - Other vertebrate sequence entries, part 17.
3206. gbvrt18.seq - Other vertebrate sequence entries, part 18.
3207. gbvrt19.seq - Other vertebrate sequence entries, part 19.
3208. gbvrt2.seq - Other vertebrate sequence entries, part 2.
3209. gbvrt20.seq - Other vertebrate sequence entries, part 20.
3210. gbvrt21.seq - Other vertebrate sequence entries, part 21.
3211. gbvrt22.seq - Other vertebrate sequence entries, part 22.
3212. gbvrt23.seq - Other vertebrate sequence entries, part 23.
3213. gbvrt24.seq - Other vertebrate sequence entries, part 24.
3214. gbvrt25.seq - Other vertebrate sequence entries, part 25.
3215. gbvrt26.seq - Other vertebrate sequence entries, part 26.
3216. gbvrt27.seq - Other vertebrate sequence entries, part 27.
3217. gbvrt28.seq - Other vertebrate sequence entries, part 28.
3218. gbvrt29.seq - Other vertebrate sequence entries, part 29.
3219. gbvrt3.seq - Other vertebrate sequence entries, part 3.
3220. gbvrt30.seq - Other vertebrate sequence entries, part 30.
3221. gbvrt31.seq - Other vertebrate sequence entries, part 31.
3222. gbvrt32.seq - Other vertebrate sequence entries, part 32.
3223. gbvrt33.seq - Other vertebrate sequence entries, part 33.
3224. gbvrt34.seq - Other vertebrate sequence entries, part 34.
3225. gbvrt35.seq - Other vertebrate sequence entries, part 35.
3226. gbvrt36.seq - Other vertebrate sequence entries, part 36.
3227. gbvrt37.seq - Other vertebrate sequence entries, part 37.
3228. gbvrt38.seq - Other vertebrate sequence entries, part 38.
3229. gbvrt39.seq - Other vertebrate sequence entries, part 39.
3230. gbvrt4.seq - Other vertebrate sequence entries, part 4.
3231. gbvrt40.seq - Other vertebrate sequence entries, part 40.
3232. gbvrt41.seq - Other vertebrate sequence entries, part 41.
3233. gbvrt42.seq - Other vertebrate sequence entries, part 42.
3234. gbvrt43.seq - Other vertebrate sequence entries, part 43.
3235. gbvrt44.seq - Other vertebrate sequence entries, part 44.
3236. gbvrt45.seq - Other vertebrate sequence entries, part 45.
3237. gbvrt46.seq - Other vertebrate sequence entries, part 46.
3238. gbvrt47.seq - Other vertebrate sequence entries, part 47.
3239. gbvrt48.seq - Other vertebrate sequence entries, part 48.
3240. gbvrt49.seq - Other vertebrate sequence entries, part 49.
3241. gbvrt5.seq - Other vertebrate sequence entries, part 5.
3242. gbvrt50.seq - Other vertebrate sequence entries, part 50.
3243. gbvrt51.seq - Other vertebrate sequence entries, part 51.
3244. gbvrt52.seq - Other vertebrate sequence entries, part 52.
3245. gbvrt53.seq - Other vertebrate sequence entries, part 53.
3246. gbvrt54.seq - Other vertebrate sequence entries, part 54.
3247. gbvrt55.seq - Other vertebrate sequence entries, part 55.
3248. gbvrt56.seq - Other vertebrate sequence entries, part 56.
3249. gbvrt57.seq - Other vertebrate sequence entries, part 57.
3250. gbvrt58.seq - Other vertebrate sequence entries, part 58.
3251. gbvrt59.seq - Other vertebrate sequence entries, part 59.
3252. gbvrt6.seq - Other vertebrate sequence entries, part 6.
3253. gbvrt60.seq - Other vertebrate sequence entries, part 60.
3254. gbvrt61.seq - Other vertebrate sequence entries, part 61.
3255. gbvrt62.seq - Other vertebrate sequence entries, part 62.
3256. gbvrt63.seq - Other vertebrate sequence entries, part 63.
3257. gbvrt64.seq - Other vertebrate sequence entries, part 64.
3258. gbvrt65.seq - Other vertebrate sequence entries, part 65.
3259. gbvrt66.seq - Other vertebrate sequence entries, part 66.
3260. gbvrt67.seq - Other vertebrate sequence entries, part 67.
3261. gbvrt68.seq - Other vertebrate sequence entries, part 68.
3262. gbvrt69.seq - Other vertebrate sequence entries, part 69.
3263. gbvrt7.seq - Other vertebrate sequence entries, part 7.
3264. gbvrt70.seq - Other vertebrate sequence entries, part 70.
3265. gbvrt71.seq - Other vertebrate sequence entries, part 71.
3266. gbvrt72.seq - Other vertebrate sequence entries, part 72.
3267. gbvrt73.seq - Other vertebrate sequence entries, part 73.
3268. gbvrt74.seq - Other vertebrate sequence entries, part 74.
3269. gbvrt75.seq - Other vertebrate sequence entries, part 75.
3270. gbvrt76.seq - Other vertebrate sequence entries, part 76.
3271. gbvrt77.seq - Other vertebrate sequence entries, part 77.
3272. gbvrt78.seq - Other vertebrate sequence entries, part 78.
3273. gbvrt79.seq - Other vertebrate sequence entries, part 79.
3274. gbvrt8.seq - Other vertebrate sequence entries, part 8.
3275. gbvrt80.seq - Other vertebrate sequence entries, part 80.
3276. gbvrt81.seq - Other vertebrate sequence entries, part 81.
3277. gbvrt82.seq - Other vertebrate sequence entries, part 82.
3278. gbvrt83.seq - Other vertebrate sequence entries, part 83.
3279. gbvrt84.seq - Other vertebrate sequence entries, part 84.
3280. gbvrt85.seq - Other vertebrate sequence entries, part 85.
3281. gbvrt86.seq - Other vertebrate sequence entries, part 86.
3282. gbvrt87.seq - Other vertebrate sequence entries, part 87.
3283. gbvrt88.seq - Other vertebrate sequence entries, part 88.
3284. gbvrt89.seq - Other vertebrate sequence entries, part 89.
3285. gbvrt9.seq - Other vertebrate sequence entries, part 9.
3286. gbvrt90.seq - Other vertebrate sequence entries, part 90.
3287. gbvrt91.seq - Other vertebrate sequence entries, part 91.
3288. gbvrt92.seq - Other vertebrate sequence entries, part 92.
3289. gbvrt93.seq - Other vertebrate sequence entries, part 93.
3290. gbvrt94.seq - Other vertebrate sequence entries, part 94.
3291. gbvrt95.seq - Other vertebrate sequence entries, part 95.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 229.0 flatfiles require roughly 934 GB (sequence
files only) or 934 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 249999536     gbbct1.seq
 212440503     gbbct10.seq
 241788084     gbbct100.seq
 246700568     gbbct101.seq
 249734165     gbbct102.seq
 239894254     gbbct103.seq
 244164482     gbbct104.seq
 245971886     gbbct105.seq
 244824525     gbbct106.seq
 241012420     gbbct107.seq
 241253040     gbbct108.seq
 244632881     gbbct109.seq
 102201191     gbbct11.seq
 247879337     gbbct110.seq
 239483634     gbbct111.seq
 248325996     gbbct112.seq
  58570566     gbbct113.seq
 244950777     gbbct114.seq
 246523341     gbbct115.seq
 240783673     gbbct116.seq
 242512461     gbbct117.seq
 242365577     gbbct118.seq
 242436790     gbbct119.seq
 245569221     gbbct12.seq
 243237447     gbbct120.seq
 244466731     gbbct121.seq
 246861818     gbbct122.seq
 244398726     gbbct123.seq
 239551701     gbbct124.seq
  63029575     gbbct125.seq
 241061325     gbbct126.seq
 241981601     gbbct127.seq
 247957273     gbbct128.seq
 245909858     gbbct129.seq
  36856569     gbbct13.seq
 243015659     gbbct130.seq
 247756129     gbbct131.seq
 244464732     gbbct132.seq
 234838992     gbbct133.seq
 249722679     gbbct134.seq
 179664588     gbbct135.seq
 243058580     gbbct136.seq
 241432484     gbbct137.seq
 243613731     gbbct138.seq
 247597850     gbbct139.seq
 248768491     gbbct14.seq
 247761924     gbbct140.seq
 249431207     gbbct141.seq
 245812827     gbbct142.seq
  45171391     gbbct143.seq
 244041850     gbbct144.seq
 242154067     gbbct145.seq
 241717723     gbbct146.seq
 247227673     gbbct147.seq
 248252639     gbbct148.seq
 248492868     gbbct149.seq
 242006339     gbbct15.seq
  95097975     gbbct150.seq
 249182232     gbbct151.seq
 240445666     gbbct152.seq
 245408698     gbbct153.seq
 247539814     gbbct154.seq
 243050086     gbbct155.seq
 246917271     gbbct156.seq
 246944217     gbbct157.seq
 158090177     gbbct158.seq
 246553114     gbbct159.seq
 246259327     gbbct16.seq
 244026129     gbbct160.seq
 240103172     gbbct161.seq
 249050572     gbbct162.seq
 249988967     gbbct163.seq
 243767703     gbbct164.seq
 247898708     gbbct165.seq
 249336891     gbbct166.seq
  25750486     gbbct167.seq
 249586703     gbbct168.seq
 243558974     gbbct169.seq
 240545261     gbbct17.seq
 245867616     gbbct170.seq
 248876007     gbbct171.seq
 245035399     gbbct172.seq
 243096563     gbbct173.seq
 249762321     gbbct174.seq
 241304516     gbbct175.seq
 195549944     gbbct176.seq
 240745573     gbbct177.seq
 234138200     gbbct178.seq
 243391015     gbbct179.seq
 246347543     gbbct18.seq
 244694459     gbbct180.seq
 247991618     gbbct181.seq
 242910838     gbbct182.seq
 249180710     gbbct183.seq
 234991890     gbbct184.seq
 119567256     gbbct185.seq
 249325478     gbbct186.seq
 249672015     gbbct187.seq
 242373605     gbbct188.seq
 242412790     gbbct189.seq
 232454468     gbbct19.seq
 246355346     gbbct190.seq
 245692156     gbbct191.seq
 240050949     gbbct192.seq
 102513214     gbbct193.seq
 241808257     gbbct194.seq
 245486854     gbbct195.seq
 248795219     gbbct196.seq
 245075371     gbbct197.seq
 244623598     gbbct198.seq
 241036778     gbbct199.seq
 242096864     gbbct2.seq
 249111492     gbbct20.seq
 240953269     gbbct200.seq
 116359915     gbbct201.seq
 243952724     gbbct202.seq
 240031513     gbbct203.seq
 247739431     gbbct204.seq
 246053700     gbbct205.seq
 249797544     gbbct206.seq
 248686024     gbbct207.seq
 243414024     gbbct208.seq
 249909811     gbbct209.seq
 246847396     gbbct21.seq
 246104268     gbbct210.seq
 249506141     gbbct211.seq
 248910775     gbbct212.seq
 240574421     gbbct213.seq
 241863646     gbbct214.seq
  71298900     gbbct215.seq
 244265982     gbbct216.seq
 244087884     gbbct217.seq
 249535783     gbbct218.seq
 249845661     gbbct219.seq
 248911455     gbbct22.seq
 247966666     gbbct220.seq
 239314822     gbbct221.seq
 244652962     gbbct222.seq
 229096697     gbbct223.seq
 244729587     gbbct224.seq
 241701506     gbbct225.seq
 242815608     gbbct226.seq
 249349311     gbbct227.seq
 246469120     gbbct228.seq
 246126151     gbbct229.seq
 235558044     gbbct23.seq
 243129989     gbbct230.seq
 248465603     gbbct231.seq
 243513221     gbbct232.seq
 247535076     gbbct233.seq
 154664838     gbbct234.seq
 242952907     gbbct235.seq
 243260145     gbbct236.seq
 246163313     gbbct237.seq
 239796030     gbbct238.seq
 245967543     gbbct239.seq
 244196009     gbbct24.seq
 240086852     gbbct240.seq
 249572907     gbbct241.seq
 238452247     gbbct242.seq
 243049535     gbbct243.seq
 144614030     gbbct244.seq
 249969526     gbbct245.seq
 246026506     gbbct246.seq
 246089708     gbbct247.seq
 245038394     gbbct248.seq
 249767998     gbbct249.seq
 249835702     gbbct25.seq
 249725282     gbbct250.seq
 248077197     gbbct251.seq
 240152972     gbbct252.seq
 247396075     gbbct253.seq
 240850069     gbbct254.seq
 247294536     gbbct255.seq
  71908618     gbbct256.seq
 238304435     gbbct257.seq
 246105675     gbbct258.seq
 237805767     gbbct259.seq
 246759161     gbbct26.seq
 249697142     gbbct260.seq
 249960342     gbbct261.seq
 249803901     gbbct262.seq
 245263437     gbbct263.seq
 247878550     gbbct264.seq
 243348064     gbbct265.seq
 245447979     gbbct266.seq
 244027135     gbbct267.seq
 247963020     gbbct268.seq
  80022005     gbbct269.seq
 249787214     gbbct27.seq
 245075201     gbbct270.seq
 249658068     gbbct271.seq
 245458904     gbbct272.seq
 246010119     gbbct273.seq
 246819001     gbbct274.seq
 248340061     gbbct275.seq
 246698549     gbbct276.seq
 247576537     gbbct277.seq
 245926295     gbbct278.seq
 246370153     gbbct279.seq
 243617372     gbbct28.seq
 248225089     gbbct280.seq
 244072105     gbbct281.seq
 248817327     gbbct282.seq
 128630149     gbbct283.seq
 237266857     gbbct284.seq
 247272151     gbbct285.seq
 249269452     gbbct286.seq
 248613667     gbbct287.seq
 249446226     gbbct288.seq
 246206129     gbbct289.seq
 205916265     gbbct29.seq
 238098690     gbbct290.seq
 241889852     gbbct291.seq
 102213063     gbbct292.seq
 249095007     gbbct293.seq
 238105099     gbbct294.seq
 243190790     gbbct295.seq
 243373693     gbbct296.seq
 244327491     gbbct297.seq
 241324223     gbbct298.seq
 245182719     gbbct299.seq
 248982286     gbbct3.seq
  21361554     gbbct30.seq
  15384052     gbbct300.seq
 246600840     gbbct301.seq
 248402440     gbbct302.seq
 244815797     gbbct303.seq
 239366214     gbbct304.seq
 247379417     gbbct305.seq
 239588319     gbbct306.seq
 241061131     gbbct307.seq
 248778683     gbbct308.seq
 247600004     gbbct309.seq
  38593312     gbbct31.seq
 240545316     gbbct310.seq
 246339837     gbbct311.seq
 246167734     gbbct312.seq
 236418862     gbbct313.seq
 248572362     gbbct314.seq
  52901275     gbbct315.seq
 248391326     gbbct316.seq
 244714061     gbbct317.seq
 246220471     gbbct318.seq
 247716002     gbbct319.seq
 237251058     gbbct32.seq
 242944047     gbbct320.seq
 243449750     gbbct321.seq
 248736229     gbbct322.seq
 249831860     gbbct323.seq
 249475726     gbbct324.seq
 247144318     gbbct325.seq
  75560213     gbbct326.seq
 243309579     gbbct327.seq
 248787121     gbbct328.seq
 248409688     gbbct329.seq
 242844247     gbbct33.seq
 246798396     gbbct330.seq
 248851654     gbbct331.seq
 248851403     gbbct332.seq
 245090337     gbbct333.seq
 241471561     gbbct334.seq
  56222398     gbbct335.seq
 244520390     gbbct336.seq
 248045621     gbbct337.seq
 249211838     gbbct338.seq
 243640666     gbbct339.seq
 240149614     gbbct34.seq
 238305979     gbbct340.seq
 246899967     gbbct341.seq
 245217544     gbbct342.seq
 229714047     gbbct343.seq
 241749234     gbbct344.seq
 247529280     gbbct345.seq
 248176894     gbbct346.seq
 248893322     gbbct347.seq
 248259801     gbbct348.seq
 245430473     gbbct349.seq
 246542072     gbbct35.seq
 247256318     gbbct350.seq
 240518138     gbbct351.seq
 243699460     gbbct352.seq
  37520302     gbbct353.seq
 247924017     gbbct354.seq
 244633899     gbbct355.seq
 248904633     gbbct356.seq
 240224673     gbbct357.seq
 246704971     gbbct358.seq
 245964695     gbbct359.seq
 245935466     gbbct36.seq
 249278001     gbbct360.seq
 248132227     gbbct361.seq
 249436989     gbbct362.seq
 249600624     gbbct363.seq
 247210515     gbbct364.seq
 248091154     gbbct365.seq
  55953649     gbbct366.seq
 247663514     gbbct367.seq
 243894562     gbbct368.seq
 243366324     gbbct369.seq
 249518826     gbbct37.seq
 242749969     gbbct370.seq
 241355538     gbbct371.seq
 241998706     gbbct372.seq
 246754840     gbbct373.seq
  67081686     gbbct374.seq
 249054923     gbbct375.seq
 245666655     gbbct376.seq
 249109052     gbbct377.seq
 243244715     gbbct378.seq
 248106540     gbbct379.seq
 246133996     gbbct38.seq
 244485232     gbbct380.seq
 240231011     gbbct381.seq
  83927117     gbbct382.seq
 244270477     gbbct383.seq
 249627909     gbbct384.seq
 247995950     gbbct385.seq
 246075931     gbbct386.seq
 243761854     gbbct387.seq
 240577097     gbbct388.seq
 242041824     gbbct389.seq
 242552745     gbbct39.seq
 246065471     gbbct390.seq
 249279071     gbbct391.seq
 247435574     gbbct392.seq
 240003213     gbbct393.seq
 246885476     gbbct394.seq
 249053397     gbbct395.seq
 249796951     gbbct396.seq
 247223795     gbbct397.seq
 244587223     gbbct398.seq
 249957275     gbbct399.seq
 248856801     gbbct4.seq
 178904831     gbbct40.seq
  96796951     gbbct400.seq
 247098442     gbbct401.seq
 243279398     gbbct402.seq
 246463963     gbbct403.seq
 237574151     gbbct404.seq
 244789832     gbbct405.seq
 246850792     gbbct406.seq
 247000784     gbbct407.seq
 249200104     gbbct408.seq
 248116255     gbbct409.seq
 249772673     gbbct41.seq
  82627349     gbbct410.seq
 244810999     gbbct411.seq
 240926350     gbbct412.seq
 244954385     gbbct413.seq
 243356728     gbbct414.seq
 249592278     gbbct415.seq
 246367391     gbbct416.seq
 249516051     gbbct417.seq
 132236783     gbbct418.seq
 247280490     gbbct419.seq
 245210448     gbbct42.seq
 247913890     gbbct420.seq
 246448101     gbbct421.seq
 241018416     gbbct422.seq
 239980548     gbbct423.seq
 246375033     gbbct424.seq
 248798955     gbbct425.seq
 247050181     gbbct426.seq
 246035151     gbbct427.seq
 243608590     gbbct428.seq
 241320892     gbbct429.seq
 246908970     gbbct43.seq
 243690185     gbbct430.seq
 199957651     gbbct431.seq
 248815646     gbbct432.seq
 249156042     gbbct433.seq
 244080022     gbbct434.seq
 248919967     gbbct435.seq
 235844328     gbbct436.seq
 246749729     gbbct437.seq
 241591978     gbbct438.seq
 208067261     gbbct439.seq
 248715782     gbbct44.seq
 246561154     gbbct440.seq
 240892770     gbbct441.seq
 235287450     gbbct442.seq
 248462303     gbbct443.seq
 249090597     gbbct444.seq
 248984269     gbbct445.seq
 247748049     gbbct446.seq
 243358282     gbbct447.seq
 246254185     gbbct448.seq
 249877761     gbbct449.seq
 240139156     gbbct45.seq
 248394407     gbbct450.seq
 182556377     gbbct451.seq
 248201876     gbbct452.seq
 240522006     gbbct453.seq
 249545919     gbbct454.seq
 248371025     gbbct455.seq
 249344755     gbbct456.seq
 249118424     gbbct457.seq
 242969036     gbbct458.seq
 140677493     gbbct459.seq
 247355401     gbbct46.seq
 242717195     gbbct460.seq
 248733325     gbbct461.seq
 244492630     gbbct462.seq
 243946983     gbbct463.seq
 248360441     gbbct464.seq
 247875514     gbbct465.seq
 247445592     gbbct466.seq
 196222383     gbbct467.seq
 248497790     gbbct468.seq
 247079315     gbbct469.seq
 238146778     gbbct47.seq
 247130214     gbbct470.seq
 249237393     gbbct471.seq
 245533564     gbbct472.seq
 242456469     gbbct473.seq
 245667703     gbbct474.seq
 114892392     gbbct475.seq
 243787668     gbbct476.seq
 240871607     gbbct477.seq
 247936321     gbbct478.seq
 247554626     gbbct479.seq
 248494556     gbbct48.seq
 248541855     gbbct480.seq
 246773474     gbbct481.seq
 249172210     gbbct482.seq
 247695648     gbbct483.seq
 244771571     gbbct484.seq
 249850070     gbbct485.seq
  86697092     gbbct486.seq
 246618717     gbbct487.seq
  59045661     gbbct488.seq
   6831749     gbbct489.seq
 249758392     gbbct49.seq
  14104098     gbbct490.seq
  22748969     gbbct491.seq
  44383275     gbbct492.seq
  86374389     gbbct493.seq
 168079549     gbbct494.seq
 249999264     gbbct495.seq
 249998762     gbbct496.seq
 246327250     gbbct497.seq
 245551669     gbbct498.seq
 248944424     gbbct499.seq
 249978259     gbbct5.seq
 247755108     gbbct50.seq
 248169254     gbbct500.seq
 245373505     gbbct501.seq
 243449492     gbbct502.seq
 249613508     gbbct503.seq
 249999433     gbbct504.seq
  12598830     gbbct505.seq
 248642483     gbbct506.seq
 244384147     gbbct507.seq
 249044585     gbbct508.seq
 249997620     gbbct509.seq
 246732695     gbbct51.seq
 248188750     gbbct510.seq
 249999626     gbbct511.seq
 249999281     gbbct512.seq
 226902212     gbbct513.seq
 249993532     gbbct514.seq
 249999527     gbbct515.seq
 250000250     gbbct516.seq
  38976518     gbbct517.seq
 249999097     gbbct518.seq
 249999275     gbbct519.seq
 244496764     gbbct52.seq
  83238041     gbbct520.seq
 249998764     gbbct521.seq
 249997799     gbbct522.seq
 120843931     gbbct523.seq
 249997905     gbbct524.seq
 249993291     gbbct525.seq
  33894297     gbbct526.seq
 140134897     gbbct527.seq
 244614125     gbbct528.seq
 249602003     gbbct529.seq
 116082121     gbbct53.seq
 244307830     gbbct530.seq
 124334468     gbbct531.seq
 247516851     gbbct532.seq
 246613653     gbbct533.seq
 245702552     gbbct534.seq
 249414715     gbbct535.seq
 239983684     gbbct536.seq
 247706528     gbbct537.seq
 246643903     gbbct538.seq
 248268774     gbbct539.seq
 245319818     gbbct54.seq
 247022658     gbbct540.seq
 245327725     gbbct541.seq
 249458659     gbbct542.seq
 248215547     gbbct543.seq
 226793535     gbbct544.seq
 247762102     gbbct545.seq
 240592547     gbbct546.seq
 237340764     gbbct547.seq
 249331091     gbbct548.seq
 247076145     gbbct549.seq
 239965684     gbbct55.seq
 246000711     gbbct550.seq
 247206317     gbbct551.seq
 239280287     gbbct552.seq
 130217418     gbbct553.seq
 246057103     gbbct554.seq
 247852493     gbbct555.seq
 244899902     gbbct556.seq
 244159800     gbbct557.seq
 247850313     gbbct558.seq
 247592492     gbbct559.seq
 243796561     gbbct56.seq
 249569049     gbbct560.seq
 173289970     gbbct561.seq
  50756602     gbbct562.seq
 103846230     gbbct563.seq
 249998418     gbbct564.seq
 249998954     gbbct565.seq
 162485080     gbbct566.seq
 246826813     gbbct57.seq
 249204125     gbbct58.seq
 248427261     gbbct59.seq
  40301527     gbbct6.seq
 245610930     gbbct60.seq
 244011660     gbbct61.seq
 249937923     gbbct62.seq
 247965897     gbbct63.seq
 249558828     gbbct64.seq
 243879697     gbbct65.seq
 240165726     gbbct66.seq
 249557921     gbbct67.seq
 249998385     gbbct68.seq
 242573406     gbbct69.seq
 236412674     gbbct7.seq
 249169441     gbbct70.seq
 246723921     gbbct71.seq
 244405644     gbbct72.seq
 242761770     gbbct73.seq
 249983364     gbbct74.seq
 247124168     gbbct75.seq
 244747359     gbbct76.seq
 249662213     gbbct77.seq
 247348132     gbbct78.seq
   4108412     gbbct79.seq
 157697346     gbbct8.seq
 244241177     gbbct80.seq
 247972834     gbbct81.seq
 249362099     gbbct82.seq
 240280108     gbbct83.seq
 249672432     gbbct84.seq
 247055113     gbbct85.seq
 244594662     gbbct86.seq
 249789616     gbbct87.seq
 238886157     gbbct88.seq
 248633884     gbbct89.seq
 246786517     gbbct9.seq
 249773974     gbbct90.seq
 247796006     gbbct91.seq
 246124051     gbbct92.seq
  30310080     gbbct93.seq
 245123030     gbbct94.seq
 248424275     gbbct95.seq
 244247651     gbbct96.seq
 244865681     gbbct97.seq
 248232014     gbbct98.seq
 240342508     gbbct99.seq
   1490310     gbchg.txt
 249999167     gbcon1.seq
 249993616     gbcon10.seq
 249995149     gbcon100.seq
 250000102     gbcon101.seq
  48471727     gbcon102.seq
 249995058     gbcon103.seq
 249995292     gbcon104.seq
 249999081     gbcon105.seq
 249996003     gbcon106.seq
 249997161     gbcon107.seq
   9912200     gbcon108.seq
 249999865     gbcon109.seq
 244549243     gbcon11.seq
 249997281     gbcon110.seq
 249998854     gbcon111.seq
 249998474     gbcon112.seq
 187377117     gbcon113.seq
 249993476     gbcon114.seq
 249996617     gbcon115.seq
 249996794     gbcon116.seq
 249995754     gbcon117.seq
 249995024     gbcon118.seq
 114605876     gbcon119.seq
 247881007     gbcon12.seq
 249997526     gbcon120.seq
 249996436     gbcon121.seq
 249997759     gbcon122.seq
 249997192     gbcon123.seq
 249996943     gbcon124.seq
 136128497     gbcon125.seq
 249998114     gbcon126.seq
 249995914     gbcon127.seq
 249999832     gbcon128.seq
 222788052     gbcon129.seq
 246532698     gbcon13.seq
 173591655     gbcon130.seq
 249996463     gbcon131.seq
 249998895     gbcon132.seq
  40225154     gbcon133.seq
 249999603     gbcon134.seq
 249983531     gbcon135.seq
 203591373     gbcon136.seq
 199346006     gbcon137.seq
 249841821     gbcon138.seq
 249613155     gbcon139.seq
 238111268     gbcon14.seq
 249998717     gbcon140.seq
 250000257     gbcon141.seq
 249999720     gbcon142.seq
 126272309     gbcon143.seq
 250000136     gbcon144.seq
 249414186     gbcon145.seq
 244776550     gbcon146.seq
 244013501     gbcon147.seq
 249998477     gbcon148.seq
 249862330     gbcon149.seq
 246803367     gbcon15.seq
 249999504     gbcon150.seq
  85430345     gbcon151.seq
 249999726     gbcon152.seq
 249995400     gbcon153.seq
 249938140     gbcon154.seq
 249823095     gbcon155.seq
 249998079     gbcon156.seq
 250000171     gbcon157.seq
 249991985     gbcon158.seq
   6379456     gbcon159.seq
 249106359     gbcon16.seq
 249570958     gbcon160.seq
 249999007     gbcon161.seq
 249999859     gbcon162.seq
 249999696     gbcon163.seq
 131027908     gbcon164.seq
 249998889     gbcon165.seq
 249999227     gbcon166.seq
 249984889     gbcon167.seq
 249998349     gbcon168.seq
 249999997     gbcon169.seq
 240808086     gbcon17.seq
 249997574     gbcon170.seq
 249996778     gbcon171.seq
   6823756     gbcon172.seq
 249999170     gbcon173.seq
 249998065     gbcon174.seq
 250000211     gbcon175.seq
 249998681     gbcon176.seq
 168840261     gbcon177.seq
 250000153     gbcon178.seq
 249998233     gbcon179.seq
 245641647     gbcon18.seq
 249116844     gbcon180.seq
 249972961     gbcon181.seq
 249999905     gbcon182.seq
 249974478     gbcon183.seq
 249810586     gbcon184.seq
 249842269     gbcon185.seq
 249998535     gbcon186.seq
  66673812     gbcon187.seq
 250000186     gbcon188.seq
 249995593     gbcon189.seq
 249835530     gbcon19.seq
 249999614     gbcon190.seq
 249995182     gbcon191.seq
 249998537     gbcon192.seq
 249999353     gbcon193.seq
