Release Notes For GenBank Release 230

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2019

               NCBI-GenBank Flat File Release 230.0

                    Distribution Release Notes

 212260377 loci, 303709510632 bases, from 212260377 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 230.0
1.2 Cutoff Date
1.3 Important Changes in Release 230.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 230.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 230.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 230.0, incorporates data processed by the INSDC databases
as of Sunday February 17 2019 at approximately 1:33AM EST. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 230.0

1.3.1 Organizational changes

1.3.1.a Large decrease in the number of sequence files

  The number of sequence files for GenBank 230.0 has decreased significantly,
from 3,287 files to 2,272 files.

  This has occurred due to changes in how EST and GSS records are stored at
NCBI, which has impacts for both Entrez and for GenBank Release file
organization. For information about the Entrez impacts, please see:

https://ncbiinsights.ncbi.nlm.nih.gov/2018/07/30/upcoming-changes-est-gss-databases/

  The GenBank Release files are impacted because we increased the targeted
uncompressed file size for *all* of the sequence data files to 500MB, to match
the target used by EST and GSS for many years.

  The overall effect is that this release has fewer files, and each file is
larger than before. For example, there were 566 BCT-division GenBank flatfiles
for GenBank 229.0, most of which were about 250MB (uncompressed). For GenBank
230.0 the number of BCT files is 324, most of which are about 500MB
(uncompressed).

  However, there were two issues that caused a net *increase* in the number of
files for the SYN and EST divisions.

  A Jan 2019 submission of 57 synthetic chromosomal constructs ranging from
35Mbp to 271Mbp nearly tripled the number of SYN files. Unfortunately, the
size of these records limits some SYN files to only 1 to 4 records apiece.
The gbsyn2.seq data file is a good example, containing just this record:

LOCUS       CP034487           271050050 bp    DNA     linear   SYN 08-JAN-2019
DEFINITION  Eukaryotic synthetic construct chromosome 1.
ACCESSION   CP034487
VERSION     CP034487.1
DBLINK      BioProject: PRJNA504496
            BioSample: SAMN10411725
KEYWORDS    .
SOURCE      eukaryotic synthetic construct
  ORGANISM  eukaryotic synthetic construct
            other sequences; artificial sequences.
REFERENCE   1  (bases 1 to 271050050)
  AUTHORS   Fu,S., Wang,A. and Au,K.F.
  TITLE     A comparative evaluation of hybrid error correction methods for
            error-prone long reads
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 271050050)
  AUTHORS   Fu,S., Wang,A. and Au,K.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2018) Internal medicine, University of Iowa, 285
            Newton Road, Iowa City, IA 52242, USA
COMMENT     This genome was generated by simulation. We randomly generated a
            set of SNPs and modified the human hg38 reference genome. We used
            the the simulated genome to test the performance of error
            correction tools on  heterozygous sequences.

  For the EST division, in spite of attempting to achieve 500MB uncompressed
per file, 93 of the gbest*.seq files are less than half of that target size.
Some of the files are dramatically less, such as gbest302.seq at only 5MB.
So ironically, the number of EST division files has increased from 489 to 574
for GenBank 230.0 . We will work to address EST file-size uniformity problem
in future releases.

  Note: The uncompressed file-size target for GenBank flatfiles is periodically
increased due to database growth. It is likely that the target will increase
to 750MB within the next year or two.

1.3.1.b Division-specific changes in number of sequence files

The total number of sequence data files decreased by 1,015 with this release:

  - the BCT division is now composed of 324 files (-242)
  - the CON division is now composed of 205 files (-170)
  - the ENV division is now composed of  57 files (-48)
  - the EST division is now composed of 574 files (+85)
  - the GSS division is now composed of 268 files (-40)
  - the HTC division is now composed of   8 files (-7)
  - the HTG division is now composed of  82 files (-73)
  - the INV division is now composed of  68 files (-49)
  - the MAM division is now composed of  32 files (-23)
  - the PAT division is now composed of 193 files (-154)
  - the PHG division is now composed of   3 files (-2)
  - the PLN division is now composed of 143 files (-98)
  - the PRI division is now composed of  33 files (-26)
  - the ROD division is now composed of  17 files (-14)
  - the STS division is now composed of  11 files (-9)
  - the SYN division is now composed of  27 files (+17)
  - the TSA division is now composed of 127 files (-107)
  - the VRL division is now composed of  32 files (-27)
  - the VRT division is now composed of  67 files (-28)

1.3.2 Expanded accession number formats now in use for WGS projects

  As of the February 2019 GenBank 230.0 release, several of the
long-planned expanded accession number formats are in use for
sequences in some WGS projects.

  Previously, the accession format used for Whole Genome Shotgun (WGS),
Transcriptome Shotgun Assembly (TSA), and Targeted Locus Study (TLS)
sequencing projects consisted of a four-letter Project Code prefix,
a two-digit Assembly-Version number, followed by 6, 7, or 8 digits
(depending on the number of sequences in the project).

  This format has been expanded to a six-letter Project Code prefix,
two-digit Assembly-Version number, followed by 7, 8, or 9 digits.

  Protein sequences have made use of a "3+5" accession format, consisting
of a three-letter prefix followed by five digits. This format has been
expanded to make use of seven digits, allowing exhausted protein accession
ranges such as EAA00001-EZZ99999 to be re-opened, as EAA0000001-EZZ9999999.
  
  Project AAAABB provides a good example of both of these changes:

LOCUS       AAAABB010000001       100500 bp    DNA     linear   BCT 30-JAN-2019
DEFINITION  Clostridioides difficile isolate CD24
            SAMN10715316-rid7006163.denovo.001, whole genome shotgun sequence.
ACCESSION   AAAABB010000001 AAAABB010000000
VERSION     AAAABB010000001.1
DBLINK      BioProject: PRJNA278886
            BioSample: SAMN10715316
            Sequence Read Archive: SRR8419280
KEYWORDS    WGS; GMI.
....
     CDS             39..485
                     /gene="lspA"
                     /locus_tag="EPE87_00005"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001089114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="EAA0000001.1"
                     /translation="MLYILIIILLIGLDQLSKIWVLNNLVDVSTIPIINNVFHLTYVE
                     NRGAAFGLLQNNQWIFIIVALLATVFGLYYLNTRKVHIFGRLGIILIISGALGNLVDR
                     VRLGFVVDYFDFRVIWEYVFNVADVFVVVGTVFLCIYVLFFESKSR"

  Accession numbers in the old formats will continue to be assigned
for some classes of GenBank submissions, until the available 4-letter
project code prefixes and the available 3+5 protein accession ranges
have been exhausted.

  Non-WGS/TLS/TSA nucleotide sequences currently make use of a "2+6"
accession format, consisting of a two-letter prefix followed by six digits.
This format will be expanded to make use of eight digits, allowing accession
ranges that have been exhausted (eg: JG000001-JG999999) to be "re-opened"
(eg: JG00000001-JG99999999). No nucleotide sequence records have yet been
assigned a "2+8" accession number, but this will certainly occur within
the next few months.

1.3.3 GSS File Header Problem : Resolved

  GSS sequences at GenBank used to be maintained in two different systems,
depending on their origin. This caused a discrepancy between the filenames
and file headers of 130 GSS flatfiles, because the dumps from each system
did not know how many files were being dumped by the other. For example,
the header for gbgss179.seq in GenBank 229.0 was:

GBGSS1.SEQ          Genetic Sequence Data Bank
                        December 15 2018

                NCBI-GenBank Flat File Release 229.0

                           GSS Sequences (Part 1)

   87375 loci,    64103840 bases, from    87375 reported sequences

  The filename and part number in the header was "1", though the file
had been renamed as "179" based on the number of files dumped from the
other system. Files gbgss179.seq.gz through gbgss308.seq.gz were affected
in GenBank 229.0 . However, as of GenBank 230.0, GSS sequences are
stored in a single system at NCBI, so this file header problem no longer
occurs.

1.4 Upcoming Changes

  No GenBank release changes are planned for the next four months.
  