   3256160     gbcon194.seq
 249999690     gbcon195.seq
 249999180     gbcon196.seq
 249997731     gbcon197.seq
 249999141     gbcon198.seq
 148368191     gbcon199.seq
 249999115     gbcon2.seq
 244936010     gbcon20.seq
 249996910     gbcon200.seq
 249953516     gbcon201.seq
 249992681     gbcon202.seq
 249999839     gbcon203.seq
 249998973     gbcon204.seq
 249940326     gbcon205.seq
 249998459     gbcon206.seq
   7464907     gbcon207.seq
 249995329     gbcon208.seq
 249998874     gbcon209.seq
 245207861     gbcon21.seq
 249998513     gbcon210.seq
 249999827     gbcon211.seq
 198324129     gbcon212.seq
  44793208     gbcon213.seq
 249999960     gbcon214.seq
 249997460     gbcon215.seq
 249999952     gbcon216.seq
 249992457     gbcon217.seq
 249997971     gbcon218.seq
 177764167     gbcon219.seq
 248592560     gbcon22.seq
 249998013     gbcon220.seq
 249998939     gbcon221.seq
 249992587     gbcon222.seq
 249999177     gbcon223.seq
 249979917     gbcon224.seq
 249998539     gbcon225.seq
 173116009     gbcon226.seq
 249997803     gbcon227.seq
 249992491     gbcon228.seq
 249997847     gbcon229.seq
 246089440     gbcon23.seq
 249997197     gbcon230.seq
 216484831     gbcon231.seq
 249999114     gbcon232.seq
 249998526     gbcon233.seq
 249994517     gbcon234.seq
 200780658     gbcon235.seq
 249998531     gbcon236.seq
 249998805     gbcon237.seq
 249997760     gbcon238.seq
 250000223     gbcon239.seq
 249997473     gbcon24.seq
 249999734     gbcon240.seq
   4000245     gbcon241.seq
 249251562     gbcon242.seq
 249999183     gbcon243.seq
 249997742     gbcon244.seq
 249959245     gbcon245.seq
 249985691     gbcon246.seq
 249972123     gbcon247.seq
  92888198     gbcon248.seq
 249999375     gbcon249.seq
  64176670     gbcon25.seq
 249999989     gbcon250.seq
 250000169     gbcon251.seq
 249999353     gbcon252.seq
 159031002     gbcon253.seq
 249999699     gbcon254.seq
 249999885     gbcon255.seq
 250000121     gbcon256.seq
 250000081     gbcon257.seq
   8766340     gbcon258.seq
 249998262     gbcon259.seq
 249990197     gbcon26.seq
 249992859     gbcon260.seq
 249615947     gbcon261.seq
 249999025     gbcon262.seq
 249996876     gbcon263.seq
 175638002     gbcon264.seq
 249999844     gbcon265.seq
 249990963     gbcon266.seq
 249998896     gbcon267.seq
 249998666     gbcon268.seq
 250000091     gbcon269.seq
 249995972     gbcon27.seq
 104911921     gbcon270.seq
 250000006     gbcon271.seq
 249993928     gbcon272.seq
 249999642     gbcon273.seq
 249984872     gbcon274.seq
 249994238     gbcon275.seq
 104113954     gbcon276.seq
 249327116     gbcon277.seq
 249997399     gbcon278.seq
 249999344     gbcon279.seq
 249999688     gbcon28.seq
 249999564     gbcon280.seq
 184746884     gbcon281.seq
 250000025     gbcon282.seq
 249998630     gbcon283.seq
 249802308     gbcon284.seq
 249997831     gbcon285.seq
 249993757     gbcon286.seq
 249998471     gbcon287.seq
 129494379     gbcon288.seq
 249873034     gbcon289.seq
 249999838     gbcon29.seq
 249979533     gbcon290.seq
 249670066     gbcon291.seq
 249966235     gbcon292.seq
 249995312     gbcon293.seq
 249967287     gbcon294.seq
 249974599     gbcon295.seq
 118939730     gbcon296.seq
 249999976     gbcon297.seq
 250000213     gbcon298.seq
 249981596     gbcon299.seq
 249997951     gbcon3.seq
 249998707     gbcon30.seq
 249999488     gbcon300.seq
 249997762     gbcon301.seq
 152685431     gbcon302.seq
 249996828     gbcon303.seq
 249998585     gbcon304.seq
 249999314     gbcon305.seq
 249998749     gbcon306.seq
 249900019     gbcon307.seq
 249991071     gbcon308.seq
 247504438     gbcon309.seq
 249999347     gbcon31.seq
 250000253     gbcon310.seq
 250000174     gbcon311.seq
 250000096     gbcon312.seq
 249248548     gbcon313.seq
 249728950     gbcon314.seq
 249997860     gbcon315.seq
 249981081     gbcon316.seq
 249997346     gbcon317.seq
 166378375     gbcon318.seq
 249999458     gbcon319.seq
  81247390     gbcon32.seq
 249998177     gbcon320.seq
 249019520     gbcon321.seq
 249998583     gbcon322.seq
 125802579     gbcon323.seq
 249560188     gbcon324.seq
 249996386     gbcon325.seq
 249999193     gbcon326.seq
 249998147     gbcon327.seq
 249998835     gbcon328.seq
 249998602     gbcon329.seq
 249998890     gbcon33.seq
 249999122     gbcon330.seq
 103501979     gbcon331.seq
 249999543     gbcon332.seq
 249965865     gbcon333.seq
 249998527     gbcon334.seq
 249999615     gbcon335.seq
 249994283     gbcon336.seq
 249992060     gbcon337.seq
  19002018     gbcon338.seq
 249913609     gbcon339.seq
 249999804     gbcon34.seq
 249998392     gbcon340.seq
 249998285     gbcon341.seq
 250000186     gbcon342.seq
 249998499     gbcon343.seq
 249999884     gbcon344.seq
  16274758     gbcon345.seq
 250000059     gbcon346.seq
 249902654     gbcon347.seq
 249938552     gbcon348.seq
 249999281     gbcon349.seq
 249999148     gbcon35.seq
 249997207     gbcon350.seq
 249995002     gbcon351.seq
 166369570     gbcon352.seq
 250000041     gbcon353.seq
 249998616     gbcon354.seq
 249999761     gbcon355.seq
 249999436     gbcon356.seq
  37638463     gbcon357.seq
 249999246     gbcon358.seq
 249998030     gbcon359.seq
 249999869     gbcon36.seq
 250000149     gbcon360.seq
 249998460     gbcon361.seq
 249996825     gbcon362.seq
 249994963     gbcon363.seq
 249999785     gbcon364.seq
 249999633     gbcon365.seq
   2667331     gbcon366.seq
 250000086     gbcon367.seq
 249999738     gbcon368.seq
 249999167     gbcon369.seq
 247507218     gbcon37.seq
 249999337     gbcon370.seq
 250000061     gbcon371.seq
 249993517     gbcon372.seq
 249999058     gbcon373.seq
 249999590     gbcon374.seq
   4510419     gbcon375.seq
 248843076     gbcon38.seq
 249981802     gbcon39.seq
 249996482     gbcon4.seq
  38588250     gbcon40.seq
 249997284     gbcon41.seq
 249483168     gbcon42.seq
 125744383     gbcon43.seq
 126402369     gbcon44.seq
 249991267     gbcon45.seq
 249999122     gbcon46.seq
 249999517     gbcon47.seq
 249997898     gbcon48.seq
  26019784     gbcon49.seq
 249999486     gbcon5.seq
 249999520     gbcon50.seq
 250000158     gbcon51.seq
 249997942     gbcon52.seq
 249996661     gbcon53.seq
 249999447     gbcon54.seq
 197804294     gbcon55.seq
 249995009     gbcon56.seq
 249998243     gbcon57.seq
 249997153     gbcon58.seq
 249998312     gbcon59.seq
 249996575     gbcon6.seq
 249999774     gbcon60.seq
 249998166     gbcon61.seq
  41929642     gbcon62.seq
 249997971     gbcon63.seq
 249998523     gbcon64.seq
 249994641     gbcon65.seq
 249997127     gbcon66.seq
 249999662     gbcon67.seq
  27021264     gbcon68.seq
 249996783     gbcon69.seq
  92832421     gbcon7.seq
 249999817     gbcon70.seq
 249998382     gbcon71.seq
 249995556     gbcon72.seq
 249997081     gbcon73.seq
  20620805     gbcon74.seq
 249994608     gbcon75.seq
 249995334     gbcon76.seq
 249996443     gbcon77.seq
 249996717     gbcon78.seq
 249997080     gbcon79.seq
 249992520     gbcon8.seq
 135388982     gbcon80.seq
 249999204     gbcon81.seq
 249998450     gbcon82.seq
 249998272     gbcon83.seq
 249997459     gbcon84.seq
 176584001     gbcon85.seq
 249996314     gbcon86.seq
 249999452     gbcon87.seq
 249994925     gbcon88.seq
 249997508     gbcon89.seq
 249909238     gbcon9.seq
 238783867     gbcon90.seq
 249999844     gbcon91.seq
 249998048     gbcon92.seq
 250000106     gbcon93.seq
 249995283     gbcon94.seq
 249993884     gbcon95.seq
  85705140     gbcon96.seq
 249995498     gbcon97.seq
 249995014     gbcon98.seq
 249999777     gbcon99.seq
   1755116     gbdel.txt
 249999876     gbenv1.seq
 249998311     gbenv10.seq
 249998256     gbenv100.seq
 249999743     gbenv101.seq
 250000174     gbenv102.seq
 249998239     gbenv103.seq
 249990426     gbenv104.seq
 112997549     gbenv105.seq
 249997839     gbenv11.seq
 249998242     gbenv12.seq
 249999440     gbenv13.seq
  53621119     gbenv14.seq
 249998427     gbenv15.seq
 249998667     gbenv16.seq
 249997820     gbenv17.seq
 249998183     gbenv18.seq
 249998651     gbenv19.seq
 249999186     gbenv2.seq
 249999340     gbenv20.seq
 249997752     gbenv21.seq
 245257008     gbenv22.seq
 249999248     gbenv23.seq
 249999566     gbenv24.seq
 249998988     gbenv25.seq
 249999018     gbenv26.seq
 173516163     gbenv27.seq
 249998167     gbenv28.seq
 249852096     gbenv29.seq
 249999754     gbenv3.seq
 249999405     gbenv30.seq
 249998872     gbenv31.seq
 249999467     gbenv32.seq
 249999941     gbenv33.seq
  70307949     gbenv34.seq
 249997840     gbenv35.seq
 249999605     gbenv36.seq
 249998953     gbenv37.seq
 249997178     gbenv38.seq
 177730583     gbenv39.seq
 249998156     gbenv4.seq
 249998801     gbenv40.seq
 249999742     gbenv41.seq
 249999455     gbenv42.seq
 249999321     gbenv43.seq
 249998950     gbenv44.seq
 249998998     gbenv45.seq
  46083489     gbenv46.seq
 249998756     gbenv47.seq
 250000105     gbenv48.seq
 249998744     gbenv49.seq
 248054610     gbenv5.seq
 249998033     gbenv50.seq
 192036198     gbenv51.seq
 249999454     gbenv52.seq
 249999556     gbenv53.seq
 249999135     gbenv54.seq
 250000251     gbenv55.seq
 249999639     gbenv56.seq
  83181815     gbenv57.seq
 249999388     gbenv58.seq
 249999694     gbenv59.seq
 249999140     gbenv6.seq
 249956191     gbenv60.seq
 249998946     gbenv61.seq
 250000010     gbenv62.seq
 213322012     gbenv63.seq
 249999393     gbenv64.seq
 249997581     gbenv65.seq
 249999418     gbenv66.seq
 249998419     gbenv67.seq
 249996423     gbenv68.seq
  84664264     gbenv69.seq
 249998129     gbenv7.seq
 250000103     gbenv70.seq
 250000207     gbenv71.seq
 249981071     gbenv72.seq
 249999315     gbenv73.seq
 249998282     gbenv74.seq
 143504885     gbenv75.seq
 249998256     gbenv76.seq
 249998718     gbenv77.seq
 249999704     gbenv78.seq
 249999894     gbenv79.seq
 249998805     gbenv8.seq
 249999034     gbenv80.seq
  90208264     gbenv81.seq
 249998691     gbenv82.seq
 249999769     gbenv83.seq
 249999909     gbenv84.seq
 249999925     gbenv85.seq
 236538670     gbenv86.seq
 249998096     gbenv87.seq
 249998572     gbenv88.seq
 249999045     gbenv89.seq
  22614989     gbenv9.seq
 249997717     gbenv90.seq
 249999520     gbenv91.seq
 128058292     gbenv92.seq
 249998503     gbenv93.seq
 250000084     gbenv94.seq
 249999530     gbenv95.seq
 249998209     gbenv96.seq
 249999088     gbenv97.seq
 171258000     gbenv98.seq
 249997888     gbenv99.seq
 524290193     gbest1.seq
 524289584     gbest10.seq
 524290757     gbest100.seq
 524290540     gbest101.seq
 524290627     gbest102.seq
 524291927     gbest103.seq
 327837727     gbest104.seq
 524291948     gbest105.seq
 524289523     gbest106.seq
 524288795     gbest107.seq
 381103684     gbest108.seq
 384304069     gbest109.seq
 524290828     gbest11.seq
 378451636     gbest110.seq
 379037807     gbest111.seq
 375969680     gbest112.seq
 380205062     gbest113.seq
 384567365     gbest114.seq
 383506355     gbest115.seq
 382359944     gbest116.seq
 378752882     gbest117.seq
 402059376     gbest118.seq
 479389521     gbest119.seq
 524289613     gbest12.seq
 524290339     gbest120.seq
 524290717     gbest121.seq
 524289306     gbest122.seq
 524290988     gbest123.seq
 456077782     gbest124.seq
 524289715     gbest125.seq
 524289937     gbest126.seq
 524289459     gbest127.seq
 524290967     gbest128.seq
 524290753     gbest129.seq
 118620794     gbest13.seq
 524292067     gbest130.seq
 524290209     gbest131.seq
 524290753     gbest132.seq
 524289042     gbest133.seq
 524292003     gbest134.seq
 524289922     gbest135.seq
 524291263     gbest136.seq
 267857101     gbest137.seq
 524288974     gbest138.seq
 524292166     gbest139.seq
 524290689     gbest14.seq
 524290606     gbest140.seq
 524290962     gbest141.seq
 524289320     gbest142.seq
 524290970     gbest143.seq
 524290814     gbest144.seq
 524289426     gbest145.seq
 524291157     gbest146.seq
 524292903     gbest147.seq
 524292477     gbest148.seq
 524290449     gbest149.seq
 524289408     gbest15.seq
 524290994     gbest150.seq
 450984334     gbest151.seq
 524290426     gbest152.seq
 524291229     gbest153.seq
 524290302     gbest154.seq
 524288899     gbest155.seq
 524290678     gbest156.seq
 524291113     gbest157.seq
 524291579     gbest158.seq
 524296697     gbest159.seq
 524289967     gbest16.seq
 524289224     gbest160.seq
 524292708     gbest161.seq
 524289344     gbest162.seq
 524289734     gbest163.seq
 208086426     gbest164.seq
 524290777     gbest165.seq
 524291086     gbest166.seq
 524290428     gbest167.seq
 524291849     gbest168.seq
 524290615     gbest169.seq
 524289926     gbest17.seq
 524288958     gbest170.seq
 524289193     gbest171.seq
 524292066     gbest172.seq
 524291740     gbest173.seq
 524288891     gbest174.seq
 524290974     gbest175.seq
 524288965     gbest176.seq
 524291506     gbest177.seq
  63583455     gbest178.seq
 524289738     gbest179.seq
 524289186     gbest18.seq
 524288794     gbest180.seq
 524290498     gbest181.seq
 524290855     gbest182.seq
 524290207     gbest183.seq
 524289092     gbest184.seq
 524291257     gbest185.seq
 524290362     gbest186.seq
 524291463     gbest187.seq
 524289230     gbest188.seq
 524290212     gbest189.seq
 524290300     gbest19.seq
 524291810     gbest190.seq
 430010490     gbest191.seq
 524292572     gbest192.seq
 524290993     gbest193.seq
 524291900     gbest194.seq
 524289081     gbest195.seq
 524290452     gbest196.seq
 524289298     gbest197.seq
 523306432     gbest198.seq
 524290328     gbest199.seq
 524291495     gbest2.seq
 524289189     gbest20.seq
 524289250     gbest200.seq
 524291648     gbest201.seq
 524290149     gbest202.seq
 523161765     gbest203.seq
 522870619     gbest204.seq
  17139407     gbest205.seq
 524290687     gbest206.seq
 524291743     gbest207.seq
 524289656     gbest208.seq
 524290550     gbest209.seq
 524289619     gbest21.seq
 524290884     gbest210.seq
 524289904     gbest211.seq
 524290228     gbest212.seq
 524293162     gbest213.seq
 524289792     gbest214.seq
 524289473     gbest215.seq
 442138664     gbest216.seq
 524291061     gbest217.seq
 524289016     gbest218.seq
 524289328     gbest219.seq
 481729267     gbest22.seq
 524291062     gbest220.seq
 524292910     gbest221.seq
 524290375     gbest222.seq
 524292272     gbest223.seq
 524289411     gbest224.seq
 524290512     gbest225.seq
 524290531     gbest226.seq
 524291061     gbest227.seq
 524288761     gbest228.seq
 431464986     gbest229.seq
 489302645     gbest23.seq
 524292858     gbest230.seq
 524291080     gbest231.seq
 524289372     gbest232.seq
 524292178     gbest233.seq
 524289422     gbest234.seq
 524292535     gbest235.seq
 524291191     gbest236.seq
 524291246     gbest237.seq
 524291346     gbest238.seq
 524291581     gbest239.seq
 499694003     gbest24.seq
 524291018     gbest240.seq
 524290214     gbest241.seq
 524290623     gbest242.seq
 524291466     gbest243.seq
 218283504     gbest244.seq
 524290594     gbest245.seq
 524290852     gbest246.seq
 524288906     gbest247.seq
 524289619     gbest248.seq
 524293045     gbest249.seq
 317259761     gbest25.seq
 524290293     gbest250.seq
 524289187     gbest251.seq
 508555400     gbest252.seq
 524289679     gbest253.seq
 524289536     gbest254.seq
 524290537     gbest255.seq
 314796088     gbest256.seq
 524291391     gbest257.seq
 524291315     gbest258.seq
 524291576     gbest259.seq
 524290572     gbest26.seq
 524289677     gbest260.seq
 524288794     gbest261.seq
 524289602     gbest262.seq
 524288924     gbest263.seq
 524289241     gbest264.seq
 524291304     gbest265.seq
 524290041     gbest266.seq
 187277881     gbest267.seq
 524290813     gbest268.seq
 524291921     gbest269.seq
 524291144     gbest27.seq
 524288797     gbest270.seq
 524289465     gbest271.seq
 524290463     gbest272.seq
 524289880     gbest273.seq
 524288731     gbest274.seq
 524292199     gbest275.seq
 524289239     gbest276.seq
 524289629     gbest277.seq
 524290064     gbest278.seq
 340942122     gbest279.seq
 524293271     gbest28.seq
 524289502     gbest280.seq
 524289501     gbest281.seq
 524288849     gbest282.seq
 524289022     gbest283.seq
 524290091     gbest284.seq
 524290259     gbest285.seq
 524289521     gbest286.seq
 524291603     gbest287.seq
 524291984     gbest288.seq
 524290683     gbest289.seq
 524289432     gbest29.seq
 524289698     gbest290.seq
 258552936     gbest291.seq
 524290188     gbest292.seq
 524289435     gbest293.seq
 524289508     gbest294.seq
 524288810     gbest295.seq
 524289269     gbest296.seq
 524288976     gbest297.seq
 524290898     gbest298.seq
 524290666     gbest299.seq
 486628041     gbest3.seq
 524289740     gbest30.seq
 524289371     gbest300.seq
 524289463     gbest301.seq
 464461954     gbest302.seq
 303649555     gbest303.seq
 470337769     gbest304.seq
 467780689     gbest305.seq
 524290652     gbest306.seq
 524289352     gbest307.seq
 524292358     gbest308.seq
 524289868     gbest309.seq
 524288960     gbest31.seq
 524289144     gbest310.seq
 524291099     gbest311.seq
 524290788     gbest312.seq
 524290765     gbest313.seq
 524290147     gbest314.seq
 524290519     gbest315.seq
 360607361     gbest316.seq
 524291462     gbest317.seq
 524291506     gbest318.seq
 524290841     gbest319.seq
 524291486     gbest32.seq
 524290035     gbest320.seq
 524291317     gbest321.seq
 524289944     gbest322.seq
 524289727     gbest323.seq
 524290547     gbest324.seq
 524291336     gbest325.seq
 524290231     gbest326.seq
 524290762     gbest327.seq
 511767446     gbest328.seq
 512292715     gbest329.seq
 524289379     gbest33.seq
 205427226     gbest330.seq
 524290020     gbest331.seq
 524291958     gbest332.seq
 524290488     gbest333.seq
 524289683     gbest334.seq
 524289317     gbest335.seq
 524293531     gbest336.seq
 492552873     gbest337.seq
 524290323     gbest338.seq
 524292142     gbest339.seq
 503027335     gbest34.seq
 524292431     gbest340.seq
 524289528     gbest341.seq
 524289156     gbest342.seq
 524291927     gbest343.seq
 318760506     gbest344.seq
 524291361     gbest345.seq
 524291126     gbest346.seq
 524290904     gbest347.seq
 524292262     gbest348.seq
 524290614     gbest349.seq
 483810358     gbest35.seq
 524292776     gbest350.seq
 504461804     gbest351.seq
 524288933     gbest352.seq
 524295862     gbest353.seq
 524289653     gbest354.seq
 524291364     gbest355.seq
 524290755     gbest356.seq
 524290955     gbest357.seq
 524291368     gbest358.seq
 158460095     gbest359.seq
 485552143     gbest36.seq
 524290662     gbest360.seq
 524289342     gbest361.seq
 524290462     gbest362.seq
 524290800     gbest363.seq
 524290944     gbest364.seq
 524291603     gbest365.seq
 524289800     gbest366.seq
 524289546     gbest367.seq
 524289187     gbest368.seq
 524289835     gbest369.seq
 484522378     gbest37.seq
 524289467     gbest370.seq
  56645511     gbest371.seq
 524288933     gbest372.seq
 524289127     gbest373.seq
 524290436     gbest374.seq
 524290604     gbest375.seq
 524288832     gbest376.seq
 524290090     gbest377.seq
 482894917     gbest378.seq
 524291701     gbest379.seq
 479045675     gbest38.seq
 524292001     gbest380.seq
 524291470     gbest381.seq
 524290812     gbest382.seq
 245114871     gbest383.seq
 524289536     gbest384.seq
 524290474     gbest385.seq
 524288840     gbest386.seq
 524289885     gbest387.seq
 524289985     gbest388.seq
 524289177     gbest389.seq
 483287654     gbest39.seq
 524290511     gbest390.seq
 524291113     gbest391.seq
 524288803     gbest392.seq
 524289101     gbest393.seq
 138039448     gbest394.seq
 524288805     gbest395.seq
 524289441     gbest396.seq
 524291956     gbest397.seq
 524291551     gbest398.seq
 524290290     gbest399.seq
 524289247     gbest4.seq
 129140054     gbest40.seq
 524291429     gbest400.seq
 524288764     gbest401.seq
 524290769     gbest402.seq
 524291504     gbest403.seq
 524289816     gbest404.seq
 524290749     gbest405.seq
 524290512     gbest406.seq
 438313571     gbest407.seq
 524289407     gbest408.seq
 524290922     gbest409.seq
 524290910     gbest41.seq
 524289009     gbest410.seq
 524290225     gbest411.seq
 524291018     gbest412.seq
 524291300     gbest413.seq
 524290441     gbest414.seq
 524289725     gbest415.seq
 524289698     gbest416.seq
 524289954     gbest417.seq
 524290542     gbest418.seq
 524291694     gbest419.seq
 520680322     gbest42.seq
 497755370     gbest420.seq
 524291054     gbest421.seq
 524289223     gbest422.seq
 524290259     gbest423.seq
 524291042     gbest424.seq
 524289496     gbest425.seq
 524290324     gbest426.seq
 524289989     gbest427.seq
 524293134     gbest428.seq
 524294104     gbest429.seq
 524290808     gbest43.seq
 524289503     gbest430.seq
 524289875     gbest431.seq
 524290407     gbest432.seq
 524289615     gbest433.seq
 524289902     gbest434.seq
 167157723     gbest435.seq
 524288965     gbest436.seq
 524290170     gbest437.seq
 524295139     gbest438.seq
 524288999     gbest439.seq
 524290643     gbest44.seq
 524291700     gbest440.seq
 524290848     gbest441.seq
 524290939     gbest442.seq
 524289186     gbest443.seq
 524290779     gbest444.seq
 524290903     gbest445.seq
 524292212     gbest446.seq
 524289007     gbest447.seq
  82524155     gbest448.seq
 524290348     gbest449.seq
 524290282     gbest45.seq
 524288836     gbest450.seq
 524290687     gbest451.seq
 524289624     gbest452.seq
 524289726     gbest453.seq
 524289590     gbest454.seq
 524290493     gbest455.seq
 524289308     gbest456.seq
 524289608     gbest457.seq
 524289181     gbest458.seq
 524290912     gbest459.seq
 524291099     gbest46.seq
  27591222     gbest460.seq
 524290318     gbest461.seq
 524289862     gbest462.seq
 524290132     gbest463.seq
 524290990     gbest464.seq
 524290782     gbest465.seq
 524289635     gbest466.seq
 524291613     gbest467.seq
 524290024     gbest468.seq
 524289691     gbest469.seq
 524290540     gbest47.seq
 524290683     gbest470.seq
 524289120     gbest471.seq
  20950927     gbest472.seq
 524288939     gbest473.seq
 524290194     gbest474.seq
 524290212     gbest475.seq
 524289802     gbest476.seq
 524290841     gbest477.seq
 524290731     gbest478.seq
 524290163     gbest479.seq
 524291253     gbest48.seq
 524289447     gbest480.seq
 524290435     gbest481.seq
 524290784     gbest482.seq
 524289031     gbest483.seq
 202191030     gbest484.seq
 524288993     gbest485.seq
 524290430     gbest486.seq
 524290869     gbest487.seq
 524290302     gbest488.seq
  26742856     gbest489.seq
 524291782     gbest49.seq
 524291592     gbest5.seq
 524289096     gbest50.seq
 524291206     gbest51.seq
 524290759     gbest52.seq
 524290375     gbest53.seq
 218755490     gbest54.seq
 524290815     gbest55.seq
 524290391     gbest56.seq
 524290132     gbest57.seq
 524291356     gbest58.seq
 524290700     gbest59.seq
 524288986     gbest6.seq
 524289230     gbest60.seq
 524289979     gbest61.seq
 524288735     gbest62.seq
 524290584     gbest63.seq
 524290998     gbest64.seq
 524291711     gbest65.seq
 524291738     gbest66.seq
 422952960     gbest67.seq
 524292488     gbest68.seq
 524290777     gbest69.seq
 524289782     gbest7.seq
 524289564     gbest70.seq
 524289725     gbest71.seq
 524289510     gbest72.seq
 524291492     gbest73.seq
 524289543     gbest74.seq
 524289933     gbest75.seq
 524290033     gbest76.seq
 524292444     gbest77.seq
 524290739     gbest78.seq
 524290212     gbest79.seq
 524291122     gbest8.seq
 149167072     gbest80.seq
 524289729     gbest81.seq
 524290400     gbest82.seq
 524289877     gbest83.seq
 524290251     gbest84.seq
 524290410     gbest85.seq
 524290747     gbest86.seq
 524288811     gbest87.seq
 524290279     gbest88.seq
 524291371     gbest89.seq
 524289925     gbest9.seq
 524290482     gbest90.seq
 524290003     gbest91.seq
 424290266     gbest92.seq
 524289197     gbest93.seq
 524292228     gbest94.seq
 524290739     gbest95.seq
 524290942     gbest96.seq
 524291586     gbest97.seq
 524291587     gbest98.seq
 524288801     gbest99.seq
 524291050     gbgss1.seq
 524291300     gbgss10.seq
 524290326     gbgss100.seq
 524292280     gbgss101.seq
 524292196     gbgss102.seq
 524291060     gbgss103.seq
 380900845     gbgss104.seq
 524289671     gbgss105.seq
 524290081     gbgss106.seq
 524290583     gbgss107.seq
 524288971     gbgss108.seq
 524289157     gbgss109.seq
 524289786     gbgss11.seq
 524290186     gbgss110.seq
 524288835     gbgss111.seq
 524289160     gbgss112.seq
 524290863     gbgss113.seq
 524289505     gbgss114.seq
 524291787     gbgss115.seq
   8873801     gbgss116.seq
 524288950     gbgss117.seq
 524290999     gbgss118.seq
 524290295     gbgss119.seq
 524292188     gbgss12.seq
 524289938     gbgss120.seq
 524290354     gbgss121.seq
 524291640     gbgss122.seq
 524289184     gbgss123.seq
 524289577     gbgss124.seq
 524290025     gbgss125.seq
 524290039     gbgss126.seq
 524290974     gbgss127.seq
 524291743     gbgss128.seq
 189921923     gbgss129.seq
 524291794     gbgss13.seq
 524291435     gbgss130.seq
 524288855     gbgss131.seq
 524289295     gbgss132.seq
 524290028     gbgss133.seq
 524288808     gbgss134.seq
 524291707     gbgss135.seq
 524290373     gbgss136.seq
 524289496     gbgss137.seq
 524290461     gbgss138.seq
 513694074     gbgss139.seq
 524291453     gbgss14.seq
 491110001     gbgss140.seq
 220824116     gbgss141.seq
 524290092     gbgss142.seq
 524289705     gbgss143.seq
 524291183     gbgss144.seq
 524290789     gbgss145.seq
 524291578     gbgss146.seq
 524289458     gbgss147.seq
 524291397     gbgss148.seq
 524290174     gbgss149.seq
 524291189     gbgss15.seq
 524289663     gbgss150.seq
 524289377     gbgss151.seq
 315384641     gbgss152.seq
 524290587     gbgss153.seq
 524289912     gbgss154.seq
 524291520     gbgss155.seq
 524290727     gbgss156.seq
 524290313     gbgss157.seq
 524290382     gbgss158.seq
 524290348     gbgss159.seq
 524290028     gbgss16.seq
 524289237     gbgss160.seq
 524289865     gbgss161.seq
 524289351     gbgss162.seq
 524288939     gbgss163.seq
 524292142     gbgss164.seq
 132279601     gbgss165.seq
 524290617     gbgss166.seq
 524290586     gbgss167.seq
 524291206     gbgss168.seq
 524290134     gbgss169.seq
 524289819     gbgss17.seq
 524289975     gbgss170.seq
 524288948     gbgss171.seq
 524290156     gbgss172.seq
 524289742     gbgss173.seq
 524290845     gbgss174.seq
 524290511     gbgss175.seq
 367277938     gbgss176.seq
 524289032     gbgss177.seq
  71084288     gbgss178.seq
 249999307     gbgss179.seq
 524289206     gbgss18.seq
 249999803     gbgss180.seq
 249999034     gbgss181.seq
 250000188     gbgss182.seq
  27270082     gbgss183.seq
 250000220     gbgss184.seq
 249999312     gbgss185.seq
 249997128     gbgss186.seq
 249998262     gbgss187.seq
 219536183     gbgss188.seq
 250000046     gbgss189.seq
 273539262     gbgss19.seq
 249997736     gbgss190.seq
 249999841     gbgss191.seq
 249999021     gbgss192.seq
 189705997     gbgss193.seq
 249999911     gbgss194.seq
 249997779     gbgss195.seq
 249998992     gbgss196.seq
 249997543     gbgss197.seq
 249998328     gbgss198.seq
  66166938     gbgss199.seq
 524289586     gbgss2.seq
 524291463     gbgss20.seq
 249998062     gbgss200.seq
    542128     gbgss201.seq
  80022020     gbgss202.seq
 250000228     gbgss203.seq
 249999996     gbgss204.seq
  84490531     gbgss205.seq
 249998087     gbgss206.seq
 249999221     gbgss207.seq
 249998781     gbgss208.seq
 197045515     gbgss209.seq
 524289782     gbgss21.seq
 249999644     gbgss210.seq
 250000078     gbgss211.seq
 249998943     gbgss212.seq
 241194397     gbgss213.seq
 249998895     gbgss214.seq
 249998646     gbgss215.seq
 249999899     gbgss216.seq
 239478749     gbgss217.seq
 249999622     gbgss218.seq
 249996865     gbgss219.seq
 524289976     gbgss22.seq
 249999649     gbgss220.seq
 250000226     gbgss221.seq
 121271948     gbgss222.seq
 249999870     gbgss223.seq
 250000164     gbgss224.seq
 249998650     gbgss225.seq
 249998378     gbgss226.seq
  86638471     gbgss227.seq
 249999180     gbgss228.seq
 250000196     gbgss229.seq
 524291041     gbgss23.seq
 249998742     gbgss230.seq
 249998926     gbgss231.seq
 249999544     gbgss232.seq
 137865838     gbgss233.seq
 249999577     gbgss234.seq
 249999925     gbgss235.seq
 249999323     gbgss236.seq
 249997632     gbgss237.seq
  79228653     gbgss238.seq
 249997675     gbgss239.seq
 524289830     gbgss24.seq
 249998339     gbgss240.seq
 249999331     gbgss241.seq
 249999245     gbgss242.seq
 249997693     gbgss243.seq
 249999721     gbgss244.seq
  99660048     gbgss245.seq
 249998155     gbgss246.seq
 249999580     gbgss247.seq
 249999271     gbgss248.seq
  52447926     gbgss249.seq
 524290612     gbgss25.seq
  53076689     gbgss250.seq
 249998109     gbgss251.seq
 249998073     gbgss252.seq
 249999880     gbgss253.seq
 249999725     gbgss254.seq
 249998744     gbgss255.seq
 249997664     gbgss256.seq
 211852026     gbgss257.seq
 249997890     gbgss258.seq
 249999836     gbgss259.seq
 524291393     gbgss26.seq
 249998514     gbgss260.seq
 249998986     gbgss261.seq
  21316342     gbgss262.seq
 249997567     gbgss263.seq
 249999132     gbgss264.seq
 249996570     gbgss265.seq
 249998430     gbgss266.seq
 249997631     gbgss267.seq
 249998992     gbgss268.seq
 181964370     gbgss269.seq
 524289262     gbgss27.seq
 249998672     gbgss270.seq
 250000165     gbgss271.seq
 250000243     gbgss272.seq
 221699337     gbgss273.seq
 249999134     gbgss274.seq
 249998851     gbgss275.seq
 249998700     gbgss276.seq
 249999839     gbgss277.seq
 249999513     gbgss278.seq
 249999543     gbgss279.seq
 524288911     gbgss28.seq
 145308699     gbgss280.seq
 249997149     gbgss281.seq
 249998191     gbgss282.seq
 249999087     gbgss283.seq
 249998744     gbgss284.seq
 227218278     gbgss285.seq
 249997931     gbgss286.seq
 249997185     gbgss287.seq
 249999114     gbgss288.seq
 249999909     gbgss289.seq
 524290701     gbgss29.seq
 249998098     gbgss290.seq
 116181294     gbgss291.seq
 249999837     gbgss292.seq
 249998408     gbgss293.seq
 249998054     gbgss294.seq
 249997635     gbgss295.seq
 215534679     gbgss296.seq
 249998609     gbgss297.seq
 249998604     gbgss298.seq
 249999576     gbgss299.seq
 524289345     gbgss3.seq
 524290842     gbgss30.seq
 249998662     gbgss300.seq
  85129549     gbgss301.seq
 249999096     gbgss302.seq
 249998233     gbgss303.seq
 250000177     gbgss304.seq
 249997711     gbgss305.seq
 249998095     gbgss306.seq
 249998419     gbgss307.seq
 133619126     gbgss308.seq
  34126334     gbgss31.seq
 524290389     gbgss32.seq
 524289318     gbgss33.seq
 524290415     gbgss34.seq
 524288882     gbgss35.seq
 524290033     gbgss36.seq
 524290732     gbgss37.seq
 524291233     gbgss38.seq
 485805509     gbgss39.seq
 524291308     gbgss4.seq
 524290520     gbgss40.seq
 524288891     gbgss41.seq
 524290678     gbgss42.seq
  24823793     gbgss43.seq
 524289585     gbgss44.seq
 524289288     gbgss45.seq
 524291329     gbgss46.seq
 524291104     gbgss47.seq
 231385769     gbgss48.seq
 524290048     gbgss49.seq
 147772850     gbgss5.seq
 524290355     gbgss50.seq
 524289654     gbgss51.seq
 524288837     gbgss52.seq
 524289395     gbgss53.seq
 524289349     gbgss54.seq
 524289462     gbgss55.seq
 524290921     gbgss56.seq
 524288806     gbgss57.seq
 524289687     gbgss58.seq
 524289692     gbgss59.seq
 524291132     gbgss6.seq
  17122776     gbgss60.seq
 524290041     gbgss61.seq
 524289550     gbgss62.seq
 524289049     gbgss63.seq
 451069994     gbgss64.seq
 524291105     gbgss65.seq
 524291854     gbgss66.seq
 524290696     gbgss67.seq
 524290782     gbgss68.seq
 524290880     gbgss69.seq
 524290703     gbgss7.seq
 524289894     gbgss70.seq
 524291852     gbgss71.seq
 524289412     gbgss72.seq
 524288932     gbgss73.seq
 524290704     gbgss74.seq
 524289998     gbgss75.seq
 524291390     gbgss76.seq
  45278932     gbgss77.seq
 524290734     gbgss78.seq
 524291914     gbgss79.seq
 524288726     gbgss8.seq
 524291795     gbgss80.seq
 524289843     gbgss81.seq
 524289763     gbgss82.seq
 524292079     gbgss83.seq
 524289755     gbgss84.seq
 524289702     gbgss85.seq
 524289192     gbgss86.seq
 524289234     gbgss87.seq
 524291238     gbgss88.seq
 375738261     gbgss89.seq
 524288780     gbgss9.seq
 524291581     gbgss90.seq
 524289137     gbgss91.seq
 524289489     gbgss92.seq
 524288742     gbgss93.seq
 524290297     gbgss94.seq
 524291466     gbgss95.seq
 524291648     gbgss96.seq
 524290979     gbgss97.seq
 524289812     gbgss98.seq
 524290686     gbgss99.seq
 249995862     gbhtc1.seq
 249996894     gbhtc10.seq
 249999635     gbhtc11.seq
 187663200     gbhtc12.seq
 249999169     gbhtc13.seq
 249998577     gbhtc14.seq
 160278020     gbhtc15.seq
 249995478     gbhtc2.seq
 249991894     gbhtc3.seq
 249985970     gbhtc4.seq
 249999048     gbhtc5.seq
 249987440     gbhtc6.seq
 249996035     gbhtc7.seq
  80798178     gbhtc8.seq
 249998827     gbhtc9.seq
 249919103     gbhtg1.seq
 249935336     gbhtg10.seq
 249898506     gbhtg100.seq
 249852504     gbhtg101.seq
 249535042     gbhtg102.seq
 249887166     gbhtg103.seq
   3688130     gbhtg104.seq
 249798859     gbhtg105.seq
 249998294     gbhtg106.seq
 249949751     gbhtg107.seq
 249916394     gbhtg108.seq
 249978605     gbhtg109.seq
    799292     gbhtg11.seq
 249896195     gbhtg110.seq
 167433043     gbhtg111.seq
 249850870     gbhtg112.seq
 249939795     gbhtg113.seq
 249869598     gbhtg114.seq
 249906673     gbhtg115.seq
 249768916     gbhtg116.seq
 249967908     gbhtg117.seq
 249944117     gbhtg118.seq
 219057303     gbhtg119.seq
 249867576     gbhtg12.seq
 249986066     gbhtg120.seq
 249896587     gbhtg121.seq
 249935778     gbhtg122.seq
 249900357     gbhtg123.seq
 249891139     gbhtg124.seq
 249797886     gbhtg125.seq
 249847034     gbhtg126.seq
 249920794     gbhtg127.seq
 249887387     gbhtg128.seq
 249878396     gbhtg129.seq
 249953697     gbhtg13.seq
 249892198     gbhtg130.seq
 144800589     gbhtg131.seq
 249890602     gbhtg132.seq
 249895390     gbhtg133.seq
 249844710     gbhtg134.seq
 249988579     gbhtg135.seq
 249862660     gbhtg136.seq
 135815749     gbhtg137.seq
 249905628     gbhtg138.seq
 249808330     gbhtg139.seq
 249995099     gbhtg14.seq
 249958007     gbhtg140.seq
 249697484     gbhtg141.seq
 249816953     gbhtg142.seq
 134304697     gbhtg143.seq
 249939319     gbhtg144.seq
 249796848     gbhtg145.seq
 249816843     gbhtg146.seq
 249884829     gbhtg147.seq
 249747665     gbhtg148.seq
 249922755     gbhtg149.seq
 249938964     gbhtg15.seq
 249831405     gbhtg150.seq
 249900380     gbhtg151.seq
 249955029     gbhtg152.seq
 249829301     gbhtg153.seq
 249944800     gbhtg154.seq
  10956383     gbhtg155.seq
 249750336     gbhtg16.seq
 249774726     gbhtg17.seq
 249714731     gbhtg18.seq
 249957759     gbhtg19.seq
 249965174     gbhtg2.seq
 249931734     gbhtg20.seq
 235850971     gbhtg21.seq
 249743613     gbhtg22.seq
 249849760     gbhtg23.seq
 249968489     gbhtg24.seq
 249904378     gbhtg25.seq
 249743777     gbhtg26.seq
 249872278     gbhtg27.seq
 249943100     gbhtg28.seq
 249821972     gbhtg29.seq
 249990925     gbhtg3.seq
 249974297     gbhtg30.seq
 225307913     gbhtg31.seq
 249988250     gbhtg32.seq
 249721384     gbhtg33.seq
 249910646     gbhtg34.seq
 249900069     gbhtg35.seq
 249839995     gbhtg36.seq
 249796553     gbhtg37.seq
 249749194     gbhtg38.seq
 249608093     gbhtg39.seq
 249912663     gbhtg4.seq
 249819463     gbhtg40.seq
 224341330     gbhtg41.seq
 249988697     gbhtg42.seq
 249929499     gbhtg43.seq
 249878159     gbhtg44.seq
 249894493     gbhtg45.seq
 249780350     gbhtg46.seq
 249512030     gbhtg47.seq
 249848792     gbhtg48.seq
 249876917     gbhtg49.seq
 249892800     gbhtg5.seq
 249885018     gbhtg50.seq
 234804693     gbhtg51.seq
 249991982     gbhtg52.seq
 249969628     gbhtg53.seq
 249777162     gbhtg54.seq
 249928077     gbhtg55.seq
 249738038     gbhtg56.seq
  18488541     gbhtg57.seq
 249846209     gbhtg58.seq
 249813649     gbhtg59.seq
 249976698     gbhtg6.seq
 249982652     gbhtg60.seq
 249907805     gbhtg61.seq
 225115632     gbhtg62.seq
 249868960     gbhtg63.seq
 249892184     gbhtg64.seq
 249989957     gbhtg65.seq
 249828872     gbhtg66.seq
 249951490     gbhtg67.seq
  15793409     gbhtg68.seq
 249969504     gbhtg69.seq
 249792412     gbhtg7.seq
 249868114     gbhtg70.seq
 249949360     gbhtg71.seq
 249752681     gbhtg72.seq
 223399956     gbhtg73.seq
 249931880     gbhtg74.seq
 249870863     gbhtg75.seq
 249834885     gbhtg76.seq
 249935383     gbhtg77.seq
 235157815     gbhtg78.seq
 249863725     gbhtg79.seq
 249808933     gbhtg8.seq
 249962382     gbhtg80.seq
 249850580     gbhtg81.seq
 249876768     gbhtg82.seq
 202286158     gbhtg83.seq
 249854884     gbhtg84.seq
 249932273     gbhtg85.seq
 249851304     gbhtg86.seq
 249870067     gbhtg87.seq
 206005794     gbhtg88.seq
 249874212     gbhtg89.seq
 249937013     gbhtg9.seq
 249860356     gbhtg90.seq
 249764128     gbhtg91.seq
 249875964     gbhtg92.seq
 194399433     gbhtg93.seq
 249959164     gbhtg94.seq
 249968525     gbhtg95.seq
 249861046     gbhtg96.seq
 249784880     gbhtg97.seq
 161649769     gbhtg98.seq
 249859601     gbhtg99.seq
 249996724     gbinv1.seq
 249990082     gbinv10.seq
 249136252     gbinv100.seq
 229719338     gbinv101.seq
 249997337     gbinv102.seq
 249495412     gbinv103.seq
 247838456     gbinv104.seq
 249520449     gbinv105.seq
 170146490     gbinv106.seq
 249999589     gbinv107.seq
 249998810     gbinv108.seq
 249998158     gbinv109.seq
 246497269     gbinv11.seq
 249997460     gbinv110.seq
 196676151     gbinv111.seq
 249997987     gbinv112.seq
 249998913     gbinv113.seq
 250000193     gbinv114.seq
 249997863     gbinv115.seq
 249971679     gbinv116.seq
  35679822     gbinv117.seq
 249934189     gbinv12.seq
 226516876     gbinv13.seq
 248469141     gbinv14.seq
 249999986     gbinv15.seq
 249999638     gbinv16.seq
 142771099     gbinv17.seq
 249997609     gbinv18.seq
 249998110     gbinv19.seq
 249795164     gbinv2.seq
 249999582     gbinv20.seq
 153849837     gbinv21.seq
 249394850     gbinv22.seq
 247814048     gbinv23.seq
 249998049     gbinv24.seq
 249789472     gbinv25.seq
 248434113     gbinv26.seq
 231067355     gbinv27.seq
 175319053     gbinv28.seq
 249999171     gbinv29.seq
 249891316     gbinv3.seq
 249997923     gbinv30.seq
 249997723     gbinv31.seq
  12547654     gbinv32.seq
 249999463     gbinv33.seq
 249999753     gbinv34.seq
 249997871     gbinv35.seq
 249999157     gbinv36.seq
 250000114     gbinv37.seq
   8882625     gbinv38.seq
 249998578     gbinv39.seq
 202823844     gbinv4.seq
 249954481     gbinv40.seq
 250000229     gbinv41.seq
 249998320     gbinv42.seq
 173683078     gbinv43.seq
 250000194     gbinv44.seq
 249998353     gbinv45.seq
 249998302     gbinv46.seq
 249997802     gbinv47.seq
 115864256     gbinv48.seq
 249998854     gbinv49.seq
 249999037     gbinv5.seq
 249997500     gbinv50.seq
 249998839     gbinv51.seq
 249999477     gbinv52.seq
 102357289     gbinv53.seq
 249999630     gbinv54.seq
 249998527     gbinv55.seq
 249999876     gbinv56.seq
 249998376     gbinv57.seq
 106340598     gbinv58.seq
 249997173     gbinv59.seq
 249999716     gbinv6.seq
 249997149     gbinv60.seq
 249997240     gbinv61.seq
 249998896     gbinv62.seq
 187777605     gbinv63.seq
 249998310     gbinv64.seq
 249997821     gbinv65.seq
 249996213     gbinv66.seq
 249976375     gbinv67.seq
 233348410     gbinv68.seq
 249999353     gbinv69.seq
 249998073     gbinv7.seq
 249998950     gbinv70.seq
 249997697     gbinv71.seq
 250000194     gbinv72.seq
 249998727     gbinv73.seq
 249999808     gbinv74.seq
 249997591     gbinv75.seq
  79920784     gbinv76.seq
 249999804     gbinv77.seq
 249999334     gbinv78.seq
 249998579     gbinv79.seq
 247364950     gbinv8.seq
 195993243     gbinv80.seq
 242954427     gbinv81.seq
  61014068     gbinv82.seq
  54947886     gbinv83.seq
  52917686     gbinv84.seq
 156788939     gbinv85.seq
 249983717     gbinv86.seq
 249987661     gbinv87.seq
 250000011     gbinv88.seq
  13298097     gbinv89.seq
 150264994     gbinv9.seq
 249999292     gbinv90.seq
 249999528     gbinv91.seq
 249999497     gbinv92.seq
 249998460     gbinv93.seq
 172341791     gbinv94.seq
 249999187     gbinv95.seq
 249363278     gbinv96.seq
 239262607     gbinv97.seq
 248519472     gbinv98.seq
 247982903     gbinv99.seq
 249959140     gbmam1.seq
 338653931     gbmam10.seq
 315434407     gbmam11.seq
 162425847     gbmam12.seq
 150157334     gbmam13.seq
 159032538     gbmam14.seq
 136269230     gbmam15.seq
 122412955     gbmam16.seq
 248159396     gbmam17.seq
 202955071     gbmam18.seq
 208310866     gbmam19.seq
 249998914     gbmam2.seq
 209752346     gbmam20.seq
 197940543     gbmam21.seq
 230561841     gbmam22.seq
 220222444     gbmam23.seq
 123191120     gbmam24.seq
 190279404     gbmam25.seq
 195995383     gbmam26.seq
 174515534     gbmam27.seq
 149170534     gbmam28.seq
 145602287     gbmam29.seq
  87242147     gbmam3.seq
 151524132     gbmam30.seq
 131892622     gbmam31.seq
 166263689     gbmam32.seq
 132948664     gbmam33.seq
 178685080     gbmam34.seq
 197788353     gbmam35.seq
 206568488     gbmam36.seq
 242409571     gbmam37.seq
 220443672     gbmam38.seq
 213549561     gbmam39.seq
  82812194     gbmam4.seq
 247368706     gbmam40.seq
 179287074     gbmam41.seq
   9943428     gbmam42.seq
  43989127     gbmam43.seq
  91322474     gbmam44.seq
  88810705     gbmam45.seq
   6365611     gbmam46.seq
  20918356     gbmam47.seq
 249999732     gbmam48.seq
 199541519     gbmam49.seq
  71295407     gbmam5.seq
 249997038     gbmam50.seq
 249997582     gbmam51.seq
 249999072     gbmam52.seq
 249975731     gbmam53.seq
 241342984     gbmam54.seq
 226442582     gbmam55.seq
  22570875     gbmam6.seq
   1268605     gbmam7.seq
   2477678     gbmam8.seq
 375834657     gbmam9.seq
  27809724     gbnew.txt
 249999595     gbpat1.seq
 249999980     gbpat10.seq
 249998963     gbpat100.seq
 249999641     gbpat101.seq
 249999965     gbpat102.seq
 249999455     gbpat103.seq
 137267099     gbpat104.seq
 250000015     gbpat105.seq
 249999153     gbpat106.seq
 249888679     gbpat107.seq
 249749771     gbpat108.seq
 250000144     gbpat109.seq
 168191513     gbpat11.seq
 179847282     gbpat110.seq
 250000043     gbpat111.seq
 249999494     gbpat112.seq
 249997123     gbpat113.seq
  70392159     gbpat114.seq
 249999103     gbpat115.seq
 250000232     gbpat116.seq
 249696915     gbpat117.seq
 249999993     gbpat118.seq
 249999110     gbpat119.seq
 249998651     gbpat12.seq
  55704446     gbpat120.seq
 249999350     gbpat121.seq
 249999805     gbpat122.seq
 249999831     gbpat123.seq
 249998300     gbpat124.seq
 144919044     gbpat125.seq
 249999927     gbpat126.seq
 249999834     gbpat127.seq
 226235203     gbpat128.seq
 249966117     gbpat129.seq
 249999567     gbpat13.seq
 249976912     gbpat130.seq
 249999729     gbpat131.seq
 249998903     gbpat132.seq
 249998034     gbpat133.seq
  59559800     gbpat134.seq
 249995969     gbpat135.seq
 249995285     gbpat136.seq
 249998740     gbpat137.seq
 249998430     gbpat138.seq
 249999159     gbpat139.seq
 249998972     gbpat14.seq
   9607227     gbpat140.seq
 249999998     gbpat141.seq
 249998686     gbpat142.seq
 249999576     gbpat143.seq
 249998604     gbpat144.seq
  36785302     gbpat145.seq
 249995259     gbpat146.seq
 249999971     gbpat147.seq
 249999853     gbpat148.seq
 224419737     gbpat149.seq
 249996819     gbpat15.seq
 249999338     gbpat150.seq
 249999887     gbpat151.seq
 249999564     gbpat152.seq
  75491672     gbpat153.seq
 249999318     gbpat154.seq
 250000197     gbpat155.seq
 249999825     gbpat156.seq
  55090875     gbpat157.seq
 249999077     gbpat158.seq
 249999067     gbpat159.seq
 249999594     gbpat16.seq
 249999776     gbpat160.seq
 249999591     gbpat161.seq
 250000242     gbpat162.seq
 249997218     gbpat163.seq
 202392948     gbpat164.seq
 250000181     gbpat165.seq
 249999529     gbpat166.seq
 249999529     gbpat167.seq
 205870569     gbpat168.seq
 249999373     gbpat169.seq
  66936474     gbpat17.seq
 249999772     gbpat170.seq
 250000071     gbpat171.seq
   2029303     gbpat172.seq
 249999068     gbpat173.seq
 249996376     gbpat174.seq
 249999465     gbpat175.seq
 249997869     gbpat176.seq
  81953257     gbpat177.seq
 249999232     gbpat178.seq
 249999933     gbpat179.seq
 249998753     gbpat18.seq
 249999839     gbpat180.seq
 248237643     gbpat181.seq
 249998773     gbpat182.seq
 249999109     gbpat183.seq
 249998937     gbpat184.seq
 250000075     gbpat185.seq
 248566246     gbpat186.seq
 249998056     gbpat187.seq
 230155279     gbpat188.seq
 250000241     gbpat189.seq
 249999427     gbpat19.seq
 249998973     gbpat190.seq
 249997114     gbpat191.seq
 250000182     gbpat192.seq
 249999162     gbpat193.seq
 249999322     gbpat194.seq
 249998695     gbpat195.seq
  85324625     gbpat196.seq
 249998863     gbpat197.seq
 249998474     gbpat198.seq
 249999323     gbpat199.seq
 249997969     gbpat2.seq
 249999265     gbpat20.seq
 249999619     gbpat200.seq
 207988426     gbpat201.seq
 249999875     gbpat202.seq
 249857982     gbpat203.seq
 249994774     gbpat204.seq
 249997847     gbpat205.seq
 174001975     gbpat206.seq
 249988465     gbpat207.seq
 249998701     gbpat208.seq
 249999968     gbpat209.seq
 249999381     gbpat21.seq
 249999815     gbpat210.seq
 249998544     gbpat211.seq
 249999631     gbpat212.seq
   8448545     gbpat213.seq
 249999288     gbpat214.seq
 249660127     gbpat215.seq
 249999727     gbpat216.seq
 132772292     gbpat217.seq
 249999758     gbpat218.seq
 249997972     gbpat219.seq
 179041317     gbpat22.seq
 249997756     gbpat220.seq
 249999208     gbpat221.seq
 249995993     gbpat222.seq
 249997662     gbpat223.seq
 250000240     gbpat224.seq
 249999076     gbpat225.seq
  56245860     gbpat226.seq
 249999673     gbpat227.seq
 249989218     gbpat228.seq
 249998307     gbpat229.seq
 249999813     gbpat23.seq
 249997672     gbpat230.seq
 208385420     gbpat231.seq
 249999385     gbpat232.seq
 249999768     gbpat233.seq
 249999573     gbpat234.seq
 250000172     gbpat235.seq
  57205027     gbpat236.seq
 249999981     gbpat237.seq
 249997739     gbpat238.seq
 249997388     gbpat239.seq
 249994174     gbpat24.seq
 249997616     gbpat240.seq
 249997564     gbpat241.seq
 237291371     gbpat242.seq
 249999914     gbpat243.seq
 249999367     gbpat244.seq
 250000089     gbpat245.seq
 249999139     gbpat246.seq
  25826800     gbpat247.seq
 249999458     gbpat248.seq
 249992374     gbpat249.seq
 249999373     gbpat25.seq
 249999863     gbpat250.seq
 135111998     gbpat251.seq
 249980771     gbpat252.seq
 249999989     gbpat253.seq
 250000225     gbpat254.seq
 250000225     gbpat255.seq
 148497227     gbpat256.seq
 249999032     gbpat257.seq
 250000037     gbpat258.seq
 249999574     gbpat259.seq
 249999634     gbpat26.seq
  64423759     gbpat260.seq
 249999027     gbpat261.seq
 249989619     gbpat262.seq
 249998962     gbpat263.seq
 249981586     gbpat264.seq
 249999491     gbpat265.seq
 159538878     gbpat266.seq
 249999492     gbpat267.seq
 249998152     gbpat268.seq
 249999183     gbpat269.seq
  62270827     gbpat27.seq
 249989512     gbpat270.seq
 125941966     gbpat271.seq
 249998964     gbpat272.seq
 249990860     gbpat273.seq
 249996341     gbpat274.seq
 249996754     gbpat275.seq
 249995718     gbpat276.seq
 249998309     gbpat277.seq
 249996432     gbpat278.seq
 249995570     gbpat279.seq
 249998261     gbpat28.seq
 169825712     gbpat280.seq
 249998785     gbpat281.seq
 249999605     gbpat282.seq
 249996750     gbpat283.seq
 175273373     gbpat284.seq
 250000021     gbpat285.seq
 249998724     gbpat286.seq
 250000020     gbpat287.seq
 250000093     gbpat288.seq
 250000265     gbpat289.seq
 249999979     gbpat29.seq
 249838683     gbpat290.seq
 248658531     gbpat291.seq
 104796846     gbpat292.seq
 249998271     gbpat293.seq
 249992855     gbpat294.seq
 249999799     gbpat295.seq
 250000021     gbpat296.seq
 249999288     gbpat297.seq
  37515921     gbpat298.seq
 249997533     gbpat299.seq
 249999269     gbpat3.seq
 249998957     gbpat30.seq
 250000252     gbpat300.seq
 249998892     gbpat301.seq
 249998625     gbpat302.seq
 250000073     gbpat303.seq
 249998635     gbpat304.seq
 100300068     gbpat305.seq
 249998932     gbpat306.seq
 249999620     gbpat307.seq
 249994400     gbpat308.seq
 249996528     gbpat309.seq
 250000238     gbpat31.seq
 249997485     gbpat310.seq
 249999753     gbpat311.seq
 249999952     gbpat312.seq
 250000242     gbpat313.seq
 250000225     gbpat314.seq
  51653377     gbpat315.seq
 249999305     gbpat316.seq
 249982077     gbpat317.seq
 249999682     gbpat318.seq
 249994346     gbpat319.seq
 249999942     gbpat32.seq
 249999569     gbpat320.seq
 249996327     gbpat321.seq
 249999810     gbpat322.seq
 249999881     gbpat323.seq
 249999145     gbpat324.seq
 104407721     gbpat325.seq
 249999683     gbpat326.seq
 247266865     gbpat327.seq