1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2276 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct33.seq - Bacterial sequence entries, part 33.
253. gbbct34.seq - Bacterial sequence entries, part 34.
254. gbbct35.seq - Bacterial sequence entries, part 35.
255. gbbct36.seq - Bacterial sequence entries, part 36.
256. gbbct37.seq - Bacterial sequence entries, part 37.
257. gbbct38.seq - Bacterial sequence entries, part 38.
258. gbbct39.seq - Bacterial sequence entries, part 39.
259. gbbct4.seq - Bacterial sequence entries, part 4.
260. gbbct40.seq - Bacterial sequence entries, part 40.
261. gbbct41.seq - Bacterial sequence entries, part 41.
262. gbbct42.seq - Bacterial sequence entries, part 42.
263. gbbct43.seq - Bacterial sequence entries, part 43.
264. gbbct44.seq - Bacterial sequence entries, part 44.
265. gbbct45.seq - Bacterial sequence entries, part 45.
266. gbbct46.seq - Bacterial sequence entries, part 46.
267. gbbct47.seq - Bacterial sequence entries, part 47.
268. gbbct48.seq - Bacterial sequence entries, part 48.
269. gbbct49.seq - Bacterial sequence entries, part 49.
270. gbbct5.seq - Bacterial sequence entries, part 5.
271. gbbct50.seq - Bacterial sequence entries, part 50.
272. gbbct51.seq - Bacterial sequence entries, part 51.
273. gbbct52.seq - Bacterial sequence entries, part 52.
274. gbbct53.seq - Bacterial sequence entries, part 53.
275. gbbct54.seq - Bacterial sequence entries, part 54.
276. gbbct55.seq - Bacterial sequence entries, part 55.
277. gbbct56.seq - Bacterial sequence entries, part 56.
278. gbbct57.seq - Bacterial sequence entries, part 57.
279. gbbct58.seq - Bacterial sequence entries, part 58.
280. gbbct59.seq - Bacterial sequence entries, part 59.
281. gbbct6.seq - Bacterial sequence entries, part 6.
282. gbbct60.seq - Bacterial sequence entries, part 60.
283. gbbct61.seq - Bacterial sequence entries, part 61.
284. gbbct62.seq - Bacterial sequence entries, part 62.
285. gbbct63.seq - Bacterial sequence entries, part 63.
286. gbbct64.seq - Bacterial sequence entries, part 64.
287. gbbct65.seq - Bacterial sequence entries, part 65.
288. gbbct66.seq - Bacterial sequence entries, part 66.
289. gbbct67.seq - Bacterial sequence entries, part 67.
290. gbbct68.seq - Bacterial sequence entries, part 68.
291. gbbct69.seq - Bacterial sequence entries, part 69.
292. gbbct7.seq - Bacterial sequence entries, part 7.
293. gbbct70.seq - Bacterial sequence entries, part 70.
294. gbbct71.seq - Bacterial sequence entries, part 71.
295. gbbct72.seq - Bacterial sequence entries, part 72.
296. gbbct73.seq - Bacterial sequence entries, part 73.
297. gbbct74.seq - Bacterial sequence entries, part 74.
298. gbbct75.seq - Bacterial sequence entries, part 75.
299. gbbct76.seq - Bacterial sequence entries, part 76.
300. gbbct77.seq - Bacterial sequence entries, part 77.
301. gbbct78.seq - Bacterial sequence entries, part 78.
302. gbbct79.seq - Bacterial sequence entries, part 79.
303. gbbct8.seq - Bacterial sequence entries, part 8.
304. gbbct80.seq - Bacterial sequence entries, part 80.
305. gbbct81.seq - Bacterial sequence entries, part 81.
306. gbbct82.seq - Bacterial sequence entries, part 82.
307. gbbct83.seq - Bacterial sequence entries, part 83.
308. gbbct84.seq - Bacterial sequence entries, part 84.
309. gbbct85.seq - Bacterial sequence entries, part 85.
310. gbbct86.seq - Bacterial sequence entries, part 86.
311. gbbct87.seq - Bacterial sequence entries, part 87.
312. gbbct88.seq - Bacterial sequence entries, part 88.
313. gbbct89.seq - Bacterial sequence entries, part 89.
314. gbbct9.seq - Bacterial sequence entries, part 9.
315. gbbct90.seq - Bacterial sequence entries, part 90.
316. gbbct91.seq - Bacterial sequence entries, part 91.
317. gbbct92.seq - Bacterial sequence entries, part 92.
318. gbbct93.seq - Bacterial sequence entries, part 93.
319. gbbct94.seq - Bacterial sequence entries, part 94.
320. gbbct95.seq - Bacterial sequence entries, part 95.
321. gbbct96.seq - Bacterial sequence entries, part 96.
322. gbbct97.seq - Bacterial sequence entries, part 97.
323. gbbct98.seq - Bacterial sequence entries, part 98.
324. gbbct99.seq - Bacterial sequence entries, part 99.
325. gbchg.txt - Accession numbers of entries updated since the previous release.
326. gbcon1.seq - Constructed sequence entries, part 1.
327. gbcon10.seq - Constructed sequence entries, part 10.
328. gbcon100.seq - Constructed sequence entries, part 100.
329. gbcon101.seq - Constructed sequence entries, part 101.
330. gbcon102.seq - Constructed sequence entries, part 102.
331. gbcon103.seq - Constructed sequence entries, part 103.
332. gbcon104.seq - Constructed sequence entries, part 104.
333. gbcon105.seq - Constructed sequence entries, part 105.
334. gbcon106.seq - Constructed sequence entries, part 106.
335. gbcon107.seq - Constructed sequence entries, part 107.
336. gbcon108.seq - Constructed sequence entries, part 108.
337. gbcon109.seq - Constructed sequence entries, part 109.
338. gbcon11.seq - Constructed sequence entries, part 11.
339. gbcon110.seq - Constructed sequence entries, part 110.
340. gbcon111.seq - Constructed sequence entries, part 111.
341. gbcon112.seq - Constructed sequence entries, part 112.
342. gbcon113.seq - Constructed sequence entries, part 113.
343. gbcon114.seq - Constructed sequence entries, part 114.
344. gbcon115.seq - Constructed sequence entries, part 115.
345. gbcon116.seq - Constructed sequence entries, part 116.
346. gbcon117.seq - Constructed sequence entries, part 117.
347. gbcon118.seq - Constructed sequence entries, part 118.
348. gbcon119.seq - Constructed sequence entries, part 119.
349. gbcon12.seq - Constructed sequence entries, part 12.
350. gbcon120.seq - Constructed sequence entries, part 120.
351. gbcon121.seq - Constructed sequence entries, part 121.
352. gbcon122.seq - Constructed sequence entries, part 122.
353. gbcon123.seq - Constructed sequence entries, part 123.
354. gbcon124.seq - Constructed sequence entries, part 124.
355. gbcon125.seq - Constructed sequence entries, part 125.
356. gbcon126.seq - Constructed sequence entries, part 126.
357. gbcon127.seq - Constructed sequence entries, part 127.
358. gbcon128.seq - Constructed sequence entries, part 128.
359. gbcon129.seq - Constructed sequence entries, part 129.
360. gbcon13.seq - Constructed sequence entries, part 13.
361. gbcon130.seq - Constructed sequence entries, part 130.
362. gbcon131.seq - Constructed sequence entries, part 131.
363. gbcon132.seq - Constructed sequence entries, part 132.
364. gbcon133.seq - Constructed sequence entries, part 133.
365. gbcon134.seq - Constructed sequence entries, part 134.
366. gbcon135.seq - Constructed sequence entries, part 135.
367. gbcon136.seq - Constructed sequence entries, part 136.
368. gbcon137.seq - Constructed sequence entries, part 137.
369. gbcon138.seq - Constructed sequence entries, part 138.
370. gbcon139.seq - Constructed sequence entries, part 139.
371. gbcon14.seq - Constructed sequence entries, part 14.
372. gbcon140.seq - Constructed sequence entries, part 140.
373. gbcon141.seq - Constructed sequence entries, part 141.
374. gbcon142.seq - Constructed sequence entries, part 142.
375. gbcon143.seq - Constructed sequence entries, part 143.
376. gbcon144.seq - Constructed sequence entries, part 144.
377. gbcon145.seq - Constructed sequence entries, part 145.
378. gbcon146.seq - Constructed sequence entries, part 146.
379. gbcon147.seq - Constructed sequence entries, part 147.
380. gbcon148.seq - Constructed sequence entries, part 148.
381. gbcon149.seq - Constructed sequence entries, part 149.
382. gbcon15.seq - Constructed sequence entries, part 15.
383. gbcon150.seq - Constructed sequence entries, part 150.
384. gbcon151.seq - Constructed sequence entries, part 151.
385. gbcon152.seq - Constructed sequence entries, part 152.
386. gbcon153.seq - Constructed sequence entries, part 153.
387. gbcon154.seq - Constructed sequence entries, part 154.
388. gbcon155.seq - Constructed sequence entries, part 155.
389. gbcon156.seq - Constructed sequence entries, part 156.
390. gbcon157.seq - Constructed sequence entries, part 157.
391. gbcon158.seq - Constructed sequence entries, part 158.
392. gbcon159.seq - Constructed sequence entries, part 159.
393. gbcon16.seq - Constructed sequence entries, part 16.
394. gbcon160.seq - Constructed sequence entries, part 160.
395. gbcon161.seq - Constructed sequence entries, part 161.
396. gbcon162.seq - Constructed sequence entries, part 162.
397. gbcon163.seq - Constructed sequence entries, part 163.
398. gbcon164.seq - Constructed sequence entries, part 164.
399. gbcon165.seq - Constructed sequence entries, part 165.
400. gbcon166.seq - Constructed sequence entries, part 166.
401. gbcon167.seq - Constructed sequence entries, part 167.
402. gbcon168.seq - Constructed sequence entries, part 168.
403. gbcon169.seq - Constructed sequence entries, part 169.
404. gbcon17.seq - Constructed sequence entries, part 17.
405. gbcon170.seq - Constructed sequence entries, part 170.
406. gbcon171.seq - Constructed sequence entries, part 171.
407. gbcon172.seq - Constructed sequence entries, part 172.
408. gbcon173.seq - Constructed sequence entries, part 173.
409. gbcon174.seq - Constructed sequence entries, part 174.
410. gbcon175.seq - Constructed sequence entries, part 175.
411. gbcon176.seq - Constructed sequence entries, part 176.
412. gbcon177.seq - Constructed sequence entries, part 177.
413. gbcon178.seq - Constructed sequence entries, part 178.
414. gbcon179.seq - Constructed sequence entries, part 179.
415. gbcon18.seq - Constructed sequence entries, part 18.
416. gbcon180.seq - Constructed sequence entries, part 180.
417. gbcon181.seq - Constructed sequence entries, part 181.
418. gbcon182.seq - Constructed sequence entries, part 182.
419. gbcon183.seq - Constructed sequence entries, part 183.
420. gbcon184.seq - Constructed sequence entries, part 184.
421. gbcon185.seq - Constructed sequence entries, part 185.
422. gbcon186.seq - Constructed sequence entries, part 186.
423. gbcon187.seq - Constructed sequence entries, part 187.
424. gbcon188.seq - Constructed sequence entries, part 188.
425. gbcon189.seq - Constructed sequence entries, part 189.
426. gbcon19.seq - Constructed sequence entries, part 19.
427. gbcon190.seq - Constructed sequence entries, part 190.
428. gbcon191.seq - Constructed sequence entries, part 191.
429. gbcon192.seq - Constructed sequence entries, part 192.
430. gbcon193.seq - Constructed sequence entries, part 193.
431. gbcon194.seq - Constructed sequence entries, part 194.
432. gbcon195.seq - Constructed sequence entries, part 195.
433. gbcon196.seq - Constructed sequence entries, part 196.
434. gbcon197.seq - Constructed sequence entries, part 197.
435. gbcon198.seq - Constructed sequence entries, part 198.
436. gbcon199.seq - Constructed sequence entries, part 199.
437. gbcon2.seq - Constructed sequence entries, part 2.
438. gbcon20.seq - Constructed sequence entries, part 20.
439. gbcon200.seq - Constructed sequence entries, part 200.
440. gbcon201.seq - Constructed sequence entries, part 201.
441. gbcon202.seq - Constructed sequence entries, part 202.
442. gbcon203.seq - Constructed sequence entries, part 203.
443. gbcon204.seq - Constructed sequence entries, part 204.
444. gbcon205.seq - Constructed sequence entries, part 205.
445. gbcon21.seq - Constructed sequence entries, part 21.
446. gbcon22.seq - Constructed sequence entries, part 22.
447. gbcon23.seq - Constructed sequence entries, part 23.
448. gbcon24.seq - Constructed sequence entries, part 24.
449. gbcon25.seq - Constructed sequence entries, part 25.
450. gbcon26.seq - Constructed sequence entries, part 26.
451. gbcon27.seq - Constructed sequence entries, part 27.
452. gbcon28.seq - Constructed sequence entries, part 28.
453. gbcon29.seq - Constructed sequence entries, part 29.
454. gbcon3.seq - Constructed sequence entries, part 3.
455. gbcon30.seq - Constructed sequence entries, part 30.
456. gbcon31.seq - Constructed sequence entries, part 31.
457. gbcon32.seq - Constructed sequence entries, part 32.
458. gbcon33.seq - Constructed sequence entries, part 33.
459. gbcon34.seq - Constructed sequence entries, part 34.
460. gbcon35.seq - Constructed sequence entries, part 35.
461. gbcon36.seq - Constructed sequence entries, part 36.
462. gbcon37.seq - Constructed sequence entries, part 37.
463. gbcon38.seq - Constructed sequence entries, part 38.
464. gbcon39.seq - Constructed sequence entries, part 39.
465. gbcon4.seq - Constructed sequence entries, part 4.
466. gbcon40.seq - Constructed sequence entries, part 40.
467. gbcon41.seq - Constructed sequence entries, part 41.
468. gbcon42.seq - Constructed sequence entries, part 42.
469. gbcon43.seq - Constructed sequence entries, part 43.
470. gbcon44.seq - Constructed sequence entries, part 44.
471. gbcon45.seq - Constructed sequence entries, part 45.
472. gbcon46.seq - Constructed sequence entries, part 46.
473. gbcon47.seq - Constructed sequence entries, part 47.
474. gbcon48.seq - Constructed sequence entries, part 48.
475. gbcon49.seq - Constructed sequence entries, part 49.
476. gbcon5.seq - Constructed sequence entries, part 5.
477. gbcon50.seq - Constructed sequence entries, part 50.
478. gbcon51.seq - Constructed sequence entries, part 51.
479. gbcon52.seq - Constructed sequence entries, part 52.
480. gbcon53.seq - Constructed sequence entries, part 53.
481. gbcon54.seq - Constructed sequence entries, part 54.
482. gbcon55.seq - Constructed sequence entries, part 55.
483. gbcon56.seq - Constructed sequence entries, part 56.
484. gbcon57.seq - Constructed sequence entries, part 57.
485. gbcon58.seq - Constructed sequence entries, part 58.
486. gbcon59.seq - Constructed sequence entries, part 59.
487. gbcon6.seq - Constructed sequence entries, part 6.
488. gbcon60.seq - Constructed sequence entries, part 60.
489. gbcon61.seq - Constructed sequence entries, part 61.
490. gbcon62.seq - Constructed sequence entries, part 62.
491. gbcon63.seq - Constructed sequence entries, part 63.
492. gbcon64.seq - Constructed sequence entries, part 64.
493. gbcon65.seq - Constructed sequence entries, part 65.
494. gbcon66.seq - Constructed sequence entries, part 66.
495. gbcon67.seq - Constructed sequence entries, part 67.
496. gbcon68.seq - Constructed sequence entries, part 68.
497. gbcon69.seq - Constructed sequence entries, part 69.
498. gbcon7.seq - Constructed sequence entries, part 7.
499. gbcon70.seq - Constructed sequence entries, part 70.
500. gbcon71.seq - Constructed sequence entries, part 71.
501. gbcon72.seq - Constructed sequence entries, part 72.
502. gbcon73.seq - Constructed sequence entries, part 73.
503. gbcon74.seq - Constructed sequence entries, part 74.
504. gbcon75.seq - Constructed sequence entries, part 75.
505. gbcon76.seq - Constructed sequence entries, part 76.
506. gbcon77.seq - Constructed sequence entries, part 77.
507. gbcon78.seq - Constructed sequence entries, part 78.
508. gbcon79.seq - Constructed sequence entries, part 79.
509. gbcon8.seq - Constructed sequence entries, part 8.
510. gbcon80.seq - Constructed sequence entries, part 80.
511. gbcon81.seq - Constructed sequence entries, part 81.
512. gbcon82.seq - Constructed sequence entries, part 82.
513. gbcon83.seq - Constructed sequence entries, part 83.
514. gbcon84.seq - Constructed sequence entries, part 84.
515. gbcon85.seq - Constructed sequence entries, part 85.
516. gbcon86.seq - Constructed sequence entries, part 86.
517. gbcon87.seq - Constructed sequence entries, part 87.
518. gbcon88.seq - Constructed sequence entries, part 88.
519. gbcon89.seq - Constructed sequence entries, part 89.
520. gbcon9.seq - Constructed sequence entries, part 9.
521. gbcon90.seq - Constructed sequence entries, part 90.
522. gbcon91.seq - Constructed sequence entries, part 91.
523. gbcon92.seq - Constructed sequence entries, part 92.
524. gbcon93.seq - Constructed sequence entries, part 93.
525. gbcon94.seq - Constructed sequence entries, part 94.
526. gbcon95.seq - Constructed sequence entries, part 95.
527. gbcon96.seq - Constructed sequence entries, part 96.
528. gbcon97.seq - Constructed sequence entries, part 97.
529. gbcon98.seq - Constructed sequence entries, part 98.
530. gbcon99.seq - Constructed sequence entries, part 99.
531. gbdel.txt - Accession numbers of entries deleted since the previous release.
532. gbenv1.seq - Environmental sampling sequence entries, part 1.
533. gbenv10.seq - Environmental sampling sequence entries, part 10.
534. gbenv11.seq - Environmental sampling sequence entries, part 11.
535. gbenv12.seq - Environmental sampling sequence entries, part 12.
536. gbenv13.seq - Environmental sampling sequence entries, part 13.
537. gbenv14.seq - Environmental sampling sequence entries, part 14.
538. gbenv15.seq - Environmental sampling sequence entries, part 15.
539. gbenv16.seq - Environmental sampling sequence entries, part 16.
540. gbenv17.seq - Environmental sampling sequence entries, part 17.
541. gbenv18.seq - Environmental sampling sequence entries, part 18.
542. gbenv19.seq - Environmental sampling sequence entries, part 19.
543. gbenv2.seq - Environmental sampling sequence entries, part 2.
544. gbenv20.seq - Environmental sampling sequence entries, part 20.
545. gbenv21.seq - Environmental sampling sequence entries, part 21.
546. gbenv22.seq - Environmental sampling sequence entries, part 22.
547. gbenv23.seq - Environmental sampling sequence entries, part 23.
548. gbenv24.seq - Environmental sampling sequence entries, part 24.
549. gbenv25.seq - Environmental sampling sequence entries, part 25.
550. gbenv26.seq - Environmental sampling sequence entries, part 26.
551. gbenv27.seq - Environmental sampling sequence entries, part 27.
552. gbenv28.seq - Environmental sampling sequence entries, part 28.
553. gbenv29.seq - Environmental sampling sequence entries, part 29.
554. gbenv3.seq - Environmental sampling sequence entries, part 3.
555. gbenv30.seq - Environmental sampling sequence entries, part 30.
556. gbenv31.seq - Environmental sampling sequence entries, part 31.
557. gbenv32.seq - Environmental sampling sequence entries, part 32.
558. gbenv33.seq - Environmental sampling sequence entries, part 33.
559. gbenv34.seq - Environmental sampling sequence entries, part 34.
560. gbenv35.seq - Environmental sampling sequence entries, part 35.
561. gbenv36.seq - Environmental sampling sequence entries, part 36.
562. gbenv37.seq - Environmental sampling sequence entries, part 37.
563. gbenv38.seq - Environmental sampling sequence entries, part 38.
564. gbenv39.seq - Environmental sampling sequence entries, part 39.
565. gbenv4.seq - Environmental sampling sequence entries, part 4.
566. gbenv40.seq - Environmental sampling sequence entries, part 40.
567. gbenv41.seq - Environmental sampling sequence entries, part 41.
568. gbenv42.seq - Environmental sampling sequence entries, part 42.
569. gbenv43.seq - Environmental sampling sequence entries, part 43.
570. gbenv44.seq - Environmental sampling sequence entries, part 44.
571. gbenv45.seq - Environmental sampling sequence entries, part 45.
572. gbenv46.seq - Environmental sampling sequence entries, part 46.
573. gbenv47.seq - Environmental sampling sequence entries, part 47.
574. gbenv48.seq - Environmental sampling sequence entries, part 48.
575. gbenv49.seq - Environmental sampling sequence entries, part 49.
576. gbenv5.seq - Environmental sampling sequence entries, part 5.
577. gbenv50.seq - Environmental sampling sequence entries, part 50.
578. gbenv51.seq - Environmental sampling sequence entries, part 51.
579. gbenv52.seq - Environmental sampling sequence entries, part 52.
580. gbenv53.seq - Environmental sampling sequence entries, part 53.
581. gbenv54.seq - Environmental sampling sequence entries, part 54.
582. gbenv55.seq - Environmental sampling sequence entries, part 55.
583. gbenv56.seq - Environmental sampling sequence entries, part 56.
584. gbenv57.seq - Environmental sampling sequence entries, part 57.
585. gbenv6.seq - Environmental sampling sequence entries, part 6.
586. gbenv7.seq - Environmental sampling sequence entries, part 7.
587. gbenv8.seq - Environmental sampling sequence entries, part 8.
588. gbenv9.seq - Environmental sampling sequence entries, part 9.
589. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
590. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
591. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
592. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
593. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
594. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
595. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
596. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
597. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
598. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
599. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
600. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
601. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
602. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
603. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
604. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
605. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
606. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
607. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
608. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
609. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
610. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
611. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
612. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
613. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
614. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
615. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
616. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
617. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
618. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
619. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
620. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
621. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
622. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
623. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
624. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
625. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
626. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
627. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
628. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
629. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
630. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
631. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
632. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
633. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
634. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
635. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
636. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
637. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
638. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
639. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
640. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
641. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
642. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
643. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
644. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
645. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
646. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
647. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
648. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
649. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
650. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
651. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
652. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
653. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
654. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
655. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
656. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
657. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
658. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
659. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
660. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
661. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
662. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
663. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
664. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
665. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
666. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
667. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
668. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
669. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
670. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
671. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
672. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
673. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
674. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
675. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
676. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
677. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
678. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
679. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
680. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
681. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
682. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
683. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
684. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
685. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
686. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
687. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
688. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
689. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
690. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
691. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
692. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
693. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
694. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
695. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
696. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
697. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
698. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
699. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
700. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
701. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
702. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
703. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
704. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
705. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
706. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
707. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
708. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
709. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
710. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
711. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
712. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
713. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
714. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
715. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
716. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
717. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
718. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
719. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
720. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
721. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
722. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
723. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
724. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
725. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
726. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
727. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
728. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
729. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
730. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
731. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
732. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
733. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
734. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
735. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
736. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
737. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
738. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
739. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
740. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
741. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
742. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
743. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
744. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
745. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
746. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
747. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
748. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
749. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
750. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
751. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
752. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
753. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
754. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
755. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
756. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
757. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
758. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
759. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
760. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
761. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
762. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
763. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
764. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
765. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
766. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
767. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
768. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
769. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
770. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
771. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
772. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
773. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
774. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
775. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
776. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
777. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
778. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
779. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
780. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
781. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
782. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
783. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
784. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
785. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
786. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
787. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
788. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
789. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
790. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
791. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
792. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
793. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
794. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
795. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
796. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
797. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
798. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
799. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
800. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
801. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
802. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
803. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
804. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
805. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
806. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
807. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
808. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
809. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
810. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
811. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
812. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
813. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
814. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
815. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
816. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
817. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
818. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
819. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
820. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
821. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
822. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
823. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
824. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
825. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
826. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
827. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
828. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
829. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
830. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
831. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
832. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
833. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
834. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
835. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
836. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
837. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
838. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
839. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
840. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
841. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
842. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
843. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
844. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
845. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
846. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
847. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
848. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
849. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
850. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
851. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
852. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
853. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
854. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
855. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
856. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
857. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
858. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
859. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
860. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
861. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
862. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
863. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
864. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
865. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
866. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
867. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
868. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
869. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
870. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
871. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
872. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
873. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
874. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
875. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
876. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
877. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
878. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
879. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
880. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
881. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
882. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
883. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
884. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
885. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
886. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
887. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
888. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
889. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
890. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
891. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
892. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
893. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
894. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
895. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
896. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
897. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
898. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
899. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
900. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
901. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
902. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
903. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
904. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
905. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
906. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
907. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
908. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
909. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
910. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
911. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
912. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
913. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
914. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
915. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
916. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
917. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
918. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
919. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
920. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
921. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
922. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
923. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
924. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
925. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
926. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
927. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
928. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
929. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
930. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
931. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
932. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
933. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
934. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
935. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
936. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
937. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
938. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
939. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
940. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
941. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
942. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
943. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
944. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
945. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
946. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
947. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
948. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
949. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
950. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
951. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
952. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
953. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
954. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
955. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
956. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
957. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
958. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
959. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
960. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
961. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
962. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
963. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
964. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
965. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
966. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
967. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
968. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
969. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
970. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
971. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
972. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
973. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
974. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
975. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
976. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
977. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
978. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
979. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
980. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
981. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
982. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
983. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
984. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
985. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
986. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
987. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
988. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
989. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
990. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
991. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
992. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
993. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
994. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
995. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
996. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
997. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
998. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
999. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1000. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1001. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1002. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1003. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1004. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1005. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1006. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1007. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1008. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1009. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1010. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1011. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1012. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1013. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1014. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1015. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1016. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1017. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1018. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1019. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1020. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1021. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1022. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1023. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1024. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1025. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1026. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1027. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1028. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1029. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1030. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1031. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1032. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1033. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1034. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1035. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1036. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1037. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1038. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1039. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1040. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1041. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1042. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1043. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1044. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1045. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1046. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1047. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1048. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1049. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1050. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1051. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1052. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1053. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1054. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1055. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1056. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1057. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1058. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1059. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1060. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1061. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1062. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1063. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1064. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1065. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1066. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1067. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1068. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1069. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1070. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1071. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1072. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1073. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1074. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1075. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1076. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1077. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1078. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1079. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1080. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1081. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1082. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1083. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1084. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1085. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1086. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1087. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1088. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1089. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1090. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1091. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1092. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1093. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1094. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1095. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1096. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1097. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1098. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1099. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1100. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1101. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1102. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1103. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1104. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1105. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1106. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1107. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1108. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1109. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1110. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1111. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1112. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1113. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1114. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1115. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1116. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1117. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1118. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1119. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1120. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1121. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1122. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1123. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1124. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1125. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1126. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1127. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1128. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1129. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1130. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1131. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1132. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1133. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1134. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1135. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1136. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1137. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1138. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1139. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1140. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1141. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1142. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1143. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1144. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1145. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1146. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1147. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1148. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1149. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1150. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1151. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1152. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1153. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1154. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1155. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1156. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1157. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1158. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1159. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1160. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1161. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1162. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1163. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1164. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1165. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1166. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1167. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1168. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1169. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1170. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1171. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1172. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1173. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1174. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1175. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1176. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1177. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1178. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1179. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1180. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1181. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1182. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1183. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1184. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1185. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1186. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1187. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1188. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1189. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1190. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1191. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1192. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1193. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1194. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1195. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1196. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1197. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1198. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1199. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1200. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1201. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1202. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1203. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1204. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1205. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1206. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1207. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1208. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1209. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1210. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1211. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1212. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1213. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1214. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1215. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1216. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1217. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1218. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1219. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1220. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1221. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1222. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1223. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1224. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1225. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1226. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1227. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1228. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1229. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1230. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1231. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1232. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1233. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1234. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1235. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1236. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1237. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1238. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1239. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1240. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1241. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1242. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1243. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1244. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1245. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1246. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1247. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1248. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1249. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1250. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1251. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1252. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1253. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1254. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1255. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1256. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1257. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1258. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1259. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1260. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1261. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1262. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1263. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1264. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1265. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1266. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1267. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1268. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1269. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1270. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1271. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1272. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1273. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1274. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1275. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1276. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1277. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1278. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1279. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1280. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1281. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1282. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1283. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1284. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1285. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1286. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1287. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1288. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1289. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1290. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1291. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1292. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1293. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1294. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1295. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1296. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1297. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1298. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1299. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1300. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1301. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1302. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1303. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1304. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1305. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1306. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1307. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1308. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1309. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1310. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1311. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1312. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1313. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1314. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1315. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1316. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1317. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1318. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1319. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1320. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1321. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1322. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1323. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1324. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1325. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1326. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1327. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1328. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1329. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1330. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1331. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1332. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1333. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1334. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1335. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1336. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1337. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1338. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1339. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1340. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1341. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1342. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1343. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1344. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1345. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1346. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1347. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1348. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1349. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1350. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1351. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1352. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1353. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1354. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1355. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1356. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1357. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1358. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1359. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1360. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1361. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1362. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1363. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1364. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1365. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1366. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1367. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1368. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1369. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1370. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1371. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1372. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1373. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1374. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1375. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1376. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1377. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1378. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1379. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1380. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1381. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1382. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1383. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1384. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1385. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1386. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1387. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1388. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1389. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1390. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1391. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1392. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1393. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1394. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1395. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1396. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1397. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1398. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1399. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1400. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1401. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1402. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1403. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1404. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1405. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1406. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1407. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1408. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1409. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1410. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1411. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1412. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1413. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1414. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1415. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1416. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1417. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1418. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1419. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1420. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1421. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1422. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1423. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1424. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1425. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1426. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1427. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1428. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1429. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1430. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1431. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1432. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1433. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1434. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1435. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1436. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1437. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1438. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1439. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1440. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1441. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1442. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1443. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1444. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1445. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1446. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1447. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1448. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1449. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1450. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1451. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1452. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1453. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1454. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1455. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1456. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1457. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1458. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1459. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1460. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1461. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1462. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1463. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1464. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1465. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1466. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1467. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1468. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1469. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1470. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1471. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1472. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1473. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1474. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1475. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1476. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1477. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1478. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1479. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1480. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1481. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1482. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1483. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1484. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1485. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1486. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1487. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1488. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1489. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1490. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1491. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1492. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1493. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1494. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1495. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1496. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1497. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1498. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1499. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1500. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1501. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1502. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1503. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1504. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1505. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1506. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1507. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1508. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1509. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1510. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1511. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1512. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1513. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1514. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1515. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1516. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1517. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1518. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1519. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1520. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1521. gbinv1.seq - Invertebrate sequence entries, part 1.
1522. gbinv10.seq - Invertebrate sequence entries, part 10.
1523. gbinv11.seq - Invertebrate sequence entries, part 11.
1524. gbinv12.seq - Invertebrate sequence entries, part 12.
1525. gbinv13.seq - Invertebrate sequence entries, part 13.
1526. gbinv14.seq - Invertebrate sequence entries, part 14.
1527. gbinv15.seq - Invertebrate sequence entries, part 15.
1528. gbinv16.seq - Invertebrate sequence entries, part 16.
1529. gbinv17.seq - Invertebrate sequence entries, part 17.
1530. gbinv18.seq - Invertebrate sequence entries, part 18.
1531. gbinv19.seq - Invertebrate sequence entries, part 19.
1532. gbinv2.seq - Invertebrate sequence entries, part 2.
1533. gbinv20.seq - Invertebrate sequence entries, part 20.
1534. gbinv21.seq - Invertebrate sequence entries, part 21.
1535. gbinv22.seq - Invertebrate sequence entries, part 22.
1536. gbinv23.seq - Invertebrate sequence entries, part 23.
1537. gbinv24.seq - Invertebrate sequence entries, part 24.
1538. gbinv25.seq - Invertebrate sequence entries, part 25.
1539. gbinv26.seq - Invertebrate sequence entries, part 26.
1540. gbinv27.seq - Invertebrate sequence entries, part 27.
1541. gbinv28.seq - Invertebrate sequence entries, part 28.
1542. gbinv29.seq - Invertebrate sequence entries, part 29.
1543. gbinv3.seq - Invertebrate sequence entries, part 3.
1544. gbinv30.seq - Invertebrate sequence entries, part 30.
1545. gbinv31.seq - Invertebrate sequence entries, part 31.
1546. gbinv32.seq - Invertebrate sequence entries, part 32.
1547. gbinv33.seq - Invertebrate sequence entries, part 33.
1548. gbinv34.seq - Invertebrate sequence entries, part 34.
1549. gbinv35.seq - Invertebrate sequence entries, part 35.
1550. gbinv36.seq - Invertebrate sequence entries, part 36.
1551. gbinv37.seq - Invertebrate sequence entries, part 37.
1552. gbinv38.seq - Invertebrate sequence entries, part 38.
1553. gbinv39.seq - Invertebrate sequence entries, part 39.
1554. gbinv4.seq - Invertebrate sequence entries, part 4.
1555. gbinv40.seq - Invertebrate sequence entries, part 40.
1556. gbinv41.seq - Invertebrate sequence entries, part 41.
1557. gbinv42.seq - Invertebrate sequence entries, part 42.
1558. gbinv43.seq - Invertebrate sequence entries, part 43.
1559. gbinv44.seq - Invertebrate sequence entries, part 44.
1560. gbinv45.seq - Invertebrate sequence entries, part 45.
1561. gbinv46.seq - Invertebrate sequence entries, part 46.
1562. gbinv47.seq - Invertebrate sequence entries, part 47.
1563. gbinv48.seq - Invertebrate sequence entries, part 48.
1564. gbinv49.seq - Invertebrate sequence entries, part 49.
1565. gbinv5.seq - Invertebrate sequence entries, part 5.
1566. gbinv50.seq - Invertebrate sequence entries, part 50.
1567. gbinv51.seq - Invertebrate sequence entries, part 51.
1568. gbinv52.seq - Invertebrate sequence entries, part 52.
1569. gbinv53.seq - Invertebrate sequence entries, part 53.
1570. gbinv54.seq - Invertebrate sequence entries, part 54.
1571. gbinv55.seq - Invertebrate sequence entries, part 55.
1572. gbinv56.seq - Invertebrate sequence entries, part 56.
1573. gbinv57.seq - Invertebrate sequence entries, part 57.
1574. gbinv58.seq - Invertebrate sequence entries, part 58.
1575. gbinv59.seq - Invertebrate sequence entries, part 59.
1576. gbinv6.seq - Invertebrate sequence entries, part 6.
1577. gbinv60.seq - Invertebrate sequence entries, part 60.
1578. gbinv61.seq - Invertebrate sequence entries, part 61.
1579. gbinv62.seq - Invertebrate sequence entries, part 62.
1580. gbinv63.seq - Invertebrate sequence entries, part 63.
1581. gbinv64.seq - Invertebrate sequence entries, part 64.
1582. gbinv65.seq - Invertebrate sequence entries, part 65.
1583. gbinv66.seq - Invertebrate sequence entries, part 66.
1584. gbinv67.seq - Invertebrate sequence entries, part 67.
1585. gbinv68.seq - Invertebrate sequence entries, part 68.
1586. gbinv7.seq - Invertebrate sequence entries, part 7.
1587. gbinv8.seq - Invertebrate sequence entries, part 8.
1588. gbinv9.seq - Invertebrate sequence entries, part 9.
1589. gbmam1.seq - Other mammalian sequence entries, part 1.
1590. gbmam10.seq - Other mammalian sequence entries, part 10.
1591. gbmam11.seq - Other mammalian sequence entries, part 11.
1592. gbmam12.seq - Other mammalian sequence entries, part 12.
1593. gbmam13.seq - Other mammalian sequence entries, part 13.
1594. gbmam14.seq - Other mammalian sequence entries, part 14.
1595. gbmam15.seq - Other mammalian sequence entries, part 15.
1596. gbmam16.seq - Other mammalian sequence entries, part 16.
1597. gbmam17.seq - Other mammalian sequence entries, part 17.
1598. gbmam18.seq - Other mammalian sequence entries, part 18.
1599. gbmam19.seq - Other mammalian sequence entries, part 19.
1600. gbmam2.seq - Other mammalian sequence entries, part 2.
1601. gbmam20.seq - Other mammalian sequence entries, part 20.
1602. gbmam21.seq - Other mammalian sequence entries, part 21.
1603. gbmam22.seq - Other mammalian sequence entries, part 22.
1604. gbmam23.seq - Other mammalian sequence entries, part 23.
1605. gbmam24.seq - Other mammalian sequence entries, part 24.
1606. gbmam25.seq - Other mammalian sequence entries, part 25.
1607. gbmam26.seq - Other mammalian sequence entries, part 26.
1608. gbmam27.seq - Other mammalian sequence entries, part 27.
1609. gbmam28.seq - Other mammalian sequence entries, part 28.
1610. gbmam29.seq - Other mammalian sequence entries, part 29.
1611. gbmam3.seq - Other mammalian sequence entries, part 3.
1612. gbmam30.seq - Other mammalian sequence entries, part 30.
1613. gbmam31.seq - Other mammalian sequence entries, part 31.
1614. gbmam32.seq - Other mammalian sequence entries, part 32.
1615. gbmam4.seq - Other mammalian sequence entries, part 4.
1616. gbmam5.seq - Other mammalian sequence entries, part 5.
1617. gbmam6.seq - Other mammalian sequence entries, part 6.
1618. gbmam7.seq - Other mammalian sequence entries, part 7.
1619. gbmam8.seq - Other mammalian sequence entries, part 8.
1620. gbmam9.seq - Other mammalian sequence entries, part 9.
1621. gbnew.txt - Accession numbers of entries new since the previous release.
1622. gbpat1.seq - Patent sequence entries, part 1.
1623. gbpat10.seq - Patent sequence entries, part 10.
1624. gbpat100.seq - Patent sequence entries, part 100.
1625. gbpat101.seq - Patent sequence entries, part 101.
1626. gbpat102.seq - Patent sequence entries, part 102.
1627. gbpat103.seq - Patent sequence entries, part 103.
1628. gbpat104.seq - Patent sequence entries, part 104.
1629. gbpat105.seq - Patent sequence entries, part 105.
1630. gbpat106.seq - Patent sequence entries, part 106.
1631. gbpat107.seq - Patent sequence entries, part 107.
1632. gbpat108.seq - Patent sequence entries, part 108.
1633. gbpat109.seq - Patent sequence entries, part 109.
1634. gbpat11.seq - Patent sequence entries, part 11.
1635. gbpat110.seq - Patent sequence entries, part 110.
1636. gbpat111.seq - Patent sequence entries, part 111.
1637. gbpat112.seq - Patent sequence entries, part 112.
1638. gbpat113.seq - Patent sequence entries, part 113.
1639. gbpat114.seq - Patent sequence entries, part 114.
1640. gbpat115.seq - Patent sequence entries, part 115.
1641. gbpat116.seq - Patent sequence entries, part 116.
1642. gbpat117.seq - Patent sequence entries, part 117.
1643. gbpat118.seq - Patent sequence entries, part 118.
1644. gbpat119.seq - Patent sequence entries, part 119.
1645. gbpat12.seq - Patent sequence entries, part 12.
1646. gbpat120.seq - Patent sequence entries, part 120.
1647. gbpat121.seq - Patent sequence entries, part 121.
1648. gbpat122.seq - Patent sequence entries, part 122.
1649. gbpat123.seq - Patent sequence entries, part 123.
1650. gbpat124.seq - Patent sequence entries, part 124.
1651. gbpat125.seq - Patent sequence entries, part 125.
1652. gbpat126.seq - Patent sequence entries, part 126.
1653. gbpat127.seq - Patent sequence entries, part 127.
1654. gbpat128.seq - Patent sequence entries, part 128.
1655. gbpat129.seq - Patent sequence entries, part 129.
1656. gbpat13.seq - Patent sequence entries, part 13.
1657. gbpat130.seq - Patent sequence entries, part 130.
1658. gbpat131.seq - Patent sequence entries, part 131.
1659. gbpat132.seq - Patent sequence entries, part 132.
1660. gbpat133.seq - Patent sequence entries, part 133.
1661. gbpat134.seq - Patent sequence entries, part 134.
1662. gbpat135.seq - Patent sequence entries, part 135.
1663. gbpat136.seq - Patent sequence entries, part 136.
1664. gbpat137.seq - Patent sequence entries, part 137.
1665. gbpat138.seq - Patent sequence entries, part 138.
1666. gbpat139.seq - Patent sequence entries, part 139.
1667. gbpat14.seq - Patent sequence entries, part 14.
1668. gbpat140.seq - Patent sequence entries, part 140.
1669. gbpat141.seq - Patent sequence entries, part 141.
1670. gbpat142.seq - Patent sequence entries, part 142.
1671. gbpat143.seq - Patent sequence entries, part 143.
1672. gbpat144.seq - Patent sequence entries, part 144.
1673. gbpat145.seq - Patent sequence entries, part 145.
1674. gbpat146.seq - Patent sequence entries, part 146.
1675. gbpat147.seq - Patent sequence entries, part 147.
1676. gbpat148.seq - Patent sequence entries, part 148.
1677. gbpat149.seq - Patent sequence entries, part 149.
1678. gbpat15.seq - Patent sequence entries, part 15.
1679. gbpat150.seq - Patent sequence entries, part 150.
1680. gbpat151.seq - Patent sequence entries, part 151.
1681. gbpat152.seq - Patent sequence entries, part 152.
1682. gbpat153.seq - Patent sequence entries, part 153.
1683. gbpat154.seq - Patent sequence entries, part 154.
1684. gbpat155.seq - Patent sequence entries, part 155.
1685. gbpat156.seq - Patent sequence entries, part 156.
1686. gbpat157.seq - Patent sequence entries, part 157.
1687. gbpat158.seq - Patent sequence entries, part 158.
1688. gbpat159.seq - Patent sequence entries, part 159.
1689. gbpat16.seq - Patent sequence entries, part 16.
1690. gbpat160.seq - Patent sequence entries, part 160.
1691. gbpat161.seq - Patent sequence entries, part 161.
1692. gbpat162.seq - Patent sequence entries, part 162.
1693. gbpat163.seq - Patent sequence entries, part 163.
1694. gbpat164.seq - Patent sequence entries, part 164.
1695. gbpat165.seq - Patent sequence entries, part 165.
1696. gbpat166.seq - Patent sequence entries, part 166.
1697. gbpat167.seq - Patent sequence entries, part 167.
1698. gbpat168.seq - Patent sequence entries, part 168.
1699. gbpat169.seq - Patent sequence entries, part 169.
1700. gbpat17.seq - Patent sequence entries, part 17.
1701. gbpat170.seq - Patent sequence entries, part 170.
1702. gbpat171.seq - Patent sequence entries, part 171.
1703. gbpat172.seq - Patent sequence entries, part 172.
1704. gbpat173.seq - Patent sequence entries, part 173.
1705. gbpat174.seq - Patent sequence entries, part 174.
1706. gbpat175.seq - Patent sequence entries, part 175.
1707. gbpat176.seq - Patent sequence entries, part 176.
1708. gbpat177.seq - Patent sequence entries, part 177.
1709. gbpat178.seq - Patent sequence entries, part 178.
1710. gbpat179.seq - Patent sequence entries, part 179.
1711. gbpat18.seq - Patent sequence entries, part 18.
1712. gbpat180.seq - Patent sequence entries, part 180.
1713. gbpat181.seq - Patent sequence entries, part 181.
1714. gbpat182.seq - Patent sequence entries, part 182.
1715. gbpat183.seq - Patent sequence entries, part 183.
1716. gbpat184.seq - Patent sequence entries, part 184.
1717. gbpat185.seq - Patent sequence entries, part 185.
1718. gbpat186.seq - Patent sequence entries, part 186.
1719. gbpat187.seq - Patent sequence entries, part 187.
1720. gbpat188.seq - Patent sequence entries, part 188.
1721. gbpat189.seq - Patent sequence entries, part 189.
1722. gbpat19.seq - Patent sequence entries, part 19.
1723. gbpat190.seq - Patent sequence entries, part 190.
1724. gbpat191.seq - Patent sequence entries, part 191.
1725. gbpat192.seq - Patent sequence entries, part 192.
1726. gbpat193.seq - Patent sequence entries, part 193.
1727. gbpat2.seq - Patent sequence entries, part 2.
1728. gbpat20.seq - Patent sequence entries, part 20.
1729. gbpat21.seq - Patent sequence entries, part 21.
1730. gbpat22.seq - Patent sequence entries, part 22.
1731. gbpat23.seq - Patent sequence entries, part 23.
1732. gbpat24.seq - Patent sequence entries, part 24.
1733. gbpat25.seq - Patent sequence entries, part 25.
1734. gbpat26.seq - Patent sequence entries, part 26.
1735. gbpat27.seq - Patent sequence entries, part 27.
1736. gbpat28.seq - Patent sequence entries, part 28.
1737. gbpat29.seq - Patent sequence entries, part 29.
1738. gbpat3.seq - Patent sequence entries, part 3.
1739. gbpat30.seq - Patent sequence entries, part 30.
1740. gbpat31.seq - Patent sequence entries, part 31.
1741. gbpat32.seq - Patent sequence entries, part 32.
1742. gbpat33.seq - Patent sequence entries, part 33.
1743. gbpat34.seq - Patent sequence entries, part 34.
1744. gbpat35.seq - Patent sequence entries, part 35.
1745. gbpat36.seq - Patent sequence entries, part 36.
1746. gbpat37.seq - Patent sequence entries, part 37.
1747. gbpat38.seq - Patent sequence entries, part 38.
1748. gbpat39.seq - Patent sequence entries, part 39.
1749. gbpat4.seq - Patent sequence entries, part 4.
1750. gbpat40.seq - Patent sequence entries, part 40.
1751. gbpat41.seq - Patent sequence entries, part 41.
1752. gbpat42.seq - Patent sequence entries, part 42.
1753. gbpat43.seq - Patent sequence entries, part 43.
1754. gbpat44.seq - Patent sequence entries, part 44.
1755. gbpat45.seq - Patent sequence entries, part 45.
1756. gbpat46.seq - Patent sequence entries, part 46.
1757. gbpat47.seq - Patent sequence entries, part 47.
1758. gbpat48.seq - Patent sequence entries, part 48.
1759. gbpat49.seq - Patent sequence entries, part 49.
1760. gbpat5.seq - Patent sequence entries, part 5.
1761. gbpat50.seq - Patent sequence entries, part 50.
1762. gbpat51.seq - Patent sequence entries, part 51.
1763. gbpat52.seq - Patent sequence entries, part 52.
1764. gbpat53.seq - Patent sequence entries, part 53.
1765. gbpat54.seq - Patent sequence entries, part 54.
1766. gbpat55.seq - Patent sequence entries, part 55.
1767. gbpat56.seq - Patent sequence entries, part 56.
1768. gbpat57.seq - Patent sequence entries, part 57.
1769. gbpat58.seq - Patent sequence entries, part 58.
1770. gbpat59.seq - Patent sequence entries, part 59.
1771. gbpat6.seq - Patent sequence entries, part 6.
1772. gbpat60.seq - Patent sequence entries, part 60.
1773. gbpat61.seq - Patent sequence entries, part 61.
1774. gbpat62.seq - Patent sequence entries, part 62.
1775. gbpat63.seq - Patent sequence entries, part 63.
1776. gbpat64.seq - Patent sequence entries, part 64.
1777. gbpat65.seq - Patent sequence entries, part 65.
1778. gbpat66.seq - Patent sequence entries, part 66.
1779. gbpat67.seq - Patent sequence entries, part 67.
1780. gbpat68.seq - Patent sequence entries, part 68.
1781. gbpat69.seq - Patent sequence entries, part 69.
1782. gbpat7.seq - Patent sequence entries, part 7.
1783. gbpat70.seq - Patent sequence entries, part 70.
1784. gbpat71.seq - Patent sequence entries, part 71.
1785. gbpat72.seq - Patent sequence entries, part 72.
1786. gbpat73.seq - Patent sequence entries, part 73.
1787. gbpat74.seq - Patent sequence entries, part 74.
1788. gbpat75.seq - Patent sequence entries, part 75.
1789. gbpat76.seq - Patent sequence entries, part 76.
1790. gbpat77.seq - Patent sequence entries, part 77.
1791. gbpat78.seq - Patent sequence entries, part 78.
1792. gbpat79.seq - Patent sequence entries, part 79.
1793. gbpat8.seq - Patent sequence entries, part 8.
1794. gbpat80.seq - Patent sequence entries, part 80.
1795. gbpat81.seq - Patent sequence entries, part 81.
1796. gbpat82.seq - Patent sequence entries, part 82.
1797. gbpat83.seq - Patent sequence entries, part 83.
1798. gbpat84.seq - Patent sequence entries, part 84.
1799. gbpat85.seq - Patent sequence entries, part 85.
1800. gbpat86.seq - Patent sequence entries, part 86.
1801. gbpat87.seq - Patent sequence entries, part 87.
1802. gbpat88.seq - Patent sequence entries, part 88.
1803. gbpat89.seq - Patent sequence entries, part 89.
1804. gbpat9.seq - Patent sequence entries, part 9.
1805. gbpat90.seq - Patent sequence entries, part 90.
1806. gbpat91.seq - Patent sequence entries, part 91.
1807. gbpat92.seq - Patent sequence entries, part 92.
1808. gbpat93.seq - Patent sequence entries, part 93.
1809. gbpat94.seq - Patent sequence entries, part 94.