 244213890     gbpat328.seq
 249997145     gbpat329.seq
 171721355     gbpat33.seq
 250000227     gbpat330.seq
 249998573     gbpat331.seq
 249998884     gbpat332.seq
 249999458     gbpat333.seq
 173911849     gbpat334.seq
 249998149     gbpat335.seq
 249999943     gbpat336.seq
 249999425     gbpat337.seq
 249999644     gbpat338.seq
 249999857     gbpat339.seq
 249999843     gbpat34.seq
  71708475     gbpat340.seq
 250000042     gbpat341.seq
 249991619     gbpat342.seq
 249997449     gbpat343.seq
 249966535     gbpat344.seq
 249995238     gbpat345.seq
 249987078     gbpat346.seq
   6020499     gbpat347.seq
 249752043     gbpat35.seq
 250000158     gbpat36.seq
 249999819     gbpat37.seq
 249999602     gbpat38.seq
 249999294     gbpat39.seq
 250000028     gbpat4.seq
 249869468     gbpat40.seq
  91529369     gbpat41.seq
 249999915     gbpat42.seq
 249906763     gbpat43.seq
 250000067     gbpat44.seq
 249999734     gbpat45.seq
 249999638     gbpat46.seq
 249765128     gbpat47.seq
 249999760     gbpat48.seq
 246849858     gbpat49.seq
  61173529     gbpat5.seq
 161790911     gbpat50.seq
 249999888     gbpat51.seq
 249999804     gbpat52.seq
 249999700     gbpat53.seq
 249999646     gbpat54.seq
 213206429     gbpat55.seq
 250000030     gbpat56.seq
 250000009     gbpat57.seq
 249999551     gbpat58.seq
 156000777     gbpat59.seq
 249999674     gbpat6.seq
 249999467     gbpat60.seq
 249996959     gbpat61.seq
 249999278     gbpat62.seq
 249999622     gbpat63.seq
 125163576     gbpat64.seq
 249996501     gbpat65.seq
 249999556     gbpat66.seq
 249998622     gbpat67.seq
 249997829     gbpat68.seq
 249998957     gbpat69.seq
 249999687     gbpat7.seq
 249999699     gbpat70.seq
 135705288     gbpat71.seq
 249999622     gbpat72.seq
 249999332     gbpat73.seq
 250000167     gbpat74.seq
 248918247     gbpat75.seq
 248123146     gbpat76.seq
 249394834     gbpat77.seq
 248798213     gbpat78.seq
 249999258     gbpat79.seq
 249998295     gbpat8.seq
 141050219     gbpat80.seq
 250000182     gbpat81.seq
 249999208     gbpat82.seq
 250000165     gbpat83.seq
 249999811     gbpat84.seq
 249999358     gbpat85.seq
 249999691     gbpat86.seq
  87741306     gbpat87.seq
 249925891     gbpat88.seq
 249998577     gbpat89.seq
 249999873     gbpat9.seq
 250000212     gbpat90.seq
 250000213     gbpat91.seq
 250000072     gbpat92.seq
 250000144     gbpat93.seq
 130991295     gbpat94.seq
 249998907     gbpat95.seq
 249999366     gbpat96.seq
 249999447     gbpat97.seq
 249999901     gbpat98.seq
 184979714     gbpat99.seq
 249711598     gbphg1.seq
 249639191     gbphg2.seq
 249531907     gbphg3.seq
 249960903     gbphg4.seq
 178747664     gbphg5.seq
 249998426     gbpln1.seq
 197257290     gbpln10.seq
 201667550     gbpln100.seq
 248997385     gbpln101.seq
  37267311     gbpln102.seq
     84605     gbpln103.seq
    354450     gbpln104.seq
 164935258     gbpln105.seq
  40081561     gbpln106.seq
  74904970     gbpln107.seq
 250000108     gbpln108.seq
 249999051     gbpln109.seq
 249994813     gbpln11.seq
 249999616     gbpln110.seq
 106177352     gbpln111.seq
 249999547     gbpln112.seq
 249999812     gbpln113.seq
 249997728     gbpln114.seq
 249998969     gbpln115.seq
 138372272     gbpln116.seq
 249997154     gbpln117.seq
 249806992     gbpln118.seq
 249997962     gbpln119.seq
 249999981     gbpln12.seq
 248456146     gbpln120.seq
 243496255     gbpln121.seq
 249974132     gbpln122.seq
 249998991     gbpln123.seq
  40672706     gbpln124.seq
 249998819     gbpln125.seq
  47663121     gbpln126.seq
 210410097     gbpln127.seq
 247532823     gbpln128.seq
 185608139     gbpln129.seq
 249998987     gbpln13.seq
 997331398     gbpln130.seq
  56487067     gbpln131.seq
 217280468     gbpln132.seq
 171793647     gbpln133.seq
 197391133     gbpln134.seq
 177950617     gbpln135.seq
 196456252     gbpln136.seq
 189037039     gbpln137.seq
 220764606     gbpln138.seq
 227204479     gbpln139.seq
 249960170     gbpln14.seq
 224027156     gbpln140.seq
 248372205     gbpln141.seq
 188708659     gbpln142.seq
 249999451     gbpln143.seq
 249998991     gbpln144.seq
  57064448     gbpln145.seq
 249749850     gbpln146.seq
 249998749     gbpln147.seq
 249999184     gbpln148.seq
 249999789     gbpln149.seq
 224899164     gbpln15.seq
 249998341     gbpln150.seq
  13647312     gbpln151.seq
 249999298     gbpln152.seq
 248057604     gbpln153.seq
 249998517     gbpln154.seq
 249997611     gbpln155.seq
  84487249     gbpln156.seq
 249997648     gbpln157.seq
 249997448     gbpln158.seq
 249999796     gbpln159.seq
 249999890     gbpln16.seq
 213242945     gbpln160.seq
 249998704     gbpln161.seq
 249998126     gbpln162.seq
 249999198     gbpln163.seq
 161018580     gbpln164.seq
 249996818     gbpln165.seq
 249998720     gbpln166.seq
 249915386     gbpln167.seq
 131509886     gbpln168.seq
 249998312     gbpln169.seq
 249990442     gbpln17.seq
 249999505     gbpln170.seq
 249999528     gbpln171.seq
 249997298     gbpln172.seq
 249997549     gbpln173.seq
 249998601     gbpln174.seq
  51005769     gbpln175.seq
 249998531     gbpln176.seq
 249998132     gbpln177.seq
 249834613     gbpln178.seq
 249999358     gbpln179.seq
 249965339     gbpln18.seq
 249874411     gbpln180.seq
  99715807     gbpln181.seq
 249998262     gbpln182.seq
 249999903     gbpln183.seq
 249876851     gbpln184.seq
 246454715     gbpln185.seq
 249579862     gbpln186.seq
 249998677     gbpln187.seq
  28646308     gbpln188.seq
 220745640     gbpln189.seq
  18729995     gbpln19.seq
 224206313     gbpln190.seq
 192250534     gbpln191.seq
 219520950     gbpln192.seq
 223503052     gbpln193.seq
 216899359     gbpln194.seq
 176453259     gbpln195.seq
 243157140     gbpln196.seq
 249999238     gbpln197.seq
  20000528     gbpln198.seq
   9838016     gbpln199.seq
 249998348     gbpln2.seq
 240978740     gbpln20.seq
  10084072     gbpln200.seq
 766528189     gbpln201.seq
   9056281     gbpln202.seq
 756143249     gbpln203.seq
 878426054     gbpln204.seq
 631056251     gbpln205.seq
 993852367     gbpln206.seq
1020132695     gbpln207.seq
 830166807     gbpln208.seq
 955723315     gbpln209.seq
 249892267     gbpln21.seq
1057964328     gbpln210.seq
 784007552     gbpln211.seq
 947940191     gbpln212.seq
 857511193     gbpln213.seq
 649137171     gbpln214.seq
 903393879     gbpln215.seq
 908180396     gbpln216.seq
 721135945     gbpln217.seq
 786739709     gbpln218.seq
 918070756     gbpln219.seq
 248163326     gbpln22.seq
 603192844     gbpln220.seq
 938102555     gbpln221.seq
 955978436     gbpln222.seq
 813787878     gbpln223.seq
 639701128     gbpln224.seq
 207232639     gbpln225.seq
 222591139     gbpln226.seq
 243684098     gbpln227.seq
 230132836     gbpln228.seq
 249968074     gbpln229.seq
 249712392     gbpln23.seq
 247893513     gbpln230.seq
  46333381     gbpln231.seq
 249984151     gbpln232.seq
 128173772     gbpln233.seq
 249874718     gbpln234.seq
 249821179     gbpln235.seq
 249833884     gbpln236.seq
 249815677     gbpln237.seq
 249778694     gbpln238.seq
 249999975     gbpln239.seq
 240682802     gbpln24.seq
 249999901     gbpln240.seq
  41847099     gbpln241.seq
 231415812     gbpln25.seq
 232512418     gbpln26.seq
 235239775     gbpln27.seq
 199014935     gbpln28.seq
 207051498     gbpln29.seq
 249985779     gbpln3.seq
 249999363     gbpln30.seq
  95399067     gbpln31.seq
 249999034     gbpln32.seq
 133402106     gbpln33.seq
 203982030     gbpln34.seq
  84491509     gbpln35.seq
 191574833     gbpln36.seq
 228663904     gbpln37.seq
 243276497     gbpln38.seq
 249608485     gbpln39.seq
 249974521     gbpln4.seq
 249676853     gbpln40.seq
 249998559     gbpln41.seq
 249590406     gbpln42.seq
 137796452     gbpln43.seq
 249130516     gbpln44.seq
 249951075     gbpln45.seq
 248595782     gbpln46.seq
 248796588     gbpln47.seq
 249414934     gbpln48.seq
 249604556     gbpln49.seq
 249989082     gbpln5.seq
 103698915     gbpln50.seq
 249349086     gbpln51.seq
 247427951     gbpln52.seq
 243771043     gbpln53.seq
 219791144     gbpln54.seq
 249020201     gbpln55.seq
 134817676     gbpln56.seq
 243505174     gbpln57.seq
 202810877     gbpln58.seq
 214739175     gbpln59.seq
 249924645     gbpln6.seq
 243089376     gbpln60.seq
 249507061     gbpln61.seq
 114980120     gbpln62.seq
 249874792     gbpln63.seq
 208314306     gbpln64.seq
 220962844     gbpln65.seq
 248394563     gbpln66.seq
 172290936     gbpln67.seq
 203039115     gbpln68.seq
 195647644     gbpln69.seq
 249997384     gbpln7.seq
 174630462     gbpln70.seq
 233654211     gbpln71.seq
  83738349     gbpln72.seq
 247207714     gbpln73.seq
 209396253     gbpln74.seq
 220324511     gbpln75.seq
 225243366     gbpln76.seq
 234741662     gbpln77.seq
 236517368     gbpln78.seq
 244366171     gbpln79.seq
 249979241     gbpln8.seq
 233361491     gbpln80.seq
 232947931     gbpln81.seq
  65593188     gbpln82.seq
 172902036     gbpln83.seq
 146175027     gbpln84.seq
 126466706     gbpln85.seq
 181463533     gbpln86.seq
 154678179     gbpln87.seq
 147213277     gbpln88.seq
 243795145     gbpln89.seq
 249997407     gbpln9.seq
 219220175     gbpln90.seq
 145131488     gbpln91.seq
 189274789     gbpln92.seq
 154858374     gbpln93.seq
 191029235     gbpln94.seq
 171171102     gbpln95.seq
 194023361     gbpln96.seq
 194872072     gbpln97.seq
 168527889     gbpln98.seq
 173322438     gbpln99.seq
 147957234     gbpri1.seq
 249829449     gbpri10.seq
 143951048     gbpri11.seq
 249938389     gbpri12.seq
 249864786     gbpri13.seq
 249870085     gbpri14.seq
 249923234     gbpri15.seq
 249847949     gbpri16.seq
 249851601     gbpri17.seq
 249741155     gbpri18.seq
 249904267     gbpri19.seq
 249978477     gbpri2.seq
 249931437     gbpri20.seq
 249975812     gbpri21.seq
 249641383     gbpri22.seq
 249889870     gbpri23.seq
 207519125     gbpri24.seq
 162649727     gbpri25.seq
 249994763     gbpri26.seq
 244711168     gbpri27.seq
 249973486     gbpri28.seq
 249983047     gbpri29.seq
 249829536     gbpri3.seq
 249946931     gbpri30.seq
 249783882     gbpri31.seq
 249750397     gbpri32.seq
 249840243     gbpri33.seq
 249990396     gbpri34.seq
 249995157     gbpri35.seq
  18804857     gbpri36.seq
 249995878     gbpri37.seq
 249981471     gbpri38.seq
 249410869     gbpri39.seq
 249974303     gbpri4.seq
 249982017     gbpri40.seq
 249805678     gbpri41.seq
 181210184     gbpri42.seq
 249998683     gbpri43.seq
 249975791     gbpri44.seq
 249966172     gbpri45.seq
 249999679     gbpri46.seq
 249987067     gbpri47.seq
  66348444     gbpri48.seq
 249991692     gbpri49.seq
 249917217     gbpri5.seq
 249987869     gbpri50.seq
 249997625     gbpri51.seq
 151952476     gbpri52.seq
 314294173     gbpri53.seq
 258775295     gbpri54.seq
 268666434     gbpri55.seq
 249986788     gbpri56.seq
 249969753     gbpri57.seq
 249999923     gbpri58.seq
  95283165     gbpri59.seq
 249853936     gbpri6.seq
 249750943     gbpri7.seq
 249904713     gbpri8.seq
 249823999     gbpri9.seq
    502769     gbrel.txt
 249960625     gbrod1.seq
 249869153     gbrod10.seq
  80603868     gbrod11.seq
 249853719     gbrod12.seq
 249993397     gbrod13.seq
 249952018     gbrod14.seq
 249790966     gbrod15.seq
 249791212     gbrod16.seq
 249877726     gbrod17.seq
 249887975     gbrod18.seq
 249041106     gbrod19.seq
 249878749     gbrod2.seq
 249738089     gbrod20.seq
 249777714     gbrod21.seq
 204220110     gbrod22.seq
 249998150     gbrod23.seq
 249998224     gbrod24.seq
 249960321     gbrod25.seq
 249989896     gbrod26.seq
 249997808     gbrod27.seq
 249997425     gbrod28.seq
 249999212     gbrod29.seq
 249846336     gbrod3.seq
 249999409     gbrod30.seq
  46223940     gbrod31.seq
 249956268     gbrod4.seq
 249723115     gbrod5.seq
 249894551     gbrod6.seq
 249813115     gbrod7.seq
 249947122     gbrod8.seq
 249984733     gbrod9.seq
 249997746     gbsts1.seq
 249997088     gbsts10.seq
 206741382     gbsts11.seq
 249998430     gbsts12.seq
 249999169     gbsts13.seq
 250000011     gbsts14.seq
 249998492     gbsts15.seq
  21531082     gbsts16.seq
 249999089     gbsts17.seq
 249999767     gbsts18.seq
 249999322     gbsts19.seq
 249999681     gbsts2.seq
 183368068     gbsts20.seq
 249998943     gbsts3.seq
 249996454     gbsts4.seq
  37833138     gbsts5.seq
 249998732     gbsts6.seq
 249995639     gbsts7.seq
 249996228     gbsts8.seq
 249996787     gbsts9.seq
 249995212     gbsyn1.seq
 174136686     gbsyn10.seq
 249982233     gbsyn2.seq
 249956774     gbsyn3.seq
 249995978     gbsyn4.seq
 249994081     gbsyn5.seq
 249992726     gbsyn6.seq
 249998834     gbsyn7.seq
 249997757     gbsyn8.seq
 249992743     gbsyn9.seq
 249999675     gbtsa1.seq
  50318331     gbtsa10.seq
 249998031     gbtsa100.seq
 249999022     gbtsa101.seq
 249994258     gbtsa102.seq
 250000145     gbtsa103.seq
 249999147     gbtsa104.seq
  99482523     gbtsa105.seq
 249998116     gbtsa106.seq
 249999006     gbtsa107.seq
 249999406     gbtsa108.seq
 249998157     gbtsa109.seq
 249995943     gbtsa11.seq
 249998792     gbtsa110.seq
 249999353     gbtsa111.seq
 221423351     gbtsa112.seq
 250000072     gbtsa113.seq
 249998143     gbtsa114.seq
 249999179     gbtsa115.seq
 249998870     gbtsa116.seq
 249993891     gbtsa117.seq
   9952368     gbtsa118.seq
 249997842     gbtsa119.seq
 249997183     gbtsa12.seq
 249998997     gbtsa120.seq
 249999686     gbtsa121.seq
 215403410     gbtsa122.seq
 249998009     gbtsa123.seq
 249999478     gbtsa124.seq
 250000220     gbtsa125.seq
 249999818     gbtsa126.seq
 249999718     gbtsa127.seq
 249997636     gbtsa128.seq
 164931384     gbtsa129.seq
 249994887     gbtsa13.seq
 249997163     gbtsa130.seq
 249996135     gbtsa131.seq
 249997577     gbtsa132.seq
 250000175     gbtsa133.seq
 249999451     gbtsa134.seq
 250000157     gbtsa135.seq
   2518352     gbtsa136.seq
 249997865     gbtsa137.seq
 249996502     gbtsa138.seq
 249997490     gbtsa139.seq
 249998618     gbtsa14.seq
 249999799     gbtsa140.seq
 131360517     gbtsa141.seq
 249994731     gbtsa142.seq
 249998059     gbtsa143.seq
 249999383     gbtsa144.seq
 249999200     gbtsa145.seq
  30978866     gbtsa146.seq
 249998453     gbtsa147.seq
 249998596     gbtsa148.seq
 249999972     gbtsa149.seq
 249998003     gbtsa15.seq
 249996762     gbtsa150.seq
 249998685     gbtsa151.seq
 249999392     gbtsa152.seq
 249998560     gbtsa153.seq
 249998976     gbtsa154.seq
  45724243     gbtsa155.seq
 249998921     gbtsa156.seq
 249999118     gbtsa157.seq
 249998545     gbtsa158.seq
 250000026     gbtsa159.seq
  16855572     gbtsa16.seq
 249997741     gbtsa160.seq
 249999330     gbtsa161.seq
  84607457     gbtsa162.seq
 249999313     gbtsa163.seq
 249998187     gbtsa164.seq
 249998633     gbtsa165.seq
 139220115     gbtsa166.seq
 249996774     gbtsa167.seq
 249996438     gbtsa168.seq
 249999007     gbtsa169.seq
 249998023     gbtsa17.seq
 249994445     gbtsa170.seq
 249992518     gbtsa171.seq
 249999858     gbtsa172.seq
 208363603     gbtsa173.seq
 249998828     gbtsa174.seq
 249996630     gbtsa175.seq
 249993564     gbtsa176.seq
 249994891     gbtsa177.seq
 250000106     gbtsa178.seq
 249997818     gbtsa179.seq
 249996915     gbtsa18.seq
 230583152     gbtsa180.seq
 249998515     gbtsa181.seq
 249999189     gbtsa182.seq
 249997207     gbtsa183.seq
 249996939     gbtsa184.seq
 249994703     gbtsa185.seq
 249995475     gbtsa186.seq
 249996599     gbtsa187.seq
 154687296     gbtsa188.seq
 249999558     gbtsa189.seq
 249997721     gbtsa19.seq
 249997141     gbtsa190.seq
 249999121     gbtsa191.seq
 249999588     gbtsa192.seq
 249997398     gbtsa193.seq
 249995404     gbtsa194.seq
 249999599     gbtsa195.seq
 222049284     gbtsa196.seq
 249999907     gbtsa197.seq
 249998022     gbtsa198.seq
 249999831     gbtsa199.seq
 249999875     gbtsa2.seq
 249996846     gbtsa20.seq
 249998525     gbtsa200.seq
 231476173     gbtsa201.seq
 249997536     gbtsa202.seq
 249996694     gbtsa203.seq
 249998981     gbtsa204.seq
 249997945     gbtsa205.seq
 249996879     gbtsa206.seq
 249997044     gbtsa207.seq
 249998226     gbtsa208.seq
 249998918     gbtsa209.seq
 179291287     gbtsa21.seq
  32621095     gbtsa210.seq
 249998497     gbtsa211.seq
 249998243     gbtsa212.seq
 249999255     gbtsa213.seq
 249995777     gbtsa214.seq
 249998092     gbtsa215.seq
 249998480     gbtsa216.seq
 249998398     gbtsa217.seq
 219125607     gbtsa218.seq
 249998478     gbtsa219.seq
 250000051     gbtsa22.seq
 249998905     gbtsa220.seq
 249995180     gbtsa221.seq
 249996675     gbtsa222.seq
 249994729     gbtsa223.seq
 249999027     gbtsa224.seq
 249999088     gbtsa225.seq
  28750338     gbtsa226.seq
 249999639     gbtsa227.seq
 249999892     gbtsa228.seq
 249996250     gbtsa229.seq
 249996448     gbtsa23.seq
 249995951     gbtsa230.seq
 249997802     gbtsa231.seq
 249999056     gbtsa232.seq
 249998509     gbtsa233.seq
 171540916     gbtsa234.seq
 249999882     gbtsa24.seq
 249998383     gbtsa25.seq
 150710867     gbtsa26.seq
 249999039     gbtsa27.seq
 249999075     gbtsa28.seq
 249999518     gbtsa29.seq
 249999971     gbtsa3.seq
 249998261     gbtsa30.seq
 249998844     gbtsa31.seq
   8360330     gbtsa32.seq
 249999396     gbtsa33.seq
 249998120     gbtsa34.seq
 249999803     gbtsa35.seq
 249998636     gbtsa36.seq
 249998533     gbtsa37.seq
 249998139     gbtsa38.seq
  67400599     gbtsa39.seq
 250000153     gbtsa4.seq
 249997527     gbtsa40.seq
 249999512     gbtsa41.seq
 249997467     gbtsa42.seq
 249999834     gbtsa43.seq
 249999596     gbtsa44.seq
 249998999     gbtsa45.seq
 249999361     gbtsa46.seq
  25962503     gbtsa47.seq
 249998180     gbtsa48.seq
 249999478     gbtsa49.seq
 146773925     gbtsa5.seq
 249999517     gbtsa50.seq
 249998366     gbtsa51.seq
  71315757     gbtsa52.seq
 250000188     gbtsa53.seq
 249998272     gbtsa54.seq
 249998401     gbtsa55.seq
 249995458     gbtsa56.seq
 153223993     gbtsa57.seq
 249999559     gbtsa58.seq
 249999540     gbtsa59.seq
 249998177     gbtsa6.seq
 249998090     gbtsa60.seq
 249998687     gbtsa61.seq
 249999177     gbtsa62.seq
 249998672     gbtsa63.seq
 250000057     gbtsa64.seq
 237094882     gbtsa65.seq
 249999479     gbtsa66.seq
 249996321     gbtsa67.seq
 249999966     gbtsa68.seq
 249998922     gbtsa69.seq
 249998374     gbtsa7.seq
 249998518     gbtsa70.seq
 249995333     gbtsa71.seq
 225927264     gbtsa72.seq
 249999425     gbtsa73.seq
 249997754     gbtsa74.seq
 249999723     gbtsa75.seq
 249997236     gbtsa76.seq
 249999596     gbtsa77.seq
 249997131     gbtsa78.seq
 174846214     gbtsa79.seq
 249998957     gbtsa8.seq
 249998462     gbtsa80.seq
 249997782     gbtsa81.seq
 250000080     gbtsa82.seq
 250000037     gbtsa83.seq
 249995888     gbtsa84.seq
 104827980     gbtsa85.seq
 249998728     gbtsa86.seq
 249998717     gbtsa87.seq
 249998008     gbtsa88.seq
 249999076     gbtsa89.seq
 249999330     gbtsa9.seq
 249997765     gbtsa90.seq
  39653951     gbtsa91.seq
 249999197     gbtsa92.seq
 249998374     gbtsa93.seq
 249997757     gbtsa94.seq
 249998081     gbtsa95.seq
 249999059     gbtsa96.seq
 144311861     gbtsa97.seq
 249992015     gbtsa98.seq
 249997674     gbtsa99.seq
   1116910     gbuna1.seq
 249997488     gbvrl1.seq
 249998368     gbvrl10.seq
 249998985     gbvrl11.seq
 249998910     gbvrl12.seq
 249996934     gbvrl13.seq
 249998345     gbvrl14.seq
 249996965     gbvrl15.seq
  29028071     gbvrl16.seq
 249999959     gbvrl17.seq
 249998665     gbvrl18.seq
 249995544     gbvrl19.seq
 249997897     gbvrl2.seq
 249997919     gbvrl20.seq
 209296086     gbvrl21.seq
 249999168     gbvrl22.seq
 249998202     gbvrl23.seq
 249999836     gbvrl24.seq
 250000006     gbvrl25.seq
 126651140     gbvrl26.seq
 249997774     gbvrl27.seq
 249995784     gbvrl28.seq
 249997040     gbvrl29.seq
 249999883     gbvrl3.seq
 249997145     gbvrl30.seq
 249993787     gbvrl31.seq
  55860998     gbvrl32.seq
 249982007     gbvrl33.seq
 250000111     gbvrl34.seq
 249994275     gbvrl35.seq
 249993933     gbvrl36.seq
 249996441     gbvrl37.seq
  83322946     gbvrl38.seq
 249997608     gbvrl39.seq
 249999749     gbvrl4.seq
 249997099     gbvrl40.seq
 249996777     gbvrl41.seq
 249998636     gbvrl42.seq
 249998633     gbvrl43.seq
 104851867     gbvrl44.seq
 249997867     gbvrl45.seq
 249999076     gbvrl46.seq
 248783289     gbvrl47.seq
 249997940     gbvrl48.seq
 249999551     gbvrl49.seq
 249999824     gbvrl5.seq
  34692405     gbvrl50.seq
 249999080     gbvrl51.seq
 249998547     gbvrl52.seq
 249997035     gbvrl53.seq
 249762863     gbvrl54.seq
 249985542     gbvrl55.seq
 249998268     gbvrl56.seq
 249999632     gbvrl57.seq
 249998280     gbvrl58.seq
 172748457     gbvrl59.seq
 108369979     gbvrl6.seq
 249997230     gbvrl7.seq
 249996743     gbvrl8.seq
 249994023     gbvrl9.seq
 249995502     gbvrt1.seq
  87348275     gbvrt10.seq
 249749293     gbvrt11.seq
 249836066     gbvrt12.seq
 249995333     gbvrt13.seq
  34843259     gbvrt14.seq
  15637437     gbvrt15.seq
  36032850     gbvrt16.seq
  18507952     gbvrt17.seq
 218993367     gbvrt18.seq
 238544136     gbvrt19.seq
 249731436     gbvrt2.seq
 245204042     gbvrt20.seq
 244333176     gbvrt21.seq
 212088982     gbvrt22.seq
 235491821     gbvrt23.seq
 240950113     gbvrt24.seq
 241392153     gbvrt25.seq
 233746357     gbvrt26.seq
 216505315     gbvrt27.seq
 249176153     gbvrt28.seq
 235299157     gbvrt29.seq
 249998638     gbvrt3.seq
 223829498     gbvrt30.seq
 231081542     gbvrt31.seq
 189626996     gbvrt32.seq
  14151693     gbvrt33.seq
  21383246     gbvrt34.seq
  90967413     gbvrt35.seq
 249980624     gbvrt36.seq
 249935599     gbvrt37.seq
 249988735     gbvrt38.seq
 249998221     gbvrt39.seq
 249807894     gbvrt4.seq
 249998354     gbvrt40.seq
 249989771     gbvrt41.seq
  54833277     gbvrt42.seq
 249994630     gbvrt43.seq
 249998807     gbvrt44.seq
 249997305     gbvrt45.seq
 249998619     gbvrt46.seq
 249996902     gbvrt47.seq
  95501679     gbvrt48.seq
 249999774     gbvrt49.seq
 230266413     gbvrt5.seq
 249999712     gbvrt50.seq
 249996118     gbvrt51.seq
 189102209     gbvrt52.seq
 249999417     gbvrt53.seq
 249998115     gbvrt54.seq
  22454834     gbvrt55.seq
 249996917     gbvrt56.seq
 190014549     gbvrt57.seq
 249999594     gbvrt58.seq
 249999039     gbvrt59.seq
 249992259     gbvrt6.seq
 249981712     gbvrt60.seq
 120885628     gbvrt61.seq
 249999243     gbvrt62.seq
 249998734     gbvrt63.seq
 249997113     gbvrt64.seq
  24977790     gbvrt65.seq
 249999788     gbvrt66.seq
 249998995     gbvrt67.seq
 249998356     gbvrt68.seq
 247428335     gbvrt69.seq
  13625816     gbvrt7.seq
 236339468     gbvrt70.seq
 234100397     gbvrt71.seq
 248773605     gbvrt72.seq
 247438412     gbvrt73.seq
 249933914     gbvrt74.seq
 249991250     gbvrt75.seq
 249996634     gbvrt76.seq
  91910607     gbvrt77.seq
 199952251     gbvrt78.seq
 122600608     gbvrt79.seq
 249993092     gbvrt8.seq
 243437483     gbvrt80.seq
 239733905     gbvrt81.seq
 233022258     gbvrt82.seq
 248903510     gbvrt83.seq
 240622316     gbvrt84.seq
 249662766     gbvrt85.seq
 249486033     gbvrt86.seq
 249567265     gbvrt87.seq
 249549093     gbvrt88.seq
 240581839     gbvrt89.seq
  39940926     gbvrt9.seq
 228044136     gbvrt90.seq
 207991154     gbvrt91.seq
 225553681     gbvrt92.seq
 249996698     gbvrt93.seq
 249999154     gbvrt94.seq
  14449880     gbvrt95.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         64602      87250321
BCT10        12635      75804323
BCT100       68         108099610
BCT101       45         112926461
BCT102       62         111891716
BCT103       62         108342624
BCT104       57         116195274
BCT105       63         111278300
BCT106       39         113384349
BCT107       59         111542017
BCT108       44         107663961
BCT109       44         110441702
BCT11        2600       37759883
BCT110       61         109855524
BCT111       38         110289963
BCT112       47         111322081
BCT113       11         27206151
BCT114       29         106059433
BCT115       24         104995446
BCT116       22         102815134
BCT117       22         103083356
BCT118       22         103088809
BCT119       22         103089218
BCT12        1296       115524731
BCT120       22         103633799
BCT121       22         104408660
BCT122       24         108509216
BCT123       47         110106529
BCT124       39         105943067
BCT125       9          27440665
BCT126       50         111764862
BCT127       60         109369965
BCT128       60         114865324
BCT129       68         113315118
BCT13        14         17783631
BCT130       44         114294823
BCT131       51         120259158
BCT132       59         121894787
BCT133       32         105533620
BCT134       26         110619128
BCT135       35         85165722
BCT136       44         114207420
BCT137       48         116972150
BCT138       62         113378131
BCT139       40         111579752
BCT14        79         119443556
BCT140       37         115642270
BCT141       25         110288300
BCT142       56         114513545
BCT143       7          21581982
BCT144       28         113584725
BCT145       60         113712694
BCT146       51         108768488
BCT147       38         116693963
BCT148       40         124156501
BCT149       58         116300016
BCT15        108        113659812
BCT150       28         43455255
BCT151       61         117131235
BCT152       33         109525547
BCT153       46         114210856
BCT154       71         112057562
BCT155       59         114124703
BCT156       66         113760436
BCT157       68         118323998
BCT158       25         67311299
BCT159       53         103990173
BCT16        64         117502615
BCT160       60         104041780
BCT161       29         106052559
BCT162       45         111334518
BCT163       61         114766495
BCT164       48         109041433
BCT165       64         106530026
BCT166       54         113478789
BCT167       13         11248387
BCT168       162        111153271
BCT169       84         111106670
BCT17        67         116257954
BCT170       55         109787120
BCT171       49         111465075
BCT172       45         109826408
BCT173       54         111556317
BCT174       36         113326926
BCT175       47         109376438
BCT176       21         86233168
BCT177       35         105782148
BCT178       32         106750541
BCT179       41         109306445
BCT18        66         123972567
BCT180       36         109129522
BCT181       47         111407738
BCT182       46         110556602
BCT183       48         112877957
BCT184       34         107160153
BCT185       21         55380015
BCT186       94         107567012
BCT187       30         110366632
BCT188       26         106790034
BCT189       26         106809724
BCT19        37         114503115
BCT190       33         110883410
BCT191       55         112913783
BCT192       41         108625162
BCT193       17         45134713
BCT194       54         109329126
BCT195       30         109979579
BCT196       41         110944335
BCT197       35         110170230
BCT198       50         107737018
BCT199       56         109263173
BCT2         31235      98920950
BCT20        91         122581415
BCT200       43         110528496
BCT201       29         54337812
BCT202       99         108381810
BCT203       51         106146784
BCT204       43         109679126
BCT205       48         113454617
BCT206       44         108778957
BCT207       34         110437395
BCT208       91         110429235
BCT209       61         116485890
BCT21        56         119162563
BCT210       54         111869269
BCT211       39         110141463
BCT212       35         112358952
BCT213       56         111913812
BCT214       50         112047920
BCT215       19         32144249
BCT216       70         111990039
BCT217       43         109558177
BCT218       43         112248629
BCT219       51         112580939
BCT22        85         133357143
BCT220       68         106646226
BCT221       87         102298976
BCT222       43         109238455
BCT223       48         103066847
BCT224       92         109381196
BCT225       47         107492558
BCT226       26         106747657
BCT227       36         110290270
BCT228       55         108318465
BCT229       36         107187948
BCT23        75         121928156
BCT230       38         105844899
BCT231       83         107817386
BCT232       44         107259545
BCT233       46         113019807
BCT234       22         67931236
BCT235       64         111130189
BCT236       108        104825154
BCT237       61         111304599
BCT238       62         106656274
BCT239       60         106515237
BCT24        81         115699793
BCT240       58         107099604
BCT241       79         110778774
BCT242       91         106725042
BCT243       29         104969405
BCT244       22         64568502
BCT245       50         113958402
BCT246       53         108011335
BCT247       60         108420997
BCT248       52         109213977
BCT249       72         112251232
BCT25        90         119492129
BCT250       69         110577886
BCT251       48         109632300
BCT252       60         107069404
BCT253       52         115804554
BCT254       72         106359313
BCT255       45         114547939
BCT256       45         32040831
BCT257       45         111169376
BCT258       48         112304661
BCT259       47         108169953
BCT26        80         121954198
BCT260       56         110517810
BCT261       54         116612064
BCT262       45         110227841
BCT263       61         112169959
BCT264       54         110059504
BCT265       45         108197666
BCT266       49         110061764
BCT267       78         108287013
BCT268       60         109012738
BCT269       17         35766262
BCT27        88         124737683
BCT270       51         108956514
BCT271       118        111945509
BCT272       40         114817108
BCT273       60         108910930
BCT274       55         109459019
BCT275       39         112708728
BCT276       51         111668291
BCT277       47         111180075
BCT278       45         109840945
BCT279       66         109936281
BCT28        110        127362882
BCT280       52         113632391
BCT281       97         124557240
BCT282       49         109979521
BCT283       23         57545277
BCT284       54         105746917
BCT285       43         115495170
BCT286       41         115938358
BCT287       55         112381197
BCT288       81         109038539
BCT289       58         116044525
BCT29        445        97153478
BCT290       34         105164781
BCT291       41         107294453
BCT292       16         47065327
BCT293       69         111552161
BCT294       40         107485116
BCT295       56         106939058
BCT296       101        118187257
BCT297       30         105557838
BCT298       33         104769474
BCT299       76         108888024
BCT3         47         113004732
BCT30        5200       7533877
BCT300       4          6614533
BCT301       64         105999418
BCT302       47         110185307
BCT303       80         105114161
BCT304       75         117495758
BCT305       60         114156881
BCT306       50         104169648
BCT307       68         110382862
BCT308       73         113375895
BCT309       70         113921559
BCT31        10402      13141863
BCT310       37         103321369
BCT311       60         107119178
BCT312       60         110503737
BCT313       24         101864247
BCT314       55         115901057
BCT315       16         22842593
BCT316       48         109115940
BCT317       47         108870666
BCT318       50         113823969
BCT319       79         112932493
BCT32        53817      84836831
BCT320       69         113190477
BCT321       58         113110528
BCT322       64         115389374
BCT323       61         124790527
BCT324       66         118786062
BCT325       37         115633370
BCT326       14         32748150
BCT327       62         105697558
BCT328       59         116947400
BCT329       52         110282097
BCT33        86         109498452
BCT330       39         108574367
BCT331       64         114421836
BCT332       54         111402883
BCT333       57         109811161
BCT334       60         107062309
BCT335       17         25062477
BCT336       65         109890767
BCT337       54         113942058
BCT338       80         138357086
BCT339       57         116903566
BCT34        137        95492678
BCT340       52         111604847
BCT341       74         108456864
BCT342       78         110216005
BCT343       63         104562700
BCT344       48         106758116
BCT345       71         110810362
BCT346       62         109086423
BCT347       54         108820236
BCT348       42         110254988
BCT349       48         107568738
BCT35        58         113456579
BCT350       49         112442984
BCT351       52         115130662
BCT352       66         109685433
BCT353       9          18555555
BCT354       54         117309111
BCT355       44         113768788
BCT356       52         111401293
BCT357       46         107120084
BCT358       48         112836049
BCT359       49         109386928
BCT36        52         112579647
BCT360       54         114718175
BCT361       42         110555122
BCT362       47         116825691
BCT363       53         117469922
BCT364       62         112534228
BCT365       59         115271955
BCT366       8          28479791
BCT367       58         108419516
BCT368       42         110822968
BCT369       61         106654799
BCT37        48         116997605
BCT370       53         113594866
BCT371       43         111163899
BCT372       53         110047571
BCT373       44         184648159
BCT374       12         52936329
BCT375       51         148853897
BCT376       57         112755235
BCT377       88         110505117
BCT378       101        107762924
BCT379       66         113087112
BCT38        59         116528153
BCT380       57         111216603
BCT381       72         105992986
BCT382       25         41083292
BCT383       207        155444487
BCT384       119        119863310
BCT385       68         108632952
BCT386       55         111792821
BCT387       66         108856486
BCT388       63         105658236
BCT389       42         105310251
BCT39        67         111716459
BCT390       48         114255046
BCT391       47         120158445
BCT392       36         108076276
BCT393       48         121854784
BCT394       46         113461731
BCT395       67         127028603
BCT396       81         115397233
BCT397       55         117836467
BCT398       33         105582828
BCT399       44         116007583
BCT4         58         114249094
BCT40        30         80349661
BCT400       21         43743064
BCT401       61         119308959
BCT402       37         113777682
BCT403       40         106513848
BCT404       49         109474423
BCT405       87         105032202
BCT406       53         152326981
BCT407       77         114107550
BCT408       54         108459194
BCT409       41         108293643
BCT41        44         112327765
BCT410       23         38109161
BCT411       59         115770332
BCT412       84         188841568
BCT413       67         127963710
BCT414       42         109101030
BCT415       80         110240993
BCT416       64         120398673
BCT417       72         145972784
BCT418       47         90621546
BCT419       66         140639280
BCT42        59         108549640
BCT420       78         134052612
BCT421       60         139113567
BCT422       33         115322917
BCT423       18         113162344
BCT424       17         116649367
BCT425       27         119753669
BCT426       51         111385675
BCT427       48         107307715
BCT428       52         108842262
BCT429       39         129671691
BCT43        72         113152419
BCT430       38         112279175
BCT431       40         92012526
BCT432       68         110107743
BCT433       70         111151778
BCT434       80         115757392
BCT435       80         118729014
BCT436       31         105040147
BCT437       62         117300079
BCT438       74         112168363
BCT439       34         94940832
BCT44        59         112109297
BCT440       73         110979216
BCT441       36         108120489
BCT442       46         101571124
BCT443       38         119313621
BCT444       47         113465817
BCT445       64         108970633
BCT446       61         117648254
BCT447       37         116831945
BCT448       41         118259963
BCT449       59         115824190
BCT45        60         105492134
BCT450       60         119543024
BCT451       37         80483736
BCT452       63         106158156
BCT453       69         121267167
BCT454       74         132949575
BCT455       46         113763319
BCT456       70         114548660
BCT457       61         132347917
BCT458       70         128146330
BCT459       14         67025826
BCT46        58         112573463
BCT460       58         112351507
BCT461       61         110365310
BCT462       68         106164189
BCT463       58         113190584
BCT464       52         117820407
BCT465       74         114854225
BCT466       66         106578614
BCT467       65         91230361
BCT468       50         111781989
BCT469       52         116417421
BCT47        51         106493710
BCT470       77         111110737
BCT471       50         112717063
BCT472       93         122290992
BCT473       63         126302136
BCT474       49         115076454
BCT475       33         49312732
BCT476       56         109064499
BCT477       80         111308501
BCT478       40         111059538
BCT479       73         106949760
BCT48        50         111687232
BCT480       51         107930522
BCT481       45         111066451
BCT482       61         111130053
BCT483       79         120267515
BCT484       53         132359925
BCT485       62         109519069
BCT486       44         34140481
BCT487       204        94545960
BCT488       324        21043424
BCT489       1589       2511957
BCT49        94         111458496
BCT490       3172       5268484
BCT491       6338       7796395
BCT492       12613      14997690
BCT493       25523      27672494
BCT494       50567      54073142
BCT495       76724      78740298
BCT496       72587      78185416
BCT497       8322       93184219
BCT498       5442       100112786
BCT499       3164       103164360
BCT5         27521      104242565
BCT50        58         111561411
BCT500       131        99758696
BCT501       37         107592501
BCT502       1191       101609791
BCT503       7055       99540642
BCT504       37298      89630849
BCT505       4040       3625657
BCT506       71367      76385903
BCT507       3728       103841551
BCT508       4392       102170073
BCT509       6608       100691248
BCT51        84         112644694
BCT510       3489       101202857
BCT511       20945      101457990
BCT512       75988      80453714
BCT513       66771      73020329
BCT514       76457      79300156
BCT515       73053      77688869
BCT516       73592      75212959
BCT517       10554      12784368
BCT518       71876      76355239
BCT519       72959      74967471
BCT52        108        108953601
BCT520       25400      24820835
BCT521       67482      82543400
BCT522       65291      85368297
BCT523       30454      42117409
BCT524       56213      87509393
BCT525       60743      90364957
BCT526       5486       13268903
BCT527       31212      51733663
BCT528       9244       114089862
BCT529       2544       178535584
BCT53        30         51546888
BCT530       2408       142691187
BCT531       3037       49243199
BCT532       2460       108251599
BCT533       2574       116892143
BCT534       2505       109511900
BCT535       1361       117117509
BCT536       214        111456863
BCT537       1693       110208844
BCT538       53         109665598
BCT539       42         111730579
BCT54        201        112694419
BCT540       45         114696627
BCT541       28         109791502
BCT542       220        117623009
BCT543       2489       122146043
BCT544       1225       117082036
BCT545       457        124891584
BCT546       954        134716492
BCT547       21         115156206
BCT548       25         121554497
BCT549       22         120524174
BCT55        53         109969331
BCT550       23         120079355
BCT551       466        129477810
BCT552       1611       130943401
BCT553       1018       70610815
BCT554       1195       122635658
BCT555       753        149997398
BCT556       48         160127866
BCT557       34         109993540
BCT558       327        125274877
BCT559       87         158924541
BCT56        35         108859141
BCT560       620        116589810
BCT561       2219       114237391
BCT562       11869      19839397
BCT563       24200      40594802
BCT564       60057      93520574
BCT565       61452      95807559
BCT566       30111      59875837
BCT57        60         109966555
BCT58        58         109966357
BCT59        46         113084021
BCT6         10015      14329870
BCT60        77         110161336
BCT61        61         109103329
BCT62        46         111286269
BCT63        60         112027245
BCT64        78         112427817
BCT65        84         111007733
BCT66        67         109336234
BCT67        61         108350042
BCT68        59         109790210
BCT69        55         108616273
BCT7         39658      80452171
BCT70        55         110914781
BCT71        65         113580356
BCT72        62         106974023
BCT73        69         106881048
BCT74        62         115998031
BCT75        44         116898024
BCT76        73         109295595
BCT77        55         114736454
BCT78        66         113765735
BCT79        9          1978793
BCT8         1635       58802251
BCT80        43         109853786
BCT81        51         118673819
BCT82        68         113547030
BCT83        48         110288002
BCT84        55         116500783
BCT85        104        116324895
BCT86        70         111645516
BCT87        85         109846187
BCT88        64         113994836
BCT89        62         118631327
BCT9         8013       93844117
BCT90        51         119558294
BCT91        57         114381603
BCT92        59         118186495
BCT93        5          14376193
BCT94        48         118002347
BCT95        135        118620434
BCT96        182        117074069
BCT97        66         111219258
BCT98        300        116964215
BCT99        60         109500882
ENV1         93339      72322732
ENV10        132107     31605417
ENV100       121642     48890743
ENV101       122697     46499035
ENV102       105948     50232390
ENV103       100199     51265198
ENV104       105574     50975541
ENV105       29936      34864341
ENV11        86893      70991742
ENV12        93904      73201847
ENV13        82521      86710319
ENV14        19492      17024735
ENV15        85259      81187629
ENV16        119464     43019005
ENV17        89274      78075708
ENV18        97013      67990873
ENV19        96515      63837068
ENV2         97207      69124903
ENV20        113299     67164625
ENV21        118342     65707684
ENV22        58586      79105132
ENV23        64374      80737775
ENV24        91110      75794068
ENV25        126222     39552104
ENV26        124075     29252102
ENV27        87102      20058260
ENV28        123684     50576070
ENV29        97281      68127150
ENV3         95017      67747363
ENV30        117596     55917913
ENV31        138209     52922456
ENV32        106706     62338825
ENV33        96239      64845130
ENV34        22152      21916854
ENV35        62756      85293276
ENV36        89541      73454940
ENV37        104414     44560917
ENV38        96735      58827276
ENV39        68248      51334346
ENV4         69967      85171918
ENV40        111872     47523886
ENV41        101583     61428790
ENV42        107122     62815775
ENV43        63768      91044971
ENV44        72759      79117092
ENV45        62246      84555393
ENV46        11464      15619855
ENV47        71118      78555168
ENV48        108842     49751909
ENV49        113077     56885033
ENV5         47018      96797756
ENV50        105031     61480472
ENV51        78195      41642479
ENV52        101425     44613775
ENV53        42570      53405786
ENV54        42078      54694904
ENV55        58588      57603209
ENV56        97239      61444456
ENV57        32772      18482397
ENV58        92511      67352399
ENV59        81441      71524577
ENV6         38264      105025174
ENV60        78900      68375064
ENV61        86522      70199220
ENV62        97034      59976264
ENV63        80032      52212398
ENV64        110424     46323274
ENV65        90526      60930691
ENV66        101844     52166958
ENV67        94525      57426443
ENV68        80347      75360127
ENV69        29780      21749529
ENV7         91127      82511204
ENV70        74406      83178393
ENV71        83687      51661144
ENV72        86652      60199557
ENV73        58510      76584966
ENV74        106204     31851666
ENV75        62536      15798594
ENV76        79258      74966321
ENV77        92899      58247677
ENV78        102082     60424392
ENV79        109308     39479507
ENV8         96282      73539952
ENV80        108793     38318185
ENV81        31283      23242584
ENV82        99401      54592294
ENV83        117115     29632068
ENV84        108292     41973353
ENV85        104452     50577978
ENV86        107562     43083901
ENV87        103067     51183446
ENV88        121674     47607527
ENV89        118317     40374080
ENV9         13330      1379361
ENV90        106098     51630980
ENV91        99987      54798156
ENV92        39474      35646394
ENV93        97803      56575623
ENV94        100566     55069265
ENV95        95589      51363885
ENV96        82383      38859178
ENV97        109901     47820946
ENV98        62552      47580565
ENV99        106124     66372728
EST1         160259     62097551
EST10        170053     73507361
EST100       231487     141068019
EST101       238271     124759211
EST102       193697     104507551
EST103       183117     102654719
EST104       94656      66853959
EST105       161502     120657825
EST106       175217     106883900
EST107       134158     84285238
EST108       63782      23707519
EST109       63313      22251152
EST11        168614     72962033
EST110       63754      23081945
EST111       63814      26885139
EST112       64294      22892952
EST113       64508      24555660
EST114       63486      27090486
EST115       63701      26110293
EST116       63971      27248462
EST117       63815      25137167
EST118       61190      33732180
EST119       123201     62600259
EST12        172329     73949607
EST120       161549     85997826
EST121       187221     92975401
EST122       150690     96757293
EST123       159074     93702962
EST124       127734     83201208
EST125       189491     90887898
EST126       156798     83316336
EST127       157590     84607603
EST128       158269     85437572
EST129       151748     85134053
EST13        57085      27272568
EST130       174568     93700786
EST131       184039     117519958
EST132       202785     102469987
EST133       161134     88152006
EST134       162358     81879174
EST135       143561     84728878
EST136       144605     90870713
EST137       92928      48276662
EST138       173714     98264439
EST139       244895     113049344
EST14        218752     109799542
EST140       155980     84240420
EST141       168284     92750626
EST142       150574     87902423
EST143       136254     84240231
EST144       155818     95883846
EST145       154871     85624703
EST146       124063     63626279
EST147       121216     65103381
EST148       127965     57359723
EST149       127087     51013613
EST15        169499     106218281
EST150       128371     51178003
EST151       110902     41289788
EST152       164834     83063278
EST153       177951     74540660
EST154       162638     111242253
EST155       202231     123771521
EST156       214246     121605356
EST157       175667     96820465
EST158       156091     108382132
EST159       139533     95094374
EST16        183673     113974682
EST160       158444     97029556
EST161       156442     82314066
EST162       139625     78835590
EST163       172831     95636711
EST164       59400      38067022
EST165       151422     92753771
EST166       193713     111199984
EST167       146602     84259825
EST168       142283     72103688
EST169       153001     88665407
EST17        195858     117869760
EST170       189981     105213731
EST171       157057     96440924
EST172       168625     83498974
EST173       130509     87460120
EST174       173911     101951674
EST175       173798     100070698
EST176       118792     67577187
EST177       159773     91168741
EST178       20476      12673879
EST179       171776     103774485
EST18        195784     119749799
EST180       182906     120578942