1810. gbpat95.seq - Patent sequence entries, part 95.
1811. gbpat96.seq - Patent sequence entries, part 96.
1812. gbpat97.seq - Patent sequence entries, part 97.
1813. gbpat98.seq - Patent sequence entries, part 98.
1814. gbpat99.seq - Patent sequence entries, part 99.
1815. gbphg1.seq - Phage sequence entries, part 1.
1816. gbphg2.seq - Phage sequence entries, part 2.
1817. gbphg3.seq - Phage sequence entries, part 3.
1818. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1819. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1820. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
1821. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
1822. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
1823. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
1824. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
1825. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
1826. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
1827. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
1828. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
1829. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
1830. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1831. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
1832. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
1833. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
1834. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
1835. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
1836. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
1837. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
1838. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
1839. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
1840. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
1841. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1842. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
1843. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
1844. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
1845. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
1846. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
1847. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
1848. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
1849. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
1850. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
1851. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
1852. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1853. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
1854. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
1855. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
1856. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
1857. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
1858. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
1859. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
1860. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
1861. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
1862. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
1863. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1864. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
1865. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
1866. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
1867. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
1868. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1869. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
1870. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
1871. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
1872. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
1873. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
1874. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
1875. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
1876. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
1877. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
1878. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
1879. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
1880. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
1881. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
1882. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
1883. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
1884. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
1885. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
1886. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
1887. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
1888. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
1889. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
1890. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
1891. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
1892. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
1893. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
1894. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
1895. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
1896. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
1897. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
1898. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
1899. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
1900. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
1901. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
1902. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
1903. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
1904. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
1905. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
1906. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
1907. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
1908. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
1909. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
1910. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
1911. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
1912. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
1913. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
1914. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
1915. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
1916. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
1917. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
1918. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
1919. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
1920. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
1921. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
1922. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
1923. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
1924. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
1925. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
1926. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
1927. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
1928. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
1929. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
1930. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
1931. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
1932. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
1933. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
1934. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
1935. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
1936. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
1937. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
1938. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
1939. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
1940. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
1941. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
1942. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
1943. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
1944. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
1945. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
1946. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
1947. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
1948. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
1949. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
1950. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
1951. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
1952. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
1953. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
1954. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
1955. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
1956. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
1957. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
1958. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
1959. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
1960. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
1961. gbpri1.seq - Primate sequence entries, part 1.
1962. gbpri10.seq - Primate sequence entries, part 10.
1963. gbpri11.seq - Primate sequence entries, part 11.
1964. gbpri12.seq - Primate sequence entries, part 12.
1965. gbpri13.seq - Primate sequence entries, part 13.
1966. gbpri14.seq - Primate sequence entries, part 14.
1967. gbpri15.seq - Primate sequence entries, part 15.
1968. gbpri16.seq - Primate sequence entries, part 16.
1969. gbpri17.seq - Primate sequence entries, part 17.
1970. gbpri18.seq - Primate sequence entries, part 18.
1971. gbpri19.seq - Primate sequence entries, part 19.
1972. gbpri2.seq - Primate sequence entries, part 2.
1973. gbpri20.seq - Primate sequence entries, part 20.
1974. gbpri21.seq - Primate sequence entries, part 21.
1975. gbpri22.seq - Primate sequence entries, part 22.
1976. gbpri23.seq - Primate sequence entries, part 23.
1977. gbpri24.seq - Primate sequence entries, part 24.
1978. gbpri25.seq - Primate sequence entries, part 25.
1979. gbpri26.seq - Primate sequence entries, part 26.
1980. gbpri27.seq - Primate sequence entries, part 27.
1981. gbpri28.seq - Primate sequence entries, part 28.
1982. gbpri29.seq - Primate sequence entries, part 29.
1983. gbpri3.seq - Primate sequence entries, part 3.
1984. gbpri30.seq - Primate sequence entries, part 30.
1985. gbpri31.seq - Primate sequence entries, part 31.
1986. gbpri32.seq - Primate sequence entries, part 32.
1987. gbpri33.seq - Primate sequence entries, part 33.
1988. gbpri4.seq - Primate sequence entries, part 4.
1989. gbpri5.seq - Primate sequence entries, part 5.
1990. gbpri6.seq - Primate sequence entries, part 6.
1991. gbpri7.seq - Primate sequence entries, part 7.
1992. gbpri8.seq - Primate sequence entries, part 8.
1993. gbpri9.seq - Primate sequence entries, part 9.
1994. gbrel.txt - Release notes (this document).
1995. gbrod1.seq - Rodent sequence entries, part 1.
1996. gbrod10.seq - Rodent sequence entries, part 10.
1997. gbrod11.seq - Rodent sequence entries, part 11.
1998. gbrod12.seq - Rodent sequence entries, part 12.
1999. gbrod13.seq - Rodent sequence entries, part 13.
2000. gbrod14.seq - Rodent sequence entries, part 14.
2001. gbrod15.seq - Rodent sequence entries, part 15.
2002. gbrod16.seq - Rodent sequence entries, part 16.
2003. gbrod17.seq - Rodent sequence entries, part 17.
2004. gbrod2.seq - Rodent sequence entries, part 2.
2005. gbrod3.seq - Rodent sequence entries, part 3.
2006. gbrod4.seq - Rodent sequence entries, part 4.
2007. gbrod5.seq - Rodent sequence entries, part 5.
2008. gbrod6.seq - Rodent sequence entries, part 6.
2009. gbrod7.seq - Rodent sequence entries, part 7.
2010. gbrod8.seq - Rodent sequence entries, part 8.
2011. gbrod9.seq - Rodent sequence entries, part 9.
2012. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2013. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2014. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2015. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2016. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2017. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2018. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2019. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2020. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2021. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2022. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2023. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2024. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2025. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
2026. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
2027. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
2028. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
2029. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
2030. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
2031. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
2032. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
2033. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
2034. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2035. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
2036. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
2037. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
2038. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
2039. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
2040. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
2041. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
2042. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
2043. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2044. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2045. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2046. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2047. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2048. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2049. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2050. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2051. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2052. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2053. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2054. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2055. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2056. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2057. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2058. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2059. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2060. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2061. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2062. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2063. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2064. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2065. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2066. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2067. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2068. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2069. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2070. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2071. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2072. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2073. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2074. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2075. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2076. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2077. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2078. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2079. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2080. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2081. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2082. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2083. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2084. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2085. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2086. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2087. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2088. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2089. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2090. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2091. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2092. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2093. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2094. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2095. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2096. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2097. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2098. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2099. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2100. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2101. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2102. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2103. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2104. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2105. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2106. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2107. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2108. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2109. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2110. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2111. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2112. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2113. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2114. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2115. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2116. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2117. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2118. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2119. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2120. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2121. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2122. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2123. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2124. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2125. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2126. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2127. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2128. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2129. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2130. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2131. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2132. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2133. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2134. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2135. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2136. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2137. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2138. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2139. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2140. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2141. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2142. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2143. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2144. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2145. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2146. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2147. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2148. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2149. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2150. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2151. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2152. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2153. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2154. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2155. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2156. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2157. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2158. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2159. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2160. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2161. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2162. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2163. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2164. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2165. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2166. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2167. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2168. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2169. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2170. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2171. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2172. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2173. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2174. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2175. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2176. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2177. gbuna1.seq - Unannotated sequence entries, part 1.
2178. gbvrl1.seq - Viral sequence entries, part 1.
2179. gbvrl10.seq - Viral sequence entries, part 10.
2180. gbvrl11.seq - Viral sequence entries, part 11.
2181. gbvrl12.seq - Viral sequence entries, part 12.
2182. gbvrl13.seq - Viral sequence entries, part 13.
2183. gbvrl14.seq - Viral sequence entries, part 14.
2184. gbvrl15.seq - Viral sequence entries, part 15.
2185. gbvrl16.seq - Viral sequence entries, part 16.
2186. gbvrl17.seq - Viral sequence entries, part 17.
2187. gbvrl18.seq - Viral sequence entries, part 18.
2188. gbvrl19.seq - Viral sequence entries, part 19.
2189. gbvrl2.seq - Viral sequence entries, part 2.
2190. gbvrl20.seq - Viral sequence entries, part 20.
2191. gbvrl21.seq - Viral sequence entries, part 21.
2192. gbvrl22.seq - Viral sequence entries, part 22.
2193. gbvrl23.seq - Viral sequence entries, part 23.
2194. gbvrl24.seq - Viral sequence entries, part 24.
2195. gbvrl25.seq - Viral sequence entries, part 25.
2196. gbvrl26.seq - Viral sequence entries, part 26.
2197. gbvrl27.seq - Viral sequence entries, part 27.
2198. gbvrl28.seq - Viral sequence entries, part 28.
2199. gbvrl29.seq - Viral sequence entries, part 29.
2200. gbvrl3.seq - Viral sequence entries, part 3.
2201. gbvrl30.seq - Viral sequence entries, part 30.
2202. gbvrl31.seq - Viral sequence entries, part 31.
2203. gbvrl32.seq - Viral sequence entries, part 32.
2204. gbvrl4.seq - Viral sequence entries, part 4.