EST181       144672     116507123
EST182       195069     100183418
EST183       153571     105709808
EST184       153697     98745775
EST185       142110     82739613
EST186       179447     73226538
EST187       149874     82957628
EST188       157782     100845992
EST189       160655     98405841
EST19        160268     113665229
EST190       141545     86080498
EST191       148794     88730750
EST192       147423     94432099
EST193       131930     91717108
EST194       142352     87453193
EST195       138045     90097293
EST196       133853     94157291
EST197       164349     87752917
EST198       175289     96343985
EST199       174968     97359518
EST2         162939     61833117
EST20        190764     100960602
EST200       172688     96945891
EST201       170095     95347810
EST202       173532     96425460
EST203       174625     95674657
EST204       175031     96303988
EST205       5813       3031986
EST206       190487     105995340
EST207       207796     105978307
EST208       172847     103144609
EST209       181231     102644229
EST21        220546     107080909
EST210       202112     122786212
EST211       198705     114121930
EST212       193939     124980159
EST213       137723     92293700
EST214       221569     141481321
EST215       238289     119210363
EST216       148139     100980914
EST217       183600     101346287
EST218       203867     100053556
EST219       132285     95290645
EST22        184411     59705662
EST220       147600     86800913
EST221       211236     117312568
EST222       160373     104034385
EST223       105404     110878852
EST224       155515     103294627
EST225       162658     97805949
EST226       142957     101856367
EST227       223004     107506151
EST228       137260     98636094
EST229       114241     81340073
EST23        137069     39205207
EST230       138302     98192999
EST231       123285     88325344
EST232       144389     90150076
EST233       130191     88931822
EST234       140957     105588336
EST235       132383     93270195
EST236       125464     84936301
EST237       142978     88621554
EST238       160638     122105265
EST239       123838     118144219
EST24        102420     27732371
EST240       139946     103668587
EST241       178759     108180583
EST242       164211     102116748
EST243       160067     100820308
EST244       74582      43768408
EST245       167614     126224152
EST246       143984     106328450
EST247       157129     100657002
EST248       215043     97800950
EST249       184850     113301784
EST25        120665     50517501
EST250       156778     84286535
EST251       219503     30479839
EST252       216706     87309068
EST253       163948     122023689
EST254       174879     102624637
EST255       163569     108571445
EST256       108611     67411511
EST257       156163     114082007
EST258       185636     112477335
EST259       190424     98923788
EST26        215887     98370717
EST260       177295     111304608
EST261       164129     111500474
EST262       233947     110114348
EST263       279116     121376541
EST264       188528     113780627
EST265       188782     37313463
EST266       260966     125049154
EST267       54985      36364779
EST268       153592     97942677
EST269       166526     102543077
EST27        220201     110671495
EST270       167425     114863094
EST271       198119     103380137
EST272       159010     107909616
EST273       195817     114672727
EST274       199211     47007833
EST275       204992     45224390
EST276       183871     103125907
EST277       177904     119167816
EST278       182108     115432936
EST279       116036     66112151
EST28        190524     88191861
EST280       176078     114623386
EST281       171710     74895955
EST282       133028     83114835
EST283       132566     86061800
EST284       157086     101601742
EST285       262927     27718775
EST286       266929     24542066
EST287       145354     107945197
EST288       170063     111229925
EST289       160997     101290173
EST29        158444     69180808
EST290       163562     89511168
EST291       138143     12633672
EST292       210500     74868070
EST293       166540     107863016
EST294       177625     107035126
EST295       153674     99395537
EST296       201813     108801740
EST297       154038     111091343
EST298       167236     101304650
EST299       188434     115625639
EST3         151652     53800632
EST30        172164     69715344
EST300       180665     104138886
EST301       188045     98391377
EST302       183287     64079934
EST303       119456     42081099
EST304       183142     70997036
EST305       183731     69502430
EST306       187061     96549820
EST307       183487     131851201
EST308       146136     85012879
EST309       153226     92969091
EST31        151760     64192259
EST310       132080     100810366
EST311       161916     97288147
EST312       172853     98962433
EST313       149909     96828550
EST314       168172     95288205
EST315       161177     107652883
EST316       96681      68538930
EST317       165210     108422101
EST318       158273     109562222
EST319       179854     152475750
EST32        166994     75920414
EST320       171307     111745332
EST321       142657     76715117
EST322       144096     98252156
EST323       147424     100987258
EST324       135592     91374858
EST325       150063     100287082
EST326       150889     101489042
EST327       178869     109717240
EST328       148324     84073781
EST329       148811     84878954
EST33        178894     70077392
EST330       58631      36441517
EST331       151262     108834993
EST332       162315     97563323
EST333       144001     91589335
EST334       142620     89736553
EST335       206819     112190252
EST336       136206     74532906
EST337       91068      54522529
EST338       131642     86793225
EST339       137240     87129456
EST34        114680     38231179
EST340       124897     79755583
EST341       161400     86283715
EST342       217051     84560487
EST343       170130     88070806
EST344       102602     60717770
EST345       165765     103770776
EST346       147391     90126987
EST347       133555     88950057
EST348       136548     89007847
EST349       187154     122326091
EST35        96208      29541980
EST350       160357     97075768
EST351       152928     77591882
EST352       189081     128396707
EST353       117068     81119323
EST354       72728      43773792
EST355       136012     74812563
EST356       131104     78565016
EST357       146643     58336199
EST358       155750     31600674
EST359       47023      9667327
EST36        96592      30207216
EST360       153467     41373945
EST361       190944     120599804
EST362       238950     114560874
EST363       249340     114021717
EST364       188179     103196207
EST365       140900     91268052
EST366       135911     86398187
EST367       153177     90267156
EST368       191646     118414990
EST369       229598     63680293
EST37        95515      28984345
EST370       179807     111562547
EST371       27173      13536889
EST372       215130     118149362
EST373       205635     122114552
EST374       203715     116157500
EST375       144967     69926827
EST376       197904     122126468
EST377       163569     103519305
EST378       162829     125285929
EST379       183147     147506807
EST38        97387      29417876
EST380       158169     91620836
EST381       164811     106312703
EST382       186583     106409353
EST383       89742      52609720
EST384       206299     112344962
EST385       195819     108963019
EST386       192302     118493184
EST387       191344     124849353
EST388       202593     133494303
EST389       220169     133526613
EST39        97623      30930126
EST390       208620     133307508
EST391       198713     150188178
EST392       213436     165466849
EST393       201872     121733560
EST394       47405      29595406
EST395       181196     94742339
EST396       172176     70233304
EST397       164957     12798539
EST398       152093     14460564
EST399       155500     32187003
EST4         172279     67729780
EST40        27127      6947298
EST400       155856     31319893
EST401       155560     32037250
EST402       147886     95635975
EST403       189174     114135747
EST404       161115     109226874
EST405       166778     101354596
EST406       149124     102791546
EST407       120356     83533967
EST408       145553     95062181
EST409       173051     118625184
EST41        101680     53135326
EST410       142857     99381352
EST411       177841     105129458
EST412       173246     36304123
EST413       165737     58808879
EST414       156531     110567051
EST415       161841     103588993
EST416       162966     101257642
EST417       158383     91970468
EST418       190270     124464729
EST419       145568     96140330
EST42        119480     50845228
EST420       126068     86550694
EST421       154637     95703479
EST422       156234     93653207
EST423       174710     93749892
EST424       160916     96894918
EST425       166768     96626398
EST426       172543     106148950
EST427       141249     88329887
EST428       102193     72974678
EST429       80783      62115516
EST43        166666     92196190
EST430       105803     69718297
EST431       157076     86395621
EST432       126923     77086196
EST433       139587     91504991
EST434       141876     83449374
EST435       44490      30113612
EST436       167731     97712200
EST437       179626     93724264
EST438       164641     105788075
EST439       154804     96653186
EST44        171093     72322883
EST440       171613     77027177
EST441       193188     106238053
EST442       155233     83955129
EST443       167213     96949431
EST444       221390     130261227
EST445       155423     105873232
EST446       171577     103514064
EST447       140731     93140013
EST448       21635      14343338
EST449       136291     91314820
EST45        167868     85343986
EST450       198922     74971664
EST451       182001     86213677
EST452       207569     88879978
EST453       201440     81794865
EST454       182875     107455073
EST455       184220     112352873
EST456       191136     110066783
EST457       196336     116697890
EST458       199231     130776204
EST459       189969     88587976
EST46        169319     87177234
EST460       9714       4700881
EST461       186927     112017713
EST462       216855     130683850
EST463       213949     133189225
EST464       204259     118324880
EST465       199838     119851828
EST466       172934     104604094
EST467       200784     125843327
EST468       154135     90987844
EST469       148569     111762459
EST47        163966     88173423
EST470       159551     86987594
EST471       188419     96710743
EST472       5465       2960752
EST473       149976     80311943
EST474       155470     85134207
EST475       186733     99191095
EST476       168810     109362600
EST477       184491     106593089
EST478       177121     116616158
EST479       184401     122709633
EST48        163075     83191636
EST480       182067     119157610
EST481       178754     104264454
EST482       191464     115082788
EST483       210180     125337229
EST484       108589     37703156
EST485       277628     94149131
EST486       237549     77979628
EST487       171099     59531545
EST488       162056     63120519
EST489       9836       3006358
EST49        160614     91563793
EST5         170310     66711371
EST50        162706     89634804
EST51        158664     98428541
EST52        160231     70989841
EST53        148594     83114091
EST54        66044      44502697
EST55        168332     70374074
EST56        165739     75324623
EST57        166137     91761482
EST58        159098     96832642
EST59        157253     103132324
EST6         172511     67136237
EST60        165454     99520364
EST61        161123     109052854
EST62        173064     79245558
EST63        174863     94893433
EST64        155306     84397250
EST65        148772     82595673
EST66        160847     97883134
EST67        124011     71479700
EST68        150450     92212312
EST69        196250     108982104
EST7         171663     73640184
EST70        182404     95469693
EST71        221632     121574094
EST72        188118     112721793
EST73        203421     120410596
EST74        165090     90732269
EST75        132465     60662032
EST76        137108     67492566
EST77        159768     100891978
EST78        158009     95859854
EST79        143499     79222678
EST8         181665     73758575
EST80        41771      19328447
EST81        164107     100513122
EST82        213242     115452960
EST83        226556     125094842
EST84        202025     95221809
EST85        213294     93917346
EST86        160274     92311760
EST87        144756     88406343
EST88        164694     80782776
EST89        160987     81176714
EST9         168624     69343035
EST90        152944     102039194
EST91        152298     91427552
EST92        124768     79022360
EST93        156598     113286613
EST94        141826     103815424
EST95        142668     102020659
EST96        141669     97901024
EST97        148194     81693026
EST98        179920     112081700
EST99        227897     137928703
GSS1         201999     88514458
GSS10        133688     61854048
GSS100       145808     114924281
GSS101       142441     116458038
GSS102       144399     118006621
GSS103       171003     129235213
GSS104       135795     73648523
GSS105       192636     121669182
GSS106       169804     113413955
GSS107       201943     118670084
GSS108       207461     135918679
GSS109       210915     139107139
GSS11        137309     73012824
GSS110       209997     139958978
GSS111       205501     145682651
GSS112       206748     144049585
GSS113       205575     145742091
GSS114       203257     147469686
GSS115       181584     136741645
GSS116       3063       1517819
GSS117       131194     82845655
GSS118       170356     80873860
GSS119       184817     79465989
GSS12        149008     76238593
GSS120       170476     148427545
GSS121       178689     121369362
GSS122       180327     146378144
GSS123       188763     121698950
GSS124       188213     139356926
GSS125       193142     128186129
GSS126       191688     94088238
GSS127       164209     153120210
GSS128       164861     115114198
GSS129       58696      35055542
GSS13        146088     69808585
GSS130       167432     152215735
GSS131       168608     151240559
GSS132       168823     151737809
GSS133       169903     151014008
GSS134       167608     154262929
GSS135       180449     134846730
GSS136       173107     148559896
GSS137       173503     123186593
GSS138       187874     93660250
GSS139       257731     53129541
GSS14        173401     86662545
GSS140       257003     39623565
GSS141       115592     17772988
GSS142       257047     59269757
GSS143       266430     55379786
GSS144       191916     87960336
GSS145       198143     66958191
GSS146       185768     147752075
GSS147       181752     150159955
GSS148       166223     153557987
GSS149       167498     154552389
GSS15        163238     97353241
GSS150       234477     76520922
GSS151       231360     78718534
GSS152       127619     57493933
GSS153       215204     55237658
GSS154       159097     98482656
GSS155       182496     113473610
GSS156       136463     87205037
GSS157       164121     130228538
GSS158       179790     157929986
GSS159       188702     155787797
GSS16        173306     88994363
GSS160       191690     126801439
GSS161       218392     139389662
GSS162       223006     133746949
GSS163       161463     99421045
GSS164       151184     86639368
GSS165       38357      29392769
GSS166       213073     158912062
GSS167       193325     101875916
GSS168       173686     70246349
GSS169       204680     158713494
GSS17        185706     116446690
GSS170       207041     161413927
GSS171       208224     164691210
GSS172       206834     134323660
GSS173       204076     146697668
GSS174       224112     135782778
GSS175       201770     66573409
GSS176       173174     93157376
GSS177       259004     142497052
GSS178       31917      18385773
GSS179       87375      64103840
GSS18        191382     111501096
GSS180       83926      63074443
GSS181       103736     48659056
GSS182       68877      58698888
GSS183       7313       6756990
GSS184       68904      58160721
GSS185       69534      56898519
GSS186       69772      56433485
GSS187       71622      56290743
GSS188       67206      50842980
GSS189       76238      58461130
GSS19        99170      44376980
GSS190       86639      74399035
GSS191       81831      44658448
GSS192       92736      45153832
GSS193       63725      47847900
GSS194       78081      61893846
GSS195       70457      59382827
GSS196       68395      63565679
GSS197       63332      52838738
GSS198       94982      42020100
GSS199       18216      4260634
GSS2         183858     93157933
GSS20        181683     101687387
GSS200       113554     71279902
GSS201       206        156931
GSS202       23226      28867035
GSS203       109723     71097090
GSS204       84797      34832316
GSS205       34871      21614135
GSS206       103993     62903048
GSS207       102976     64217927
GSS208       105147     68151070
GSS209       79884      39912713
GSS21        167108     114793814
GSS210       83527      54888563
GSS211       96136      61753164
GSS212       108044     78945540
GSS213       104766     75631871
GSS214       106686     80430314
GSS215       104248     80117974
GSS216       76721      51115479
GSS217       103345     62631542
GSS218       110548     66826634
GSS219       106057     59212883
GSS22        170325     98039659
GSS220       68304      37406646
GSS221       69501      38677774
GSS222       36760      17562257
GSS223       86142      46401696
GSS224       98449      56764845
GSS225       94892      49440300
GSS226       97262      56462367
GSS227       39255      21997076
GSS228       114855     43716251
GSS229       117293     39460437
GSS23        187209     127408365
GSS230       109075     53490846
GSS231       108949     67746338
GSS232       101533     78141049
GSS233       54696      32336729
GSS234       97424      37123873
GSS235       96927      37873906
GSS236       98284      35637304
GSS237       95520      40185769
GSS238       31845      14945615
GSS239       104191     66442509
GSS24        194129     129711183
GSS240       95150      61604354
GSS241       95766      60724103
GSS242       95367      61293700
GSS243       75595      70600991
GSS244       81916      69016607
GSS245       33634      32491215
GSS246       82831      27918196
GSS247       83303      27045179
GSS248       83897      25794921
GSS249       17701      5153013
GSS25        177704     104821210
GSS250       16547      7508221
GSS251       94605      60908245
GSS252       96103      64610709
GSS253       95270      65040443
GSS254       106528     70066025
GSS255       92475      46091116
GSS256       91780      49886764
GSS257       76121      41539409
GSS258       91399      57345117
GSS259       90265      62185096
GSS26        186433     108659293
GSS260       88936      64255670
GSS261       89858      62824607
GSS262       7578       5429987
GSS263       88518      64189595
GSS264       91219      63097213
GSS265       94711      59499098
GSS266       75614      65245817
GSS267       84994      78968925
GSS268       83445      81047461
GSS269       66441      49326047
GSS27        169848     151601054
GSS270       115710     63345042
GSS271       109508     55806767
GSS272       107863     52276734
GSS273       97634      43692152
GSS274       110146     49201977
GSS275       98861      46183314
GSS276       81078      63156364
GSS277       73131      73078884
GSS278       64591      55602017
GSS279       60949      47151330
GSS28        189773     145073157
GSS280       35630      26902277
GSS281       61051      46897110
GSS282       62318      49766268
GSS283       84463      87124836
GSS284       82870      89025174
GSS285       76621      72751886
GSS286       84728      65179968
GSS287       60336      48552561
GSS288       60281      48723318
GSS289       80187      51874172
GSS29        152608     107573482
GSS290       82184      61367380
GSS291       44416      26577232
GSS292       95284      57518679
GSS293       94047      59336854
GSS294       94416      58789547
GSS295       95209      57626971
GSS296       81805      50093018
GSS297       104332     69608616
GSS298       104890     74782057
GSS299       110042     68759043
GSS3         176647     88467635
GSS30        191429     131111242
GSS300       107586     71626914
GSS301       36263      24826247
GSS302       112024     66445708
GSS303       98068      61327788
GSS304       107604     56999766
GSS305       93293      73291771
GSS306       82737      88820842
GSS307       78908      94250347
GSS308       50679      28237992
GSS31        12276      7990664
GSS32        196429     127529115
GSS33        219167     117456751
GSS34        221042     114923019
GSS35        222158     113410169
GSS36        214758     124551938
GSS37        197363     155498540
GSS38        194084     145981308
GSS39        190153     68173041
GSS4         168035     85620065
GSS40        185010     97356806
GSS41        188026     124703658
GSS42        174007     161305649
GSS43        7784       5083073
GSS44        184005     100327333
GSS45        173407     121894508
GSS46        181525     122309933
GSS47        186783     119383814
GSS48        77984      67701369
GSS49        170875     101416009
GSS5         47363      28593968
GSS50        167028     102601612
GSS51        167206     102059782
GSS52        182865     120861583
GSS53        184993     116701488
GSS54        182013     122988342
GSS55        186945     113022729
GSS56        189549     135314027
GSS57        177946     104035994
GSS58        195388     120407158
GSS59        180925     132800654
GSS6         162839     85050355
GSS60        5573       5087952
GSS61        172542     138742030
GSS62        163019     112441384
GSS63        163036     112490862
GSS64        156112     105791147
GSS65        156625     129001366
GSS66        171047     143175810
GSS67        177111     115369849
GSS68        203520     127506322
GSS69        194030     110693886
GSS7         166651     79950796
GSS70        246085     127299017
GSS71        160757     106735184
GSS72        159371     119748324
GSS73        162160     124153534
GSS74        162126     124215068
GSS75        174848     108855034
GSS76        187540     137863532
GSS77        17122      10795558
GSS78        197920     125806647
GSS79        170015     111100734
GSS8         166771     89487178
GSS80        198129     129738745
GSS81        209186     88747150
GSS82        191779     96779044
GSS83        131725     92039727
GSS84        146365     117517243
GSS85        140385     117533543
GSS86        143525     114520782
GSS87        144801     120499247
GSS88        142518     116297868
GSS89        107052     89224034
GSS9         138217     67362028
GSS90        150235     122912810
GSS91        148446     118207064
GSS92        144723     113712881
GSS93        143572     116105240
GSS94        145090     120465798
GSS95        149148     121577888
GSS96        148154     119054667
GSS97        146874     121658747
GSS98        146886     121639475
GSS99        147426     120567262
HTC1         25101      27115273
HTC10        68990      83670707
HTC11        68102      69600139
HTC12        56786      53130059
HTC13        67768      60782734
HTC14        69852      69982186
HTC15        54453      43811982
HTC2         16105      36288852
HTC3         16046      36677221
HTC4         16271      35595400
HTC5         15996      40356923
HTC6         16084      37533163
HTC7         54286      32155873
HTC8         30551      18495385
HTC9         60910      77896619
HTG1         1319       188798847
HTG10        1299       186399691
HTG100       990        189448072
HTG101       997        189338886
HTG102       983        189157681
HTG103       1164       191380395
HTG104       22         2840231
HTG105       1090       190373723
HTG106       1053       190176019
HTG107       1392       191740916