2205. gbvrl5.seq - Viral sequence entries, part 5.
2206. gbvrl6.seq - Viral sequence entries, part 6.
2207. gbvrl7.seq - Viral sequence entries, part 7.
2208. gbvrl8.seq - Viral sequence entries, part 8.
2209. gbvrl9.seq - Viral sequence entries, part 9.
2210. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2211. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2212. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2213. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2214. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2215. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2216. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2217. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2218. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2219. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2220. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2221. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2222. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2223. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2224. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2225. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2226. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2227. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2228. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2229. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2230. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2231. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2232. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2233. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2234. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2235. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2236. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2237. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2238. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2239. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2240. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2241. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2242. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2243. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2244. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2245. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2246. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2247. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2248. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2249. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2250. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2251. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2252. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2253. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2254. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2255. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2256. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2257. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2258. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2259. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2260. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2261. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2262. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2263. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2264. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2265. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2266. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2267. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2268. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2269. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2270. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2271. gbvrt65.seq - Other vertebrate sequence entries, part 65.
2272. gbvrt66.seq - Other vertebrate sequence entries, part 66.
2273. gbvrt67.seq - Other vertebrate sequence entries, part 67.
2274. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2275. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2276. gbvrt9.seq - Other vertebrate sequence entries, part 9.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 230.0 flatfiles require roughly 963 GB (sequence
files only) or 963 GB (including the *.txt files).
The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 492117130     gbbct1.seq
 497246199     gbbct10.seq
 494100520     gbbct100.seq
 493992403     gbbct101.seq
 331304342     gbbct102.seq
 499974195     gbbct103.seq
 493009100     gbbct104.seq
 492762593     gbbct105.seq
 416301799     gbbct106.seq
 499127094     gbbct107.seq
 496815434     gbbct108.seq
 491164637     gbbct109.seq
 499940438     gbbct11.seq
 499599910     gbbct110.seq
 493404201     gbbct111.seq
 499984448     gbbct112.seq
 349443576     gbbct113.seq
 498286783     gbbct114.seq
 489447997     gbbct115.seq
 499733693     gbbct116.seq
 461296924     gbbct117.seq
 495771276     gbbct118.seq
 493828912     gbbct119.seq
 450900951     gbbct12.seq
 491367507     gbbct120.seq
 498682081     gbbct121.seq
 499683464     gbbct122.seq
 147978507     gbbct123.seq
 492561308     gbbct124.seq
 497682754     gbbct125.seq
 499141254     gbbct126.seq
 497969516     gbbct127.seq
 352907891     gbbct128.seq
 495995767     gbbct129.seq
 499878145     gbbct13.seq
 491127837     gbbct130.seq
 499825891     gbbct131.seq
 487897028     gbbct132.seq
 488245975     gbbct133.seq
 319202889     gbbct134.seq
 499802570     gbbct135.seq
 497830496     gbbct136.seq
 491003699     gbbct137.seq
 495657725     gbbct138.seq
 499419319     gbbct139.seq
 498797878     gbbct14.seq
 492028057     gbbct140.seq
  80022005     gbbct141.seq
 494733009     gbbct142.seq
 491540174     gbbct143.seq
 495158797     gbbct144.seq
 498646328     gbbct145.seq
 498482857     gbbct146.seq
 492296929     gbbct147.seq
 377447211     gbbct148.seq
 499060031     gbbct149.seq
 498318275     gbbct15.seq
 497730982     gbbct150.seq
 496023622     gbbct151.seq
 498951663     gbbct152.seq
 129997687     gbbct153.seq
 498935979     gbbct154.seq
 486564218     gbbct155.seq
 499922555     gbbct156.seq
 246295400     gbbct157.seq
 495003015     gbbct158.seq
 495928348     gbbct159.seq
  35288432     gbbct16.seq
 489686041     gbbct160.seq
 303707273     gbbct161.seq
 497230607     gbbct162.seq
 499896390     gbbct163.seq
 493746284     gbbct164.seq
 321513891     gbbct165.seq
 497955712     gbbct166.seq
 496965010     gbbct167.seq
 494324414     gbbct168.seq
 498568108     gbbct169.seq
  21361596     gbbct17.seq
 488248841     gbbct170.seq
  94491711     gbbct171.seq
 492096403     gbbct172.seq
 495207819     gbbct173.seq
 497702792     gbbct174.seq
 499536686     gbbct175.seq
  56222398     gbbct176.seq
 498180827     gbbct177.seq
 493594032     gbbct178.seq
 491847269     gbbct179.seq
  38593329     gbbct18.seq
 489727521     gbbct180.seq
  26800771     gbbct181.seq
 489278805     gbbct182.seq
 496471290     gbbct183.seq
 493689830     gbbct184.seq
 499704160     gbbct185.seq
 299579221     gbbct186.seq
 499899105     gbbct187.seq
 496007798     gbbct188.seq
 495793955     gbbct189.seq
 499780778     gbbct19.seq
 494362269     gbbct190.seq
 499100167     gbbct191.seq
 497447400     gbbct192.seq
 118322665     gbbct193.seq
 491557855     gbbct194.seq
 497698716     gbbct195.seq
 497497227     gbbct196.seq
 299693012     gbbct197.seq
 494721313     gbbct198.seq
 492353549     gbbct199.seq
 497838824     gbbct2.seq
 498085295     gbbct20.seq
 492591488     gbbct200.seq
 382576864     gbbct201.seq
 493901740     gbbct202.seq
 498054420     gbbct203.seq
 499991139     gbbct204.seq
  12536567     gbbct205.seq
 499533596     gbbct206.seq
 490577960     gbbct207.seq
 496456243     gbbct208.seq
 412504909     gbbct209.seq
 493044260     gbbct21.seq
 494062568     gbbct210.seq
 497651795     gbbct211.seq
 499044800     gbbct212.seq
 428702780     gbbct213.seq
 483996403     gbbct214.seq
 494867023     gbbct215.seq
 499603332     gbbct216.seq
 498835800     gbbct217.seq
 491484015     gbbct218.seq
 416181864     gbbct219.seq
 498801841     gbbct22.seq
 499501176     gbbct220.seq
 497981516     gbbct221.seq
 499195444     gbbct222.seq
 416087576     gbbct223.seq
 495194036     gbbct224.seq
 487466672     gbbct225.seq
 486355316     gbbct226.seq
 494218277     gbbct227.seq
 492243150     gbbct228.seq
 495075178     gbbct229.seq
 140148079     gbbct23.seq
 283623185     gbbct230.seq
 495067418     gbbct231.seq
 495273004     gbbct232.seq
 493307948     gbbct233.seq
 499634612     gbbct234.seq
  16593817     gbbct235.seq
 499720445     gbbct236.seq
 496981075     gbbct237.seq
 498167572     gbbct238.seq
 491420328     gbbct239.seq
 499803427     gbbct24.seq
 491725073     gbbct240.seq
 490081824     gbbct241.seq
  82985630     gbbct242.seq
 499473506     gbbct243.seq
 495731024     gbbct244.seq
 495537900     gbbct245.seq
 495565474     gbbct246.seq
 496506796     gbbct247.seq
 491075303     gbbct248.seq
 489205856     gbbct249.seq
 490803918     gbbct25.seq
 482656838     gbbct250.seq
 171444826     gbbct251.seq
 499011799     gbbct252.seq
 496288296     gbbct253.seq
 494020160     gbbct254.seq
 494961058     gbbct255.seq
 136047633     gbbct256.seq
 492964051     gbbct257.seq
 496496573     gbbct258.seq
 494450836     gbbct259.seq
 499663375     gbbct26.seq
 408586144     gbbct260.seq
 499674714     gbbct261.seq
 499940387     gbbct262.seq
 499181433     gbbct263.seq
 280859290     gbbct264.seq
 490183252     gbbct265.seq
 495860905     gbbct266.seq
 499633633     gbbct267.seq
 499275365     gbbct268.seq
  91679370     gbbct269.seq
 499760804     gbbct27.seq
 305664179     gbbct270.seq
   6831713     gbbct271.seq
  14104274     gbbct272.seq
  22749007     gbbct273.seq
  44383287     gbbct274.seq
  86374522     gbbct275.seq
 168080035     gbbct276.seq
 499999514     gbbct277.seq
 491892729     gbbct278.seq
 499443174     gbbct279.seq
 490329262     gbbct28.seq
 499998260     gbbct280.seq
 498768443     gbbct281.seq
 499948230     gbbct282.seq
 492278636     gbbct283.seq
 499997445     gbbct284.seq
 474962727     gbbct285.seq
 499998023     gbbct286.seq
 288999977     gbbct287.seq
 499998407     gbbct288.seq
  83676751     gbbct289.seq
 496506711     gbbct29.seq
 499999236     gbbct290.seq
 121093035     gbbct291.seq
 500000046     gbbct292.seq
  35612216     gbbct293.seq
 140242282     gbbct294.seq
 499956006     gbbct295.seq
 367409628     gbbct296.seq
 494812085     gbbct297.seq
 494363310     gbbct298.seq
 493624209     gbbct299.seq
 290280066     gbbct3.seq
  93318707     gbbct30.seq
 496125518     gbbct300.seq
 494061633     gbbct301.seq
 497170429     gbbct302.seq
 154838714     gbbct303.seq
 494891493     gbbct304.seq
 496974006     gbbct305.seq
 499956720     gbbct306.seq
 213026164     gbbct307.seq
 499861010     gbbct308.seq
 496187362     gbbct309.seq
 498940535     gbbct31.seq
 498371706     gbbct310.seq
 211918453     gbbct311.seq
 488354384     gbbct312.seq
 496188422     gbbct313.seq
 497989529     gbbct314.seq
 497812642     gbbct315.seq
 104461686     gbbct316.seq
 499968016     gbbct317.seq
 498724815     gbbct318.seq
 497431900     gbbct319.seq
 483796261     gbbct32.seq
 405295847     gbbct320.seq
  50846176     gbbct321.seq
 104669792     gbbct322.seq
 499998573     gbbct323.seq
 262663434     gbbct324.seq
 490802573     gbbct33.seq
 498363289     gbbct34.seq
 495406618     gbbct35.seq
 487194236     gbbct36.seq
 497645939     gbbct37.seq
 497403821     gbbct38.seq
 493178568     gbbct39.seq
 394112379     gbbct4.seq
 497803421     gbbct40.seq
 494724072     gbbct41.seq
 495562417     gbbct42.seq
 232010084     gbbct43.seq
 497306740     gbbct44.seq
 499068181     gbbct45.seq
 495851277     gbbct46.seq
 494720754     gbbct47.seq
 499749959     gbbct48.seq
 490381275     gbbct49.seq
 459252251     gbbct5.seq
 257412073     gbbct50.seq
 499968439     gbbct51.seq
 495916754     gbbct52.seq
 486276921     gbbct53.seq
 492099661     gbbct54.seq
 475089042     gbbct55.seq
 490136102     gbbct56.seq
 485836744     gbbct57.seq
 498334127     gbbct58.seq
 496791224     gbbct59.seq
 102203256     gbbct6.seq
 285019305     gbbct60.seq
 491473852     gbbct61.seq
 494313903     gbbct62.seq
 495819854     gbbct63.seq
 498720135     gbbct64.seq
 499102885     gbbct65.seq
 261686539     gbbct66.seq
 498325371     gbbct67.seq
 499957835     gbbct68.seq
 495804273     gbbct69.seq
 282425384     gbbct7.seq
 484333800     gbbct70.seq
 397949660     gbbct71.seq
 494947599     gbbct72.seq
 499548261     gbbct73.seq
 497908174     gbbct74.seq
 271474900     gbbct75.seq
 499835926     gbbct76.seq
 495463394     gbbct77.seq
 496855044     gbbct78.seq
  74829632     gbbct79.seq
 499564851     gbbct8.seq
 489627632     gbbct80.seq
 498990868     gbbct81.seq
 499930913     gbbct82.seq
 389027549     gbbct83.seq
 499874268     gbbct84.seq
 498123825     gbbct85.seq
 499291277     gbbct86.seq
 491407518     gbbct87.seq
  13752575     gbbct88.seq
 493145411     gbbct89.seq
 496086615     gbbct9.seq
 494743357     gbbct90.seq
 499620424     gbbct91.seq
 498208073     gbbct92.seq
 176919713     gbbct93.seq
 494226510     gbbct94.seq
 492528454     gbbct95.seq
 493219495     gbbct96.seq
 498624396     gbbct97.seq
  85714970     gbbct98.seq
 498997227     gbbct99.seq
    381735     gbchg.txt
 499997258     gbcon1.seq
 499686186     gbcon10.seq
 499794319     gbcon100.seq
 331364568     gbcon101.seq
 499999517     gbcon102.seq
 499999659     gbcon103.seq
 499998518     gbcon104.seq
  20233037     gbcon105.seq
 500000206     gbcon106.seq
 499999439     gbcon107.seq
 165524598     gbcon108.seq
 499621054     gbcon109.seq
 495607092     gbcon11.seq
 499996742     gbcon110.seq
 499917029     gbcon111.seq
 276218511     gbcon112.seq
 499999876     gbcon113.seq
 499999395     gbcon114.seq
 222253215     gbcon115.seq
  45836617     gbcon116.seq
 499999805     gbcon117.seq
 499998236     gbcon118.seq
 449243282     gbcon119.seq
 496318484     gbcon12.seq
 499998414     gbcon120.seq
 499998806     gbcon121.seq
 499999294     gbcon122.seq
 196459976     gbcon123.seq
 499998272     gbcon124.seq
 500000035     gbcon125.seq
 238709560     gbcon126.seq
 499999947     gbcon127.seq
 466614733     gbcon128.seq
 499999384     gbcon129.seq
 376593711     gbcon13.seq
 499998553     gbcon130.seq
 267064848     gbcon131.seq
 499999541     gbcon132.seq
 499990800     gbcon133.seq
 499946658     gbcon134.seq
 106914672     gbcon135.seq
 499999192     gbcon136.seq
 499999540     gbcon137.seq
 179134232     gbcon138.seq
 499998502     gbcon139.seq
 499995767     gbcon14.seq
 499998651     gbcon140.seq
  22645865     gbcon141.seq
 499889958     gbcon142.seq
 499998366     gbcon143.seq
 440248761     gbcon144.seq
 499928272     gbcon145.seq
 499998055     gbcon146.seq
 374222325     gbcon147.seq
 499993470     gbcon148.seq
 499938374     gbcon149.seq
 499998618     gbcon15.seq
 373801574     gbcon150.seq
 499995421     gbcon151.seq
 499998913     gbcon152.seq
 200061508     gbcon153.seq
 499996555     gbcon154.seq
 499951545     gbcon155.seq
 499999989     gbcon156.seq
 144765078     gbcon157.seq
 499830763     gbcon158.seq
 499984873     gbcon159.seq
 499999439     gbcon16.seq
 499990883     gbcon160.seq
 380046619     gbcon161.seq
 499997860     gbcon162.seq
 499994785     gbcon163.seq
 417273036     gbcon164.seq
 499999531     gbcon165.seq
 499998746     gbcon166.seq
 499998544     gbcon167.seq
 271279165     gbcon168.seq
 499999711     gbcon169.seq
  81389816     gbcon17.seq
 499999762     gbcon170.seq
 499498197     gbcon171.seq
 499997507     gbcon172.seq
 195634880     gbcon173.seq
 499997202     gbcon174.seq
 499999213     gbcon175.seq
 141106379     gbcon176.seq
 499997150     gbcon177.seq
 500000004     gbcon178.seq
 499993405     gbcon179.seq
 499998430     gbcon18.seq
 370266283     gbcon180.seq
 499990458     gbcon181.seq
 499995255     gbcon182.seq
 499994692     gbcon183.seq
  34087475     gbcon184.seq
 499998242     gbcon185.seq
 499996646     gbcon186.seq
 499109337     gbcon187.seq
  30794107     gbcon188.seq
 499969252     gbcon189.seq
 499998753     gbcon19.seq
 499997251     gbcon190.seq
 499999368     gbcon191.seq
 167005846     gbcon192.seq
 499998392     gbcon193.seq
 499998932     gbcon194.seq
  37638463     gbcon195.seq
 499997011     gbcon196.seq
 499998344     gbcon197.seq
 499999392     gbcon198.seq
 500000188     gbcon199.seq
 499988848     gbcon2.seq
 499939241     gbcon20.seq
 119257753     gbcon200.seq
 499999559     gbcon201.seq
 499999244     gbcon202.seq
 499993177     gbcon203.seq
 499999388     gbcon204.seq
  87022578     gbcon205.seq
 284980577     gbcon21.seq
 499480316     gbcon22.seq
 125744383     gbcon23.seq
 126402369     gbcon24.seq
 499989972     gbcon25.seq
 499997151     gbcon26.seq
  26019784     gbcon27.seq
 499999414     gbcon28.seq
 499998297     gbcon29.seq
 499991903     gbcon3.seq
 448013576     gbcon30.seq
 499999057     gbcon31.seq
 499998568     gbcon32.seq
 499999100     gbcon33.seq
  41918782     gbcon34.seq
 500000081     gbcon35.seq
 499998540     gbcon36.seq
 277009775     gbcon37.seq
 499996336     gbcon38.seq
 499998469     gbcon39.seq
  92789364     gbcon4.seq
 270612827     gbcon40.seq
 499996532     gbcon41.seq
 499996905     gbcon42.seq
 385374935     gbcon43.seq
 499997390     gbcon44.seq
 499999185     gbcon45.seq
 176580283     gbcon46.seq
 499999848     gbcon47.seq
 499997718     gbcon48.seq
 238773972     gbcon49.seq
 499901495     gbcon5.seq
 499997628     gbcon50.seq
 499995125     gbcon51.seq
 335698760     gbcon52.seq
 499996299     gbcon53.seq
 499999132     gbcon54.seq
 298461041     gbcon55.seq
 499995314     gbcon56.seq
 499999014     gbcon57.seq
 259899669     gbcon58.seq
 499996880     gbcon59.seq
 494542451     gbcon6.seq
 499997062     gbcon60.seq
 187377116     gbcon61.seq
 499996720     gbcon62.seq
 499999826     gbcon63.seq
 364586197     gbcon64.seq
 499993696     gbcon65.seq
 499999904     gbcon66.seq
 386119955     gbcon67.seq
 499993762     gbcon68.seq
 472787618     gbcon69.seq
 494412971     gbcon7.seq
 173591654     gbcon70.seq
 499999661     gbcon71.seq
  44478791     gbcon72.seq
 499982868     gbcon73.seq
 203591372     gbcon74.seq
 199554915     gbcon75.seq
 499816838     gbcon76.seq
 499996503     gbcon77.seq
 386508640     gbcon78.seq
 499527910     gbcon79.seq
 499919424     gbcon8.seq
 495870137     gbcon80.seq
 499838059     gbcon81.seq
 338197862     gbcon82.seq
 499945226     gbcon83.seq
 499999133     gbcon84.seq
 499997814     gbcon85.seq
 230871767     gbcon86.seq
 499999433     gbcon87.seq
 499999510     gbcon88.seq
 131436020     gbcon89.seq
 498593486     gbcon9.seq
 500000192     gbcon90.seq
 499998918     gbcon91.seq
 499999164     gbcon92.seq
 268005626     gbcon93.seq
 499997490     gbcon94.seq
 499994169     gbcon95.seq
 180888693     gbcon96.seq
 499994299     gbcon97.seq
 499618763     gbcon98.seq
 499968205     gbcon99.seq
    209329     gbdel.txt
 499998799     gbenv1.seq
 499999769     gbenv10.seq
 499999289     gbenv11.seq
 495305708     gbenv12.seq
 499999267     gbenv13.seq
 499998723     gbenv14.seq
 173571762     gbenv15.seq
 499852026     gbenv16.seq
 500000189     gbenv17.seq
 499999149     gbenv18.seq
  70329124     gbenv19.seq
 499998978     gbenv2.seq
 499999163     gbenv20.seq
 499997601     gbenv21.seq
 177726795     gbenv22.seq
 499999525     gbenv23.seq
 499996634     gbenv24.seq
 499998595     gbenv25.seq
  46075486     gbenv26.seq
 499998748     gbenv27.seq
 499998473     gbenv28.seq
 192024203     gbenv29.seq
 499998581     gbenv3.seq
 499996178     gbenv30.seq
 499998649     gbenv31.seq
 333176042     gbenv32.seq
 499997738     gbenv33.seq
 500000256     gbenv34.seq
 463274435     gbenv35.seq
 499999627     gbenv36.seq
 499999773     gbenv37.seq
 334656606     gbenv38.seq
 499997716     gbenv39.seq
 499999327     gbenv4.seq
 499999689     gbenv40.seq
 393488305     gbenv41.seq
 499999065     gbenv42.seq
 500000087     gbenv43.seq
 340213730     gbenv44.seq
 499999726     gbenv45.seq
 500000233     gbenv46.seq
 236918991     gbenv47.seq
 499999567     gbenv48.seq
 499997913     gbenv49.seq
  37118787     gbenv5.seq
 378097461     gbenv50.seq
 499998448     gbenv51.seq
 499999583     gbenv52.seq
 445562308     gbenv53.seq
 499999876     gbenv54.seq
 499998138     gbenv55.seq
 499998436     gbenv56.seq
 177892274     gbenv57.seq
 500000262     gbenv6.seq
 499997738     gbenv7.seq
  53638902     gbenv8.seq
 499999246     gbenv9.seq
 499997544     gbest1.seq
 499997880     gbest10.seq
 499999304     gbest100.seq
 500000017     gbest101.seq
 499999843     gbest102.seq
 500000070     gbest103.seq
  25046824     gbest104.seq
 499998629     gbest105.seq
 499999321     gbest106.seq
 499998993     gbest107.seq
 499997744     gbest108.seq
   9459140     gbest109.seq
 499998301     gbest11.seq
 499998446     gbest110.seq
 499997650     gbest111.seq
 499999020     gbest112.seq
 499999838     gbest113.seq
  23451057     gbest114.seq
 499998597     gbest115.seq
 499998248     gbest116.seq
 499998513     gbest117.seq
  11662882     gbest118.seq
 499997809     gbest119.seq
 474186201     gbest12.seq
 499997466     gbest120.seq
 499997861     gbest121.seq
  68177058     gbest122.seq
 499994263     gbest123.seq
 499997786     gbest124.seq
 223701769     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499998495     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 499998259     gbest135.seq
 499997142     gbest136.seq
 499997183     gbest137.seq
  98120624     gbest138.seq
 499997468     gbest139.seq
 249663956     gbest14.seq
 499998482     gbest140.seq
 499998277     gbest141.seq
 499998684     gbest142.seq
  24925322     gbest143.seq
 499997669     gbest144.seq
 499999437     gbest145.seq
 499998142     gbest146.seq
 499998518     gbest147.seq
  30401454     gbest148.seq
 499999670     gbest149.seq
 499998856     gbest15.seq
 499999456     gbest150.seq
 499998412     gbest151.seq
 321959902     gbest152.seq
 499997320     gbest153.seq
 499999385     gbest154.seq
 500000038     gbest155.seq
 499998689     gbest156.seq
  21491766     gbest157.seq
 499999702     gbest158.seq
 499999521     gbest159.seq
 499999798     gbest16.seq
 499996841     gbest160.seq
 499998882     gbest161.seq
   9723108     gbest162.seq
 499999412     gbest163.seq
 500000006     gbest164.seq
 499997360     gbest165.seq
 499996336     gbest166.seq
  81988721     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 420834751     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499999958     gbest174.seq
 499997684     gbest175.seq
 499999843     gbest176.seq