HTG108       1294       191609595
HTG109       1641       191150380
HTG11        4          606452
HTG110       1331       192003621
HTG111       886        128541061
HTG112       1439       190844464
HTG113       1519       189555079
HTG114       1507       185985994
HTG115       1505       180139091
HTG116       1439       189988054
HTG117       1549       182739821
HTG118       1576       179517828
HTG119       1380       157639225
HTG12        1452       184004673
HTG120       1591       179505523
HTG121       1587       179611588
HTG122       1580       179575648
HTG123       1598       179580959
HTG124       1603       179513131
HTG125       1581       180746555
HTG126       1555       183982954
HTG127       1574       183957055
HTG128       1485       187625796
HTG129       1414       189852056
HTG13        875        191786413
HTG130       1063       185876469
HTG131       674        108990706
HTG132       1558       186647331
HTG133       1862       178854359
HTG134       987        187982440
HTG135       1085       193367281
HTG136       1091       193164785
HTG137       578        105203883
HTG138       1032       189666580
HTG139       1055       192668594
HTG14        754        192249622
HTG140       1164       191966294
HTG141       1079       192247965
HTG142       1083       192977959
HTG143       588        103686357
HTG144       1122       192664765
HTG145       1078       192391538
HTG146       1078       192343720
HTG147       1167       191963087
HTG148       2125       191459994
HTG149       1096       192456765
HTG15        746        192098155
HTG150       1077       192049291
HTG151       1088       192458469
HTG152       1037       190364444
HTG153       1998       182603873
HTG154       1766       189499012
HTG155       112        8249664
HTG16        785        191953105
HTG17        796        191820344
HTG18        776        191918138
HTG19        2070       170867394
HTG2         2464       186026155
HTG20        1105       187256821
HTG21        874        179202862
HTG22        785        191651644
HTG23        928        190141652
HTG24        907        190491600
HTG25        811        191323929
HTG26        784        191771279
HTG27        874        191079273
HTG28        896        190515178
HTG29        939        189959636
HTG3         2516       185249883
HTG30        911        190941779
HTG31        841        171449145
HTG32        876        191233060
HTG33        967        189366255
HTG34        884        191025385
HTG35        868        191276405
HTG36        825        191702609
HTG37        949        189868158
HTG38        949        190351720
HTG39        940        190045229
HTG4         2553       188400147
HTG40        1049       189067591
HTG41        1089       167537350
HTG42        1257       188207454
HTG43        1169       188143648
HTG44        1150       188026157
HTG45        1118       191332771
HTG46        1268       190550291
HTG47        1175       190762525
HTG48        1128       191238543
HTG49        1046       191316194
HTG5         1283       185468219
HTG50        1030       189606221
HTG51        1041       178579157
HTG52        969        190260546
HTG53        1105       190197636
HTG54        1046       190176357
HTG55        1014       189806472
HTG56        968        189013700
HTG57        80         14074619
HTG58        1010       189338312
HTG59        1029       189906352
HTG6         1273       185194143
HTG60        1078       187304761
HTG61        1125       188308213
HTG62        987        170842440
HTG63        1086       189577588
HTG64        1065       189501278
HTG65        1169       188886612
HTG66        1179       187436132
HTG67        1283       184477002
HTG68        90         11586390
HTG69        1224       185639149
HTG7         1276       185273299
HTG70        1238       184594896
HTG71        1245       184608221
HTG72        1182       187730359
HTG73        1016       169381726
HTG74        1124       189291870
HTG75        1111       192198396
HTG76        1147       192455345
HTG77        1188       192530503
HTG78        1070       181090314
HTG79        1182       192179432
HTG8         1458       184539635
HTG80        1130       192597104
HTG81        1231       192164530
HTG82        1131       192205387
HTG83        907        155718784
HTG84        1244       190290657
HTG85        1256       189445002
HTG86        1159       192543685
HTG87        1159       192540759
HTG88        928        158882781
HTG89        1197       192656061
HTG9         1200       186946737
HTG90        1117       192722248
HTG91        1161       192777037
HTG92        1131       193019385
HTG93        902        149867285
HTG94        1065       192616675
HTG95        1172       192538158
HTG96        1029       189700171
HTG97        1076       190088822
HTG98        658        122808035
HTG99        1019       189897801
INV1         94383      48935179
INV10        81160      72331339
INV100       137        196570617
INV101       724        180163965
INV102       4948       181219421
INV103       3685       150295130
INV104       4631       147440474
INV105       6450       158297833
INV106       21485      79668462
INV107       73144      58606718
INV108       76230      46160472
INV109       76651      44394679
INV11        47986      93521525
INV110       76358      48220597
INV111       60080      34819193
INV112       74800      49086075
INV113       76715      44375090
INV114       76510      54840371
INV115       72843      64219413
INV116       67517      74599854
INV117       2109       24607499
INV12        36         176944197
INV13        171        169829817
INV14        9          195252378
INV15        28117      141591685
INV16        83144      66867783
INV17        41865      34477085
INV18        85667      66961577
INV19        81739      67544952
INV2         59378      92751915
INV20        79192      68582231
INV21        47317      43507860
INV22        36854      122809002
INV23        283        150449073
INV24        51753      102163258
INV25        78129      57085847
INV26        72188      61318935
INV27        23860      127823841
INV28        6          133712559
INV29        57390      102357376
INV3         1370       188389428
INV30        75135      50751116
INV31        77119      54587850
INV32        3852       3450185
INV33        77293      54823394
INV34        75630      55285212
INV35        76226      56067067
INV36        77174      59947255
INV37        73985      48840315
INV38        2875       2105256
INV39        79668      57488524
INV4         908        125771686
INV40        75492      56153514
INV41        75086      61750260
INV42        78695      58700332
INV43        52638      35252952
INV44        78699      56875177
INV45        74438      52705621
INV46        75499      57362390
INV47        78039      58290062
INV48        36651      31636892
INV49        76324      48767351
INV5         26741      110390491
INV50        73558      44851156
INV51        75828      45871387
INV52        77458      54470724
INV53        30062      21740354
INV54        77321      54795308
INV55        74700      44646208
INV56        74013      43747388
INV57        74253      42863254
INV58        29804      18022827
INV59        69784      41440732
INV6         78694      72078716
INV60        69415      41583485
INV61        69053      41728046
INV62        69134      41115948
INV63        52564      34799468
INV64        69562      40595880
INV65        71147      43810916
INV66        68606      51493253
INV67        66998      48433782
INV68        71104      55212078
INV69        71399      53711846
INV7         53873      96439255
INV70        71273      53974247
INV71        77300      60249767
INV72        75271      58759508
INV73        77150      57461509
INV74        77862      63990116
INV75        34464      143424539
INV76        20801      45158083
INV77        81899      126749699
INV78        101136     110191760
INV79        116939     96644568
INV8         4720       175113071
INV80        99289      69232818
INV81        39632      151261647
INV82        472        47268496
INV83        800        42674647
INV84        566        40635863
INV85        8037       115580217
INV86        8071       166406101
INV87        15490      165838134
INV88        21683      161462030
INV89        1340       8441268
INV9         37198      48524427
INV90        29318      156008826
INV91        38723      149357093
INV92        51920      140051234
INV93        71367      126811786
INV94        64375      76908791
INV95        118449     93189348
INV96        62122      144117104
INV97        1743       177545896
INV98        14644      152865419
INV99        141        195503801
MAM1         21108      155417307
MAM10        1          249270926
MAM11        1          224538689
MAM12        1          119391557
MAM13        1          108026203
MAM14        1          117168053
MAM15        1          100190483
MAM16        1          90795278
MAM17        2          181387745
MAM18        2          141515582
MAM19        2          145976525
MAM2         13362      165892511
MAM20        2          152818830
MAM21        2          141060329
MAM22        3          161893012
MAM23        3          155380844
MAM24        2          89552564
MAM25        1          135657913
MAM26        1          152899641
MAM27        1          136179924
MAM28        1          116383733
MAM29        1          113757587
MAM3         21062      32456989
MAM30        1          118388990
MAM31        1          102953489
MAM32        2          129845822
MAM33        1          103782134
MAM34        2          139482799
MAM35        2          154419370
MAM36        2          161344367
MAM37        3          189161858
MAM38        3          172078298
MAM39        3          166779946
MAM4         26813      24993470
MAM40        5          193070562
MAM41        9          140471672
MAM42        54         7614329
MAM43        215        34073042
MAM44        431        71272130
MAM45        861        68509101
MAM46        1706       2411269
MAM47        6836       6159435
MAM48        80286      75310347
MAM49        30240      118091297
MAM5         13731      20581276
MAM50        76918      63014687
MAM51        69822      72842202
MAM52        65264      78649476
MAM53        53054      89742365
MAM54        21499      153238824
MAM55        43738      102151203
MAM6         3445       7368868
MAM7         107        699953
MAM8         19         1775631
MAM9         1          275920749
PAT1         225421     70993855
PAT10        126653     101608761
PAT100       180490     3429310
PAT101       180135     3422565
PAT102       179993     3419867
PAT103       179981     3419639
PAT104       125419     2711863
PAT105       349650     8741250
PAT106       186050     91875274
PAT107       107513     135541957
PAT108       3843       194691476
PAT109       137991     108090545
PAT11        90453      62784247
PAT110       151783     50730134
PAT111       227882     34313993
PAT112       253630     16070281
PAT113       177600     67409226
PAT114       48026      21887625
PAT115       115735     110547167
PAT116       139350     84264399
PAT117       161029     103164867
PAT118       167185     100849156
PAT119       134737     117530952
PAT12        142880     63395362
PAT120       36618      23041490
PAT121       194814     83178152
PAT122       155047     107550529
PAT123       364428     11160383
PAT124       248176     64617758
PAT125       132887     40797313
PAT126       328269     22915988
PAT127       155764     104210281
PAT128       126354     109119371
PAT129       128479     122630735
PAT13        104574     59133164
PAT130       21689      184619586
PAT131       149967     111615722
PAT132       168658     100093679
PAT133       43844      172281111
PAT134       8038       42566337
PAT135       33730      178662375
PAT136       155435     110345001
PAT137       180818     91511668
PAT138       137025     116369121
PAT139       119019     125218305
PAT14        103238     50079881
PAT140       4849       4475753
PAT141       158424     101541724
PAT142       184327     90868267
PAT143       185136     85636854
PAT144       177480     94577577
PAT145       20467      17346132
PAT146       149543     109199294
PAT147       161593     103400312
PAT148       186330     92436086
PAT149       228368     45729382
PAT15        121140     53105997
PAT150       205276     48281754
PAT151       283466     9264744
PAT152       224633     46570735
PAT153       95243      2594242
PAT154       274370     21772171
PAT155       186799     63026714
PAT156       111649     105352203
PAT157       41636      8368539
PAT158       88148      89406799
PAT159       79144      97081796
PAT16        113079     61315420
PAT160       152801     75262352
PAT161       163970     75813833
PAT162       125694     90268589
PAT163       98235      89697512
PAT164       160480     39727117
PAT165       274167     5209173
PAT166       274122     5208318
PAT167       274122     5208318
PAT168       225455     4283645
PAT169       273522     5196918
PAT17        40107      16656788
PAT170       235901     27355379
PAT171       209223     45648746
PAT172       1997       69573
PAT173       165888     75954920
PAT174       91807      127288620
PAT175       177921     70072695
PAT176       210426     71386681
PAT177       39406      44066854
PAT178       236689     61271332
PAT179       125083     125590832
PAT18        147938     53119339
PAT180       217679     68931191
PAT181       197384     85491224
PAT182       192799     86183567
PAT183       160052     103142924
PAT184       158485     104252941
PAT185       152376     102303293
PAT186       153284     104821004
PAT187       108066     120931232
PAT188       131010     97456392
PAT189       129357     120521145
PAT19        156198     77748072
PAT190       175044     97302491
PAT191       144298     115604482
PAT192       132490     120416967
PAT193       99092      135657342
PAT194       156484     107532837
PAT195       187757     62538940
PAT196       31550      29445733
PAT197       93826      87469183
PAT198       91784      80783259
PAT199       85388      91256491
PAT2         194679     86396194
PAT20        104148     118963756
PAT200       109494     54259324
PAT201       97906      55962298
PAT202       151406     25025002
PAT203       92604      85288661
PAT204       27031      161947013
PAT205       116076     64442611
PAT206       78456      27182019
PAT207       3632       191904545
PAT208       84658      79944634
PAT209       147804     24785609
PAT21        131837     98082051
PAT210       77115      100107426
PAT211       95461      72396213
PAT212       130092     32533691
PAT213       1386       4384298
PAT214       107201     62296741
PAT215       140564     13376548
PAT216       152488     23320938
PAT217       78288      10420708
PAT218       53299      70147281
PAT219       41588      53257148
PAT22        83498      75717880
PAT220       60912      55078171
PAT221       37663      64678945
PAT222       41773      60415230
PAT223       40163      55397856
PAT224       87860      55688969
PAT225       115382     52029938
PAT226       26008      9048698
PAT227       105881     53605089
PAT228       97873      46948548
PAT229       86062      71840182
PAT23        124774     103847682
PAT230       97452      8890305
PAT231       117381     19495921
PAT232       87918      130066340
PAT233       161761     78738364
PAT234       211966     49799578
PAT235       174308     64860705
PAT236       52276      7524806
PAT237       162448     79722768
PAT238       121563     100427675
PAT239       85468      130882785
PAT24        118221     108124614
PAT240       38100      167516171
PAT241       35868      169133023
PAT242       74292      134041199
PAT243       256650     29271966
PAT244       136543     93162338
PAT245       150102     82885593
PAT246       140933     76146143
PAT247       12273      8260588
PAT248       142939     87445786
PAT249       144204     95215889
PAT25        150174     84692460
PAT250       264981     9683594
PAT251       144377     4340536
PAT252       240761     24361869
PAT253       256037     8953305
PAT254       262605     3939075
PAT255       262605     3939075
PAT256       153472     3896783
PAT257       225731     30138510
PAT258       151701     93683972
PAT259       172305     96419302
PAT26        178514     63567521
PAT260       73385      9861487
PAT261       132237     118204122
PAT262       127658     120598622
PAT263       3357       195490777
PAT264       1277       196638191
PAT265       113842     128323979
PAT266       77057      79485375
PAT267       207306     76888680
PAT268       101163     43549091
PAT269       93044      17617670
PAT27        63317      1582925
PAT270       47485      136138538
PAT271       6430       91690961
PAT272       76636      105127353
PAT273       101249     76175895
PAT274       37392      112048481
PAT275       34156      73068608
PAT276       37959      57713256
PAT277       37837      58072485
PAT278       37921      57724944
PAT279       37832      58049740
PAT28        102489     77951993
PAT280       46231      38675647
PAT281       129929     18053062
PAT282       115666     50591436
PAT283       124999     25113741
PAT284       76619      37966262
PAT285       133959     31130348
PAT286       130625     26677385
PAT287       143447     9914585
PAT288       166158     74060022
PAT289       261572     3923580
PAT29        95015      87383270
PAT290       197120     50753581
PAT291       128249     104725701
PAT292       99526      13340137
PAT293       202590     51163528
PAT294       157990     81606772
PAT295       154604     45700196
PAT296       132977     3990536
PAT297       132977     3989960
PAT298       19955      598668
PAT299       133140     6548394
PAT3         173711     96697883
PAT30        120009     62059590
PAT300       96159      70667857
PAT301       103123     49989409
PAT302       125140     22774974
PAT303       144928     3764734
PAT304       136103     15294700
PAT305       63878      6660079
PAT306       101572     43643209
PAT307       51814      126601062
PAT308       39634      58321734
PAT309       33784      76649820
PAT31        97924      79759401
PAT310       36090      65665515
PAT311       38048      57768129
PAT312       37900      58196919
PAT313       99342      26067885
PAT314       145180     2177700
PAT315       29996      449940
PAT316       87991      80740060
PAT317       146168     18768506
PAT318       78920      69381317
PAT319       37974      57915705
PAT32        129222     55157158
PAT320       38350      61112358
PAT321       95684      39955404
PAT322       128898     30032405
PAT323       147531     2212965
PAT324       147405     2211075
PAT325       61561      923415
PAT326       143736     3286924
PAT327       134802     7478438
PAT328       45229      66228994
PAT329       53339      67823092
PAT33        88475      49384193
PAT330       110808     53972653
PAT331       108085     52941093
PAT332       99780      61002604
PAT333       138521     78058321
PAT334       117039     68439950
PAT335       125021     117957949
PAT336       143634     112415153
PAT337       224958     64914941
PAT338       57667      157394106
PAT339       134802     117013401
PAT34        118746     69220727
PAT340       57864      22602034
PAT341       171927     100348534
PAT342       104171     134672556
PAT343       12657      190387423
PAT344       175728     100939207
PAT345       55411      164411867
PAT346       199913     51235471
PAT347       4875       1141417
PAT35        120171     36360252
PAT36        122826     44471256
PAT37        94731      87320649
PAT38        150579     21220175
PAT39        147076     34854574
PAT4         156009     106307232
PAT40        110908     55377500
PAT41        33841      36793621
PAT42        96351      83600457
PAT43        99709      72323829
PAT44        138998     37627662
PAT45        143760     37193283
PAT46        125072     64720399
PAT47        100399     86321912
PAT48        99428      68548842
PAT49        111862     67345341
PAT5         50117      20254923
PAT50        60374      52824381
PAT51        136399     108802801
PAT52        168265     98178509
PAT53        119298     126920074
PAT54        201754     75944942
PAT55        69600      127456544
PAT56        27795      181082835
PAT57        189418     92960765
PAT58        277142     6928550
PAT59        122390     31451008
PAT6         171986     92903236
PAT60        162935     78473973
PAT61        92866      90598985
PAT62        109252     73717992
PAT63        123341     64227958
PAT64        62041      29215516
PAT65        70923      110313258
PAT66        88692      82810627
PAT67        93124      79739812
PAT68        94118      72274536
PAT69        94231      74769308
PAT7         157678     87491415
PAT70        118843     59763989
PAT71        96798      9793333
PAT72        177635     10656487
PAT73        173172     10978133
PAT74        173161     10971226
PAT75        94832      96316584
PAT76        101        195797548
PAT77        66         196768687
PAT78        104        196327400
PAT79        12309      182633014
PAT8         127568     101540131
PAT80        86423      5090841
PAT81        152298     9718010
PAT82        152308     9704500
PAT83        152313     9703390
PAT84        152308     9704292
PAT85        95141      89656500
PAT86        93068      93878198
PAT87        31086      33386746
PAT88        83471      94698793
PAT89        16515      179586111
PAT9         134747     98544086
PAT90        167160     18622183
PAT91        180755     3434345
PAT92        179225     3405275
PAT93        177411     3370809
PAT94        92464      1756816
PAT95        170988     12446769
PAT96        180501     3429519
PAT97        180495     3429405
PAT98        180484     3429196
PAT99        133550     2537450
PHG1         5859       106394975
PHG2         3086       109230982
PHG3         2185       109534648
PHG4         3040       112463555
PHG5         1998       75662282
PLN1         60430      94035730
PLN10        60849      60897416
PLN100       1          159154999
PLN101       20         194050548
PLN102       53         27139301
PLN103       37         16871
PLN104       149        79314
PLN105       2469       93786416
PLN106       7181       18795412
PLN107       14346      29953091
PLN108       19349      134328320
PLN109       78609      75184715
PLN11        72063      77517591
PLN110       98944      57606114
PLN111       30233      32283710
PLN112       81002      72164576
PLN113       78272      76457394
PLN114       80722      70938653
PLN115       82134      75992095
PLN116       57133      30584338
PLN117       99617      56065050
PLN118       82026      69872922
PLN119       46490      98369139
PLN12        39652      50608365
PLN120       3127       156816045
PLN121       11877      162780335
PLN122       29625      121156167
PLN123       56641      101051513
PLN124       14751      10044679
PLN125       81693      72884859
PLN126       16813      12495184
PLN127       49499      72634246
PLN128       25061      110565816
PLN129       13564      89766260
PLN13        39364      63980764
PLN130       1          774434471
PLN131       8305       28494037
PLN132       1858       148969943
PLN133       2          135217911
PLN134       2          155188403
PLN135       2          140023111
PLN136       2          154604167
PLN137       2          148753627
PLN138       3          173772618
PLN139       3          178836778
PLN14        24732      121021270
PLN140       3          176344173
PLN141       3          195539469
PLN142       12431      129466187
PLN143       82777      66160125
PLN144       94000      58020437
PLN145       20377      14690416
PLN146       78042      71612032
PLN147       70796      84949268
PLN148       77794      68066865
PLN149       71873      77260027
PLN15        21745      106564214
PLN150       80671      67002690
PLN151       4097       3780693
PLN152       78820      64033424
PLN153       75376      68567978
PLN154       82654      59020966
PLN155       81725      59641412
PLN156       22197      25376747
PLN157       74543      63577219
PLN158       72520      71630441
PLN159       63524      85255974
PLN16        17587      144956899
PLN160       57480      66239016
PLN161       92610      52869556
PLN162       75032      68687056
PLN163       72009      68791493
PLN164       41612      49865583
PLN165       71254      71615346
PLN166       62622      78942291
PLN167       62813      82490554
PLN168       38107      36715132
PLN169       70684      73051030
PLN17        17646      146317509
PLN170       65426      77025034
PLN171       66130      78943095
PLN172       59753      85456642
PLN173       61558      83863298
PLN174       59993      81658145
PLN175       15927      13713706
PLN176       59552      86096122
PLN177       63530      78172571
PLN178       54451      89737988
PLN179       60721      81628720
PLN18        17565      146440300
PLN180       53629      93945694
PLN181       17453      39639360
PLN182       52587      95793772
PLN183       66224      77373323
PLN184       55360      91838393
PLN185       11607      124593854
PLN186       737        192478399
PLN187       7301       185474831
PLN188       11587      5085557
PLN189       12512      154597097
PLN19        1356       10854690
PLN190       6          176139136
PLN191       15396      110851560
PLN192       3          160562296
PLN193       5          157173652
PLN194       297        157902279
PLN195       2          129164442
PLN196       3          176494449
PLN197       4492       178381667
PLN198       11417      3828683
PLN199       5636       1862075
PLN2         75073      78287428
PLN20        23249      121281083
PLN200       5175       2446256
PLN201       1          563502314
PLN202       1438       4114563
PLN203       1          594102056
PLN204       1          689851870
PLN205       1          495453186
PLN206       1          780798557
PLN207       1          801256715
PLN208       1          651852609
PLN209       1          750843639
PLN21        6083       151149287
PLN210       1          830829764
PLN211       1          615552423
PLN212       1          744588157
PLN213       1          673617499
PLN214       1          509857067
PLN215       1          709773743
PLN216       1          713149757
PLN217       1          566080677
PLN218       1          618079260
PLN219       1          720988478
PLN22        1184       166859751
PLN220       1          473592718
PLN221       1          736706236
PLN222       1          750620385
PLN223       1          638686055
PLN224       1          480980714
PLN225       6462       137830899
PLN226       6          175176296
PLN227       3467       169224961
PLN228       5          181542723
PLN229       7128       175664046
PLN23        1489       166869994
PLN230       2460       152220512
PLN231       13632      18683704
PLN232       47117      101364479
PLN233       42161      32590280
PLN234       50482      96050785
PLN235       52851      84126108
PLN236       40680      109856328
PLN237       45675      99282363
PLN238       53425      91560832
PLN239       55531      90241630
PLN24        34         166031187
PLN240       62631      80279846
PLN241       6948       16528411
PLN25        6          165567871
PLN26        47         169734561
PLN27        4          173777832
PLN28        4          146720977
PLN29        22012      115499920
PLN3         37482      104676156
PLN30        67654      70403472
PLN31        28895      30917601
PLN32        77526      76704792
PLN33        35684      40640112
PLN34        57311      72144648
PLN35        28689      28923180
PLN36        2644       102424035
PLN37        3          73585790
PLN38        30         105815221
PLN39        282        133858659
PLN4         1377       179289704
PLN40        99         129632256
PLN41        285        131701927
PLN42        157        130226554
PLN43        90         71965224
PLN44        157        128672551
PLN45        141        130200994
PLN46        173        129439941
PLN47        166        136053947
PLN48        211        155822577
PLN49        273        194773389
PLN5         1847       186205115
PLN50        113        80920130
PLN51        273        194661068
PLN52        182        184910473
PLN53        121        183815870
PLN54        5          168777512
PLN55        24         192004664
PLN56        68         76006381
PLN57        71         185395548
PLN58        28         139366021
PLN59        5          169521320
PLN6         1848       194317037
PLN60        12         191290805
PLN61        105        184590114
PLN62        128        90595192
PLN63        121        187155874
PLN64        28         162873013
PLN65        6          172580596
PLN66        8          194011608
PLN67        18         125365975
PLN68        4          158605168
PLN69        2          153895754
PLN7         1688       194359494
PLN70        2          137270873
PLN71        3          183683931
PLN72        1          65870126
PLN73        3          194329459
PLN74        67         164410839
PLN75        6          173247950
PLN76        8          177302113
PLN77        3          179919031
PLN78        6          186064150
PLN79        7          192206952
PLN8         1832       193371372
PLN80        53         182366011
PLN81        9          181884660
PLN82        6          51253148
PLN83        74         124609184
PLN84        6          115354966
PLN85        1          99791824
PLN86        1          143206517
PLN87        1          122064722
PLN88        1          116166884
PLN89        2          192382203
PLN9         36732      126683170
PLN90        2          173014123
PLN91        1          114519869
PLN92        1          149379573
PLN93        1          122213787
PLN94        1          150766190
PLN95        1          135085854
PLN96        1          153119099
PLN97        1          153789061
PLN98        1          132998879
PLN99        1          136776503
PRI1         23034      59762327
PRI10        1253       178780857
PRI11        860        104346432
PRI12        1278       179183454
PRI13        1451       177770436
PRI14        1589       180081042
PRI15        1591       181937113
PRI16        1285       191661798
PRI17        1137       193659098
PRI18        1098       194127649
PRI19        1166       193677094
PRI2         22396      144974332
PRI20        1737       191814810
PRI21        2631       189865971
PRI22        2079       192522927
PRI23        1206       195380396
PRI24        16435      131832845
PRI25        27929      79132146
PRI26        59941      84370864
PRI27        36109      81894692
PRI28        8761       172362823
PRI29        2264       191585097
PRI3         1438       174353221
PRI30        1666       190931151
PRI31        2074       192118866
PRI32        2196       191069594
PRI33        13104      162575570
PRI34        2098       170891945
PRI35        57042      89264943
PRI36        3822       7514956
PRI37        33757      66539295
PRI38        19385      127316933
PRI39        20385      148361481
PRI4         1278       185868863
PRI40        67595      84503661
PRI41        51513      91819732
PRI42        39007      74536349
PRI43        47895      96565841
PRI44        26429      103374244
PRI45        29288      110627209
PRI46        25134      104927029
PRI47        29535      101884999
PRI48        5091       42452873
PRI49        39438      104763028
PRI5         1335       184501516
PRI50        29647      110104156
PRI51        28973      104325280
PRI52        58397      36350257
PRI53        1          229594237
PRI54        1          190673448
PRI55        1          197221778
PRI56        11798      169046195
PRI57        16614      111265289
PRI58        48738      93286108
PRI59        19473      46806129
PRI6         1179       179994692
PRI7         1229       180208989
PRI8         1221       179042773
PRI9         1372       174851936
ROD1         37508      133642525
ROD10        989        182010602
ROD11        307        58052732
ROD12        1034       185475616
ROD13        941        182878681
ROD14        1040       189304693
ROD15        950        180388993
ROD16        967        181966557
ROD17        991        185834465
ROD18        1190       190611728
ROD19        15160      158960227
ROD2         908        176070435
ROD20        20997      153967043
ROD21        1216       193771265
ROD22        1003       157974000
ROD23        15427      168555476
ROD24        38040      70157256
ROD25        19436      118416539
ROD26        2223       191929834
ROD27        152502     18066421
ROD28        75874      79373592
ROD29        84596      53047727
ROD3         910        173108361
ROD30        67214      74440297
ROD31        12105      14596350
ROD4         900        173849398
ROD5         919        174488736
ROD6         965        177341176
ROD7         974        179555511
ROD8         969        181372318
ROD9         1001       181665338
STS1         85559      36896329
STS10        58083      44552041
STS11        48085      36873197
STS12        58099      43769473
STS13        64422      42856172
STS14        93857      34186170
STS15        104888     26688384
STS16        8950       2430284
STS17        104293     27679407
STS18        97854      33659726
STS19        97350      34711104
STS2         85035      49980125
STS20        69728      24763077
STS3         66345      26281661
STS4         77125      37068775
STS5         8191       4810172
STS6         54412      31740785
STS7         54312      31932091
STS8         54469      32048894
STS9         55909      37990705
SYN1         53007      72626271
SYN10        23056      67340669
SYN2         43719      81283746
SYN3         23884      125660539
SYN4         4595       176500394
SYN5         4589       176406940
SYN6         4594       176464751
SYN7         10887      162216489
SYN8         57278      74506570
SYN9         52655      84695185
TSA1         119867     38078881
TSA10        15758      19457445
TSA100       84628      38647321
TSA101       76860      53168945
TSA102       66230      68312035
TSA103       64656      75546157
TSA104       88788      55755865
TSA105       48310      25539654
TSA106       74550      86726411
TSA107       80730      75604381
TSA108       85476      72848266
TSA109       77395      84130963
TSA11        134601     34776357
TSA110       95638      51743388
TSA111       98570      70636110
TSA112       57559      94588287
TSA113       109914     49593061
TSA114       63990      68743424
TSA115       81365      89244404
TSA116       70499      72924750
TSA117       57287      120842146
TSA118       3695       3395000
TSA119       107244     68283732
TSA12        59950      20118999
TSA120       93864      83831193
TSA121       99424      76800693
TSA122       86215      66900549
TSA123       85137      59406979
TSA124       78341      62345274
TSA125       82329      77771081
TSA126       99805      59600144
TSA127       94858      42440076
TSA128       75839      55282740
TSA129       40596      38103163
TSA13        64437      60230317
TSA130       59842      61355677
TSA131       59222      61956330
TSA132       59447      62201688
TSA133       72514      79237539
TSA134       88241      50637266
TSA135       63416      65296736
TSA136       832        252551
TSA137       78109      34727398
TSA138       74879      67607515
TSA139       81463      78932809
TSA14        93892      60774882
TSA140       75039      64606512
TSA141       40597      33646913
TSA142       87917      70744689
TSA143       89637      68264227
TSA144       84723      77981171
TSA145       77299      81247994
TSA146       10512      8596527
TSA147       104870     53942459
TSA148       80798      61849074
TSA149       70740      78279664
TSA15        91383      65106730
TSA150       72679      69631207
TSA151       88473      74137515
TSA152       89286      71316634
TSA153       63435      101784529
TSA154       95798      75256889
TSA155       17016      11871471
TSA156       83362      63896652
TSA157       83862      64153636
TSA158       79385      73616320
TSA159       77070      76639823
TSA16        6713       3516114
TSA160       93994      58998624
TSA161       101042     66808521
TSA162       33299      23300565
TSA163       102259     63715273
TSA164       94026      74723592
TSA165       80955      64132522
TSA166       32032      49058197
TSA167       51993      98573117
TSA168       46992      108059536
TSA169       45060      111729686
TSA17        76328      86345063
TSA170       42052      117437639
TSA171       39600      122092043
TSA172       37741      125627862
TSA173       30097      107288374
TSA174       79278      65831927
TSA175       61766      78801121
TSA176       65943      56757743
TSA177       40135      19854948
TSA178       38520      26931630
TSA179       35906      38483420
TSA18        79571      72873999
TSA180       33719      32835987
TSA181       31723      56974521
TSA182       31529      57827756
TSA183       39360      23153642
TSA184       40480      18197417
TSA185       41160      15188692
TSA186       41560      13420160
TSA187       41798      12369266
TSA188       25925      7379156
TSA189       41988      11531997
TSA19        87122      45676818
TSA190       42033      11331256
TSA191       42081      11121330
TSA192       42155      10791502
TSA193       42199      10594518
TSA194       42246      10386471
TSA195       44469      10970414
TSA196       89574      35651580
TSA197       85248      64327814
TSA198       71514      85727361
TSA199       104370     34591482
TSA2         113513     41575102
TSA20        74112      88789066
TSA200       79480      68069082
TSA201       46133      105547678
TSA202       89741      47774789
TSA203       47189      118699045
TSA204       87176      55356978
TSA205       79486      69671475
TSA206       52801      112476082
TSA207       44638      125583658
TSA208       38073      136130006
TSA209       61544      98133552
TSA21        65190      48723008
TSA210       12102      5800279
TSA211       58652      100603319
TSA212       75646      71894803
TSA213       50457      112947945
TSA214       77365      67441564
TSA215       53726      106980439
TSA216       75926      70339630
TSA217       59610      97707887
TSA218       61369      69985665
TSA219       74428      72821943
TSA22        81439      82281132
TSA220       87323      50951603
TSA221       50899      111127179
TSA222       71562      76448065
TSA223       62951      91534461
TSA224       85139      53774514
TSA225       83387      56083879
TSA226       10763      4953843
TSA227       64419      91116089
TSA228       71926      77423316
TSA229       70933      78656816
TSA23        63006      84596593
TSA230       88398      46498714
TSA231       63160      89037236
TSA232       93507      36784395
TSA233       65147      85307235
TSA234       57907      35845393
TSA24        83441      73829683
TSA25        100156     54463119
TSA26        63313      19251387
TSA27        86234      70407370
TSA28        121324     38862791
TSA29        135063     35310894
TSA3         110421     41064860
TSA30        51855      68718843
TSA31        47829      62910692
TSA32        1549       2253596
TSA33        61314      82147786
TSA34        93472      67491932
TSA35        110655     50015529
TSA36        106345     50201806
TSA37        102307     54388700
TSA38        103560     49787675
TSA39        22637      12494687
TSA4         112137     47720377
TSA40        66642      59388549
TSA41        92820      68251805
TSA42        93446      62442749
TSA43        79794      86536802
TSA44        100835     49268702
TSA45        114271     34482783
TSA46        94903      69055916
TSA47        10363      5895735
TSA48        94696      35577587
TSA49        78213      36138263
TSA5         74536      22525878
TSA50        106962     43690670
TSA51        114967     46107338
TSA52        26890      19148939
TSA53        104334     51655152
TSA54        101776     54365987
TSA55        97582      60662772
TSA56        82228      86008299
TSA57        67802      29059764
TSA58        90828      71678131
TSA59        97915      54906712
TSA6         112164     59299839
TSA60        60403      105707789
TSA61        86731      65967022
TSA62        79360      70616777
TSA63        83856      71990209
TSA64        82738      73073597
TSA65        66555      88126792
TSA66        91172      67099618
TSA67        76182      84986777
TSA68        72161      72968018
TSA69        69246      61199847
TSA7         87942      58097196
TSA70        85711      78567288
TSA71        85092      79423958
TSA72        68092      94854440
TSA73        86359      70218089
TSA74        85532      52029253
TSA75        103092     68803181
TSA76        87069      60219812
TSA77        103531     57122474
TSA78        75996      72532642
TSA79        74667      42478724
TSA8         105281     73053535
TSA80        88020      79406904
TSA81        91816      69554168
TSA82        78643      53628715
TSA83        78975      56799054
TSA84        97227      61708495
TSA85        37388      33674257
TSA86        89459      77100280
TSA87        95713      55692877
TSA88        111184     45067626
TSA89        97283      59077752
TSA9         110108     61261039
TSA90        65710      96700007
TSA91        13351      13164463
TSA92        101868     55796774
TSA93        91582      53917306
TSA94        94202      43888098
TSA95        85593      75399941
TSA96        73247      71810899
TSA97        38585      45011146
TSA98        77356      80756171
TSA99        77829      55237291
UNA1         450        309853
VRL1         65928      72165176
VRL10        43874      73777710
VRL11        42987      73674638
VRL12        53124      72145461
VRL13        64011      72716151
VRL14        68177      69373746
VRL15        56173      74391661
VRL16        7321       8871573
VRL17        63262      72358493
VRL18        58768      73113281
VRL19        64057      65683580
VRL2         67716      67388323
VRL20        57710      74258842
VRL21        49009      61662069
VRL22        55437      73620045
VRL23        59327      72335264
VRL24        56531      74698785
VRL25        57040      73714220
VRL26        24638      42803154
VRL27        52772      76296133
VRL28        38626      83182550
VRL29        48754      75794979
VRL3         71702      63951559
VRL30        49294      74967643
VRL31        48024      79712726
VRL32        10963      18040117
VRL33        50270      78880148
VRL34        42966      88016098
VRL35        42101      84343657
VRL36        49247      80557372
VRL37        37718      88618291
VRL38        14560      29533366
VRL39        36700      91276993
VRL4         57619      86946894
VRL40        46974      82382585
VRL41        46777      78228535
VRL42        40345      89647380
VRL43        47888      81349978
VRL44        18187      34658133
VRL45        43369      82480816
VRL46        40032      86705528
VRL47        45144      79882675
VRL48        38237      88436050
VRL49        38396      90778265
VRL5         70203      69586704
VRL50        7083       10982987
VRL51        52231      82507535
VRL52        39320      98789078
VRL53        32918      101581839
VRL54        41798      90507613
VRL55        35273      97376364
VRL56        32944      90318606
VRL57        40903      84741331
VRL58        42410      84673939
VRL59        43236      50193862
VRL6         25276      31496722
VRL7         48737      77996724
VRL8         47056      72916124
VRL9         44223      72168763
VRT1         68593      78941459
VRT10        18698      27611025
VRT11        4665       186998242
VRT12        1320       193372782
VRT13        1392       193166295
VRT14        1972       24043127
VRT15        4685       4674270
VRT16        1171       26255719
VRT17        293        13983146
VRT18        30         172800274
VRT19        6          188303802
VRT2         1261       194022973
VRT20        6          193561301
VRT21        7          192869947
VRT22        5          167414846
VRT23        6          185887951
VRT24        6          190195176
VRT25        7          190542399
VRT26        6          184497247
VRT27        6          170891080
VRT28        7          196676012
VRT29        7          181307350
VRT3         48994      120858763
VRT30        6          164644620
VRT31        7          169411889
VRT32        34         138817921
VRT33        147        10842596
VRT34        586        15797052
VRT35        2343       67436863
VRT36        13371      172470823
VRT37        5827       185181355
VRT38        3801       188841871
VRT39        50361      115902437
VRT4         23844      150842167
VRT40        80331      70127280
VRT41        78385      67152309
VRT42        17783      13201283
VRT43        71765      78195705
VRT44        45944      122554621
VRT45        78114      64103054
VRT46        80229      62708585
VRT47        82796      58679429
VRT48        31681      22113431
VRT49        103616     66610713
VRT5         39386      102500565
VRT50        82164      57051052
VRT51        86543      59133365
VRT52        60365      45220549
VRT53        91423      54873994
VRT54        76794      58473713
VRT55        6590       5643560
VRT56        75734      59253585
VRT57        56125      45407557
VRT58        81766      57668976
VRT59        76171      60091221
VRT6         73313      67136087
VRT60        79036      60773352
VRT61        56509      22455877
VRT62        110419     53377901
VRT63        78156      66494321
VRT64        94261      54761808
VRT65        7578       5362875
VRT66        82624      56027061
VRT67        75896      63019914
VRT68        81778      58496551
VRT69        40117      127551602
VRT7         1631       3490698
VRT70        42         184527474
VRT71        102        182751359
VRT72        130        193761317
VRT73        296        192673693
VRT74        591        194013929
VRT75        1884       192119838
VRT76        34145      162025537
VRT77        58561      17275932
VRT78        145106     21008965
VRT79        75789      25336814
VRT8         32091      64261206
VRT80        13364      176952840
VRT81        11         188688279
VRT82        8          183427060
VRT83        12         195920558
VRT84        10         189393119
VRT85        243        196418294
VRT86        327        196217075
VRT87        2638       194315601
VRT88        2441       194492035
VRT89        10435      174494642
VRT9         5305       9780086
VRT90        9          179667620
VRT91        9          163877519
VRT92        14414      151530911
VRT93        67279      71460016
VRT94        73313      60124532
VRT95        4321       4092731

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 229.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

26645546 19802022088   Homo sapiens
1936684  17185251457   Triticum aestivum
9899956  10247691343   Mus musculus
2199664   6530192494   Rattus norvegicus
2233280   5432870920   Bos taurus
4211231   5249062571   Zea mays
3301861   5076479032   Sus scrofa
128190    3430042041   Escherichia coli
1346987   3237333494   Hordeum vulgare subsp. vulgare
1729703   3191533511   Danio rerio
1239330   2836978291   Oryzias latipes
311598    2682437651   Arachis hypogaea
72        2590574434   Ovis canadensis canadensis
746873    2572428689   Solanum lycopersicum
111       2290221631   Bos mutus
205561    1836765903   Cyprinus carpio
1379176   1727281422   Oryza sativa Japonica Group
13163     1619329411   Klebsiella pneumoniae
327068    1595510956   Apteryx australis mantelli
1667      1497713559   Bordetella pertussis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (net decrease; Section 1.3.1 of GB 227.0 release notes)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          December 15 2018

                NCBI-GenBank Flat File Release 229.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Benson, D. et al, Nucleic Acids Res. 45(D1):D37-D42 (2017)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Jim Ostell, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell : Director, NCBI
	Kim Pruitt : Acting Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center