  66106728     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499998416     gbest18.seq
 500000063     gbest180.seq
 499998199     gbest181.seq
 499996061     gbest182.seq
 499998568     gbest183.seq
  42355309     gbest184.seq
 499997635     gbest185.seq
 499998365     gbest186.seq
 500000139     gbest187.seq
 499997695     gbest188.seq
  40418224     gbest189.seq
 499999398     gbest19.seq
 499998666     gbest190.seq
 499998827     gbest191.seq
 499998357     gbest192.seq
 499999708     gbest193.seq
  12146790     gbest194.seq
 499999587     gbest195.seq
 500000013     gbest196.seq
 499998985     gbest197.seq
 499996194     gbest198.seq
  25113925     gbest199.seq
 499998652     gbest2.seq
 260123293     gbest20.seq
 499998542     gbest200.seq
 499996677     gbest201.seq
 500000042     gbest202.seq
 499997977     gbest203.seq
  30654152     gbest204.seq
  13610371     gbest205.seq
 499999221     gbest206.seq
 499998120     gbest207.seq
 328280744     gbest208.seq
 499997323     gbest209.seq
 499999606     gbest21.seq
 499995929     gbest210.seq
 316764106     gbest211.seq
 499998724     gbest212.seq
 499999372     gbest213.seq
 265289976     gbest214.seq
 499999161     gbest215.seq
 499998973     gbest216.seq
 268025739     gbest217.seq
 499996246     gbest218.seq
 499999806     gbest219.seq
 499997789     gbest22.seq
 499997963     gbest220.seq
 500000123     gbest221.seq
  48985942     gbest222.seq
 499999312     gbest223.seq
 499999407     gbest224.seq
 499999479     gbest225.seq
 499995116     gbest226.seq
  46446852     gbest227.seq
 499999053     gbest228.seq
 499996806     gbest229.seq
 242264308     gbest23.seq
 174825403     gbest230.seq
 499997907     gbest231.seq
 499999624     gbest232.seq
 499999509     gbest233.seq
 478341574     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499998838     gbest24.seq
 499999466     gbest240.seq
 499997560     gbest241.seq
 495413728     gbest242.seq
 499998531     gbest243.seq
 499998185     gbest244.seq
 499999561     gbest245.seq
 499998790     gbest246.seq
  24180385     gbest247.seq
 499999264     gbest248.seq
 499999054     gbest249.seq
 499997816     gbest25.seq
 490069177     gbest250.seq
 499995571     gbest251.seq
 499998200     gbest252.seq
 499999520     gbest253.seq
 499997474     gbest254.seq
  15354105     gbest255.seq
 499996559     gbest256.seq
 499999066     gbest257.seq
 499989799     gbest258.seq
 499995841     gbest259.seq
 499999429     gbest26.seq
  72988411     gbest260.seq
 499997472     gbest261.seq
 499997495     gbest262.seq
 499996504     gbest263.seq
 500000069     gbest264.seq
  10773741     gbest265.seq
 499997806     gbest266.seq
 499999532     gbest267.seq
 499999492     gbest268.seq
 499999837     gbest269.seq
 499998571     gbest27.seq
  50717151     gbest270.seq
 499999016     gbest271.seq
 499998969     gbest272.seq
 499998846     gbest273.seq
 119014210     gbest274.seq
 499997034     gbest275.seq
 499998984     gbest276.seq
 499998331     gbest277.seq
 499997611     gbest278.seq
  50680716     gbest279.seq
  48265826     gbest28.seq
 499999317     gbest280.seq
 499997412     gbest281.seq
 499998676     gbest282.seq
 499997070     gbest283.seq
  55624929     gbest284.seq
 499997730     gbest285.seq
 499999581     gbest286.seq
 499997280     gbest287.seq
 499999744     gbest288.seq
  11297119     gbest289.seq
 499999995     gbest29.seq
 499997949     gbest290.seq
 499999786     gbest291.seq
 499999462     gbest292.seq
 499998686     gbest293.seq
  25211693     gbest294.seq
 499998631     gbest295.seq
 499999758     gbest296.seq
 485611090     gbest297.seq
 499997440     gbest298.seq
 499998368     gbest299.seq
 499997776     gbest3.seq
 499998086     gbest30.seq
 499999080     gbest300.seq
 499998825     gbest301.seq
   5318213     gbest302.seq
 500000070     gbest303.seq
 499999031     gbest304.seq
 499999430     gbest305.seq
 499999675     gbest306.seq
   7714507     gbest307.seq
 499998952     gbest308.seq
 499998801     gbest309.seq
 499999100     gbest31.seq
 499997247     gbest310.seq
 421290158     gbest311.seq
 500000036     gbest312.seq
 499997700     gbest313.seq
 499999232     gbest314.seq
 496011438     gbest315.seq
 499998773     gbest316.seq
 499997415     gbest317.seq
 467914793     gbest318.seq
 499999035     gbest319.seq
 486456248     gbest32.seq
 499999234     gbest320.seq
 499999341     gbest321.seq
 499999715     gbest322.seq
  39519363     gbest323.seq
 500000256     gbest324.seq
 500000005     gbest325.seq
 499999299     gbest326.seq
 492928175     gbest327.seq
 499998749     gbest328.seq
 499997759     gbest329.seq
 499998458     gbest33.seq
 499999540     gbest330.seq
 499997875     gbest331.seq
  54900833     gbest332.seq
 499999943     gbest333.seq
 499999960     gbest334.seq
 499998379     gbest335.seq
 469183035     gbest336.seq
 499998299     gbest337.seq
 499997892     gbest338.seq
 499998449     gbest339.seq
 499997139     gbest34.seq
 499999619     gbest340.seq
  17904550     gbest341.seq
 499998607     gbest342.seq
 491341195     gbest343.seq
 499998703     gbest344.seq
 499998922     gbest345.seq
 499997410     gbest346.seq
 499999867     gbest347.seq
   5636410     gbest348.seq
 499999544     gbest349.seq
 499999697     gbest35.seq
 500000150     gbest350.seq
 499999880     gbest351.seq
 445215906     gbest352.seq
 499998629     gbest353.seq
 500000207     gbest354.seq
 499999612     gbest355.seq
 387745888     gbest356.seq
 499998924     gbest357.seq
 499997356     gbest358.seq
 499999906     gbest359.seq
 464800400     gbest36.seq
 499999387     gbest360.seq
  20897314     gbest361.seq
 499998188     gbest362.seq
 500000216     gbest363.seq
 500000193     gbest364.seq
 499999567     gbest365.seq
  56798116     gbest366.seq
 166258344     gbest367.seq
 499998124     gbest368.seq
 499999211     gbest369.seq
 499998459     gbest37.seq
 499999127     gbest370.seq
 499999965     gbest371.seq
  86596666     gbest372.seq
 499997252     gbest373.seq
 499999842     gbest374.seq
 499997446     gbest375.seq
 499996815     gbest376.seq
 164840295     gbest377.seq
 499999594     gbest378.seq
 499998086     gbest379.seq
 499998008     gbest38.seq
 499998197     gbest380.seq
 499998791     gbest381.seq
 152683169     gbest382.seq
 499997221     gbest383.seq
 499999329     gbest384.seq
 499997189     gbest385.seq
 497166333     gbest386.seq
 499997498     gbest387.seq
 499998709     gbest388.seq
 499998596     gbest389.seq
 499997178     gbest39.seq
  64052070     gbest390.seq
 499998385     gbest391.seq
 499998728     gbest392.seq
 499996496     gbest393.seq
 499997691     gbest394.seq
  83414510     gbest395.seq
 499996944     gbest396.seq
 499996739     gbest397.seq
 499997570     gbest398.seq
 499998818     gbest399.seq
 434600055     gbest4.seq
 499997938     gbest40.seq
  82858681     gbest400.seq
 499997855     gbest401.seq
 499998092     gbest402.seq
 499999582     gbest403.seq
 500000164     gbest404.seq
  50728119     gbest405.seq
 499998820     gbest406.seq
 499997816     gbest407.seq
 499999702     gbest408.seq
 499997206     gbest409.seq
 191357351     gbest41.seq
  90214994     gbest410.seq
 499999183     gbest411.seq
 499998006     gbest412.seq
 500000132     gbest413.seq
 499996677     gbest414.seq
 124589880     gbest415.seq
 499999474     gbest416.seq
 329352020     gbest417.seq
 500000254     gbest418.seq
 499998835     gbest419.seq
 499997364     gbest42.seq
 499999607     gbest420.seq
 499997838     gbest421.seq
  54913398     gbest422.seq
 499999330     gbest423.seq
 499999774     gbest424.seq
 499996219     gbest425.seq
 409977293     gbest426.seq
 499997260     gbest427.seq
 499999283     gbest428.seq
 335979604     gbest429.seq
 499997237     gbest43.seq
 499999949     gbest430.seq
 500000227     gbest431.seq
 261230544     gbest432.seq
 499999296     gbest433.seq
 499998341     gbest434.seq
 458264768     gbest435.seq
 499998830     gbest436.seq
 500000090     gbest437.seq
 307334807     gbest438.seq
 499997288     gbest439.seq
 499997245     gbest44.seq
 499999169     gbest440.seq
 329772669     gbest441.seq
 499997075     gbest442.seq
 499998558     gbest443.seq
 187654716     gbest444.seq
 499999916     gbest445.seq
 499997943     gbest446.seq
 118594788     gbest447.seq
 499998627     gbest448.seq
 500000126     gbest449.seq
 499996431     gbest45.seq
 140963965     gbest450.seq
 500000200     gbest451.seq
 499999541     gbest452.seq
 146594251     gbest453.seq
 499998942     gbest454.seq
 500000066     gbest455.seq
 499999137     gbest456.seq
 487834854     gbest457.seq
 499999035     gbest458.seq
 499997432     gbest459.seq
 189558363     gbest46.seq
 499999827     gbest460.seq
 499998074     gbest461.seq
  19453639     gbest462.seq
 170019681     gbest463.seq
 499998234     gbest464.seq
 499997948     gbest465.seq
 499996964     gbest466.seq
 499998273     gbest467.seq
  23774165     gbest468.seq
 499999458     gbest469.seq
 499999613     gbest47.seq
 499998882     gbest470.seq
 499999419     gbest471.seq
 500000249     gbest472.seq
  60660807     gbest473.seq
 499998201     gbest474.seq
 499996487     gbest475.seq
 499998922     gbest476.seq
 499999606     gbest477.seq
  57608613     gbest478.seq
 499999428     gbest479.seq
 499997471     gbest48.seq
 499998005     gbest480.seq
 499997648     gbest481.seq
 499999115     gbest482.seq
  37372779     gbest483.seq
 499999913     gbest484.seq
 499999267     gbest485.seq
 499999896     gbest486.seq
 500000088     gbest487.seq
  64491292     gbest488.seq
 499997662     gbest489.seq
 499998719     gbest49.seq
 499999130     gbest490.seq
 499999934     gbest491.seq
 206715962     gbest492.seq
 499996334     gbest493.seq
 499999744     gbest494.seq
 499997866     gbest495.seq
 499998559     gbest496.seq
  88011833     gbest497.seq
 499998125     gbest498.seq
 499998609     gbest499.seq
 499998155     gbest5.seq
 474512577     gbest50.seq
 499999195     gbest500.seq
 499997258     gbest501.seq
  53358710     gbest502.seq
 499998717     gbest503.seq
 499997860     gbest504.seq
 499999996     gbest505.seq
 499999277     gbest506.seq
 141956910     gbest507.seq
 499999254     gbest508.seq
 499998227     gbest509.seq
 499998341     gbest51.seq
 499999317     gbest510.seq
 499997700     gbest511.seq
 139089832     gbest512.seq
 499997763     gbest513.seq
 499998155     gbest514.seq
 499999016     gbest515.seq
 500000145     gbest516.seq
  16904523     gbest517.seq
 174254470     gbest518.seq
 499998928     gbest519.seq
 355703064     gbest52.seq
 499998021     gbest520.seq
  83063372     gbest521.seq
 499997944     gbest522.seq
 499998345     gbest523.seq
  75198166     gbest524.seq
 499999291     gbest525.seq
 499999095     gbest526.seq
 499998072     gbest527.seq
 499996371     gbest528.seq
  94416764     gbest529.seq
 499997477     gbest53.seq
 499999382     gbest530.seq
 499998727     gbest531.seq
 499998249     gbest532.seq
 499997618     gbest533.seq
   9145532     gbest534.seq
 499999430     gbest535.seq
 499998660     gbest536.seq
 499998262     gbest537.seq
 477035449     gbest538.seq
 499998366     gbest539.seq
 499999368     gbest54.seq
 499998262     gbest540.seq
 499997502     gbest541.seq
 335836960     gbest542.seq
 499998900     gbest543.seq
 499999161     gbest544.seq
 499998712     gbest545.seq
 467601983     gbest546.seq
 499998997     gbest547.seq
 499998220     gbest548.seq
 499998640     gbest549.seq
 499998244     gbest55.seq
 499997208     gbest550.seq
  33772444     gbest551.seq
 499996997     gbest552.seq
 499997866     gbest553.seq
 499996671     gbest554.seq
 499999192     gbest555.seq
  44069972     gbest556.seq
 499996534     gbest557.seq
 499999486     gbest558.seq
 499999762     gbest559.seq
 483303423     gbest56.seq
 499998286     gbest560.seq
   9393571     gbest561.seq
 499998309     gbest562.seq
 499998494     gbest563.seq
 392781821     gbest564.seq
 499998337     gbest565.seq
 499997718     gbest566.seq
  86725795     gbest567.seq
 499998740     gbest568.seq
 499998391     gbest569.seq
 499998261     gbest57.seq
  50311057     gbest570.seq
 499999914     gbest571.seq
 499998798     gbest572.seq
 499999072     gbest573.seq
 254441988     gbest574.seq
 500000177     gbest58.seq
 499998973     gbest59.seq
 499998099     gbest6.seq
 463542876     gbest60.seq
 499998917     gbest61.seq
 499998973     gbest62.seq
 500000217     gbest63.seq
 499997786     gbest64.seq
   6727062     gbest65.seq
 499996708     gbest66.seq
 499998678     gbest67.seq
 500000199     gbest68.seq
 482563225     gbest69.seq
 499998408     gbest7.seq
 499999010     gbest70.seq
 499997975     gbest71.seq
 499998819     gbest72.seq
 499997282     gbest73.seq
   7362559     gbest74.seq
 123216203     gbest75.seq
 499999005     gbest76.seq
 499999378     gbest77.seq
 499999069     gbest78.seq
 499999812     gbest79.seq
 469232868     gbest8.seq
   5450770     gbest80.seq
 499998041     gbest81.seq
 499998813     gbest82.seq
 499996196     gbest83.seq
 500000197     gbest84.seq
  45841590     gbest85.seq
 499999280     gbest86.seq
 499997878     gbest87.seq
 499998692     gbest88.seq
 499997962     gbest89.seq
 499997802     gbest9.seq
  52436824     gbest90.seq
 499998745     gbest91.seq
 499999084     gbest92.seq
 499998525     gbest93.seq
 470693125     gbest94.seq
 499999715     gbest95.seq
 499999638     gbest96.seq
 499997206     gbest97.seq
 498560370     gbest98.seq
  35234983     gbest99.seq
 500000049     gbgss1.seq
  55278190     gbgss10.seq
 499999043     gbgss100.seq
 499998323     gbgss101.seq
 499999275     gbgss102.seq
 466499750     gbgss103.seq
 499997164     gbgss104.seq
 499999629     gbgss105.seq
 500000188     gbgss106.seq
 499999848     gbgss107.seq
  40292488     gbgss108.seq
 499997736     gbgss109.seq
 499998998     gbgss11.seq
 500000122     gbgss110.seq
 500000164     gbgss111.seq
 316319609     gbgss112.seq
 499998282     gbgss113.seq
 499998924     gbgss114.seq
 499998333     gbgss115.seq
 499997840     gbgss116.seq
 103720750     gbgss117.seq
 499998525     gbgss118.seq
 499998144     gbgss119.seq
 499998117     gbgss12.seq
 499998256     gbgss120.seq
 499999634     gbgss121.seq
   5770896     gbgss122.seq
 499999867     gbgss123.seq
 499999676     gbgss124.seq
 499999794     gbgss125.seq
 449066275     gbgss126.seq
 499997882     gbgss127.seq
 499997140     gbgss128.seq
 499999220     gbgss129.seq
 499998574     gbgss13.seq
 499996616     gbgss130.seq
  29590310     gbgss131.seq
 499997877     gbgss132.seq
 209679641     gbgss133.seq
 500000110     gbgss134.seq
 499999602     gbgss135.seq
 499997969     gbgss136.seq
 500000125     gbgss137.seq
  14831686     gbgss138.seq
 499996726     gbgss139.seq
 496620460     gbgss14.seq
 499997951     gbgss140.seq
 499999528     gbgss141.seq
 499997001     gbgss142.seq
  16786266     gbgss143.seq
 499997786     gbgss144.seq
 499996974     gbgss145.seq
 499999546     gbgss146.seq
 499996547     gbgss147.seq
   2045398     gbgss148.seq
 499997382     gbgss149.seq
 499998303     gbgss15.seq
 499998165     gbgss150.seq
 499998480     gbgss151.seq
 499997367     gbgss152.seq
   6835799     gbgss153.seq
 373479550     gbgss154.seq
 499999304     gbgss155.seq
 499999385     gbgss156.seq
 499997177     gbgss157.seq
 447628034     gbgss158.seq
 499998740     gbgss159.seq
 499999188     gbgss16.seq
 500000150     gbgss160.seq
 499997781     gbgss161.seq
 452001882     gbgss162.seq
 499997998     gbgss163.seq
 499999955     gbgss164.seq
 499997965     gbgss165.seq
 456856217     gbgss166.seq
 499997324     gbgss167.seq
 499998331     gbgss168.seq
 499998722     gbgss169.seq
 499999792     gbgss17.seq
 362069154     gbgss170.seq
 499999614     gbgss171.seq
 499998944     gbgss172.seq
 215505768     gbgss173.seq
 499998125     gbgss174.seq
 499998134     gbgss175.seq
  67002892     gbgss176.seq
 499999079     gbgss177.seq
 499999336     gbgss178.seq
 499998518     gbgss179.seq
 480336126     gbgss18.seq
 499999975     gbgss180.seq
  49671428     gbgss181.seq
 500000156     gbgss182.seq
 499999211     gbgss183.seq
 500000209     gbgss184.seq
 499999501     gbgss185.seq
  39656212     gbgss186.seq
 499999015     gbgss187.seq
 500000221     gbgss188.seq
  23203602     gbgss189.seq
 499998653     gbgss19.seq
 499998791     gbgss190.seq
 499996639     gbgss191.seq
 499998774     gbgss192.seq
 495024971     gbgss193.seq
 499999000     gbgss194.seq
 499999251     gbgss195.seq
 499999609     gbgss196.seq
 499999185     gbgss197.seq
   4843731     gbgss198.seq
 499998820     gbgss199.seq
 499998288     gbgss2.seq
 324867797     gbgss20.seq
 499998733     gbgss200.seq
 499997041     gbgss201.seq
 479852022     gbgss202.seq
 499997737     gbgss203.seq
 499997752     gbgss204.seq
  56421213     gbgss205.seq
 499997703     gbgss206.seq
 500000150     gbgss207.seq
 499999163     gbgss208.seq
 481468771     gbgss209.seq
 499999364     gbgss21.seq
 499999908     gbgss210.seq
 499997933     gbgss211.seq
 499998148     gbgss212.seq
 488124681     gbgss213.seq
 499999175     gbgss214.seq
 499999239     gbgss215.seq
 499999176     gbgss216.seq
 467990953     gbgss217.seq
 499999749     gbgss218.seq
 499999749     gbgss219.seq
 499997480     gbgss22.seq
 499997938     gbgss220.seq
   6989681     gbgss221.seq
 499999723     gbgss222.seq
 499999684     gbgss223.seq
 499998774     gbgss224.seq
 264582471     gbgss225.seq
 499998308     gbgss226.seq
 499997919     gbgss227.seq
 499999010     gbgss228.seq
 429127642     gbgss229.seq
 499997001     gbgss23.seq
 499998680     gbgss230.seq
 499997412     gbgss231.seq
 499999464     gbgss232.seq
 468539336     gbgss233.seq
 499999119     gbgss234.seq
 499999511     gbgss235.seq
 499996654     gbgss236.seq
 418138488     gbgss237.seq
 499999568     gbgss238.seq
 499996782     gbgss239.seq
 499998002     gbgss24.seq
 499999250     gbgss240.seq
 499998270     gbgss241.seq
  16446436     gbgss242.seq
 315572447     gbgss243.seq
 499997744     gbgss244.seq
 499999931     gbgss245.seq
 499999074     gbgss246.seq
 474816353     gbgss247.seq
 499998755     gbgss248.seq
 499999852     gbgss249.seq
  47915040     gbgss25.seq
 499999457     gbgss250.seq
 499998339     gbgss251.seq
  36094621     gbgss252.seq
 499998608     gbgss253.seq
 499997686     gbgss254.seq
 499998198     gbgss255.seq
 499999134     gbgss256.seq
  19020583     gbgss257.seq
 499999905     gbgss258.seq
 499998046     gbgss259.seq
 499998203     gbgss26.seq
 499999794     gbgss260.seq
   1598075     gbgss261.seq
 499999437     gbgss262.seq
 499999239     gbgss263.seq
 499999430     gbgss264.seq
 480892291     gbgss265.seq
 499999436     gbgss266.seq
 499997879     gbgss267.seq
 300937481     gbgss268.seq
 499997734     gbgss27.seq
 500000177     gbgss28.seq
 499999547     gbgss29.seq
 499997141     gbgss3.seq
  28355345     gbgss30.seq
 499999620     gbgss31.seq
 499999369     gbgss32.seq
 499997326     gbgss33.seq
 474347611     gbgss34.seq
 499997672     gbgss35.seq
 499999711     gbgss36.seq
 499998766     gbgss37.seq
 499999331     gbgss38.seq
  10249803     gbgss39.seq
 499999376     gbgss4.seq
 499998043     gbgss40.seq
 500000104     gbgss41.seq
 168816398     gbgss42.seq
 499998215     gbgss43.seq
 499997776     gbgss44.seq
 499997935     gbgss45.seq
 487170352     gbgss46.seq
 500000097     gbgss47.seq
 499997981     gbgss48.seq
 499999384     gbgss49.seq
  37736809     gbgss5.seq
 444017100     gbgss50.seq
 499998446     gbgss51.seq
 500000163     gbgss52.seq
 499998853     gbgss53.seq
 420972611     gbgss54.seq
 499999264     gbgss55.seq
 499999392     gbgss56.seq
 499998883     gbgss57.seq
 427742687     gbgss58.seq
  67685650     gbgss59.seq
 499999011     gbgss6.seq
 500000215     gbgss60.seq
 499997984     gbgss61.seq
 500000021     gbgss62.seq
 493791092     gbgss63.seq
 499998150     gbgss64.seq
 499998593     gbgss65.seq
 500000114     gbgss66.seq
 499531795     gbgss67.seq
 499998193     gbgss68.seq
 499999621     gbgss69.seq
 499997407     gbgss7.seq
 499997616     gbgss70.seq
 419666508     gbgss71.seq
 499999747     gbgss72.seq
 499998402     gbgss73.seq
 499998080     gbgss74.seq
  33896316     gbgss75.seq
 499997046     gbgss76.seq
 499999706     gbgss77.seq
 499999836     gbgss78.seq
 490829495     gbgss79.seq
 499999701     gbgss8.seq
 499997550     gbgss80.seq
 499999765     gbgss81.seq
 499999304     gbgss82.seq
 499999239     gbgss83.seq
   6078731     gbgss84.seq
 499997751     gbgss85.seq
 499999999     gbgss86.seq
 500000054     gbgss87.seq
 499999314     gbgss88.seq
  23821801     gbgss89.seq
 499997552     gbgss9.seq
 500000224     gbgss90.seq
 499999829     gbgss91.seq
 499999704     gbgss92.seq
 462802247     gbgss93.seq
 244248654     gbgss94.seq
 499999492     gbgss95.seq
 499998457     gbgss96.seq
 500000176     gbgss97.seq
 499997669     gbgss98.seq
  44651519     gbgss99.seq
 499991077     gbhtc1.seq
 499994049     gbhtc2.seq
 499986002     gbhtc3.seq
 330777725     gbhtc4.seq
 499999497     gbhtc5.seq
 437679499     gbhtc6.seq
 499999932     gbhtc7.seq
 167754104     gbhtc8.seq
 499943248     gbhtg1.seq
 499980395     gbhtg10.seq
 485099660     gbhtg11.seq
 499977093     gbhtg12.seq
 499847932     gbhtg13.seq
 499963690     gbhtg14.seq
 499701635     gbhtg15.seq
 474637907     gbhtg16.seq
 499709370     gbhtg17.seq
 499810451     gbhtg18.seq
 499965524     gbhtg19.seq
 499844091     gbhtg2.seq
 499990400     gbhtg20.seq
 473197912     gbhtg21.seq
 499917932     gbhtg22.seq
 499967590     gbhtg23.seq
 499096914     gbhtg24.seq
 499958810     gbhtg25.seq
 484456082     gbhtg26.seq
 499961346     gbhtg27.seq
 499870385     gbhtg28.seq
 268060905     gbhtg29.seq
 499869235     gbhtg3.seq
 499926573     gbhtg30.seq
 499802593     gbhtg31.seq
 224936253     gbhtg32.seq
 499948741     gbhtg33.seq
 499915552     gbhtg34.seq
 265459787     gbhtg35.seq
 499837354     gbhtg36.seq
 499950747     gbhtg37.seq
 223150986     gbhtg38.seq
 499802479     gbhtg39.seq
 499834959     gbhtg4.seq
 499974749     gbhtg40.seq
 234953070     gbhtg41.seq
 499825843     gbhtg42.seq
 499886984     gbhtg43.seq
 202126258     gbhtg44.seq
 499786893     gbhtg45.seq
 499928337     gbhtg46.seq
 205798564     gbhtg47.seq
 499978046     gbhtg48.seq
 499930426     gbhtg49.seq
 499930133     gbhtg5.seq
 193865093     gbhtg50.seq
 499927425     gbhtg51.seq
 499937279     gbhtg52.seq
 161358152     gbhtg53.seq
 499996941     gbhtg54.seq
 499996869     gbhtg55.seq
 252726342     gbhtg56.seq
 499940699     gbhtg57.seq
 499966944     gbhtg58.seq
 499998074     gbhtg59.seq
    507366     gbhtg6.seq
 167066155     gbhtg60.seq
 499929777     gbhtg61.seq
 499926029     gbhtg62.seq
 499877486     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499964636     gbhtg67.seq
 499900384     gbhtg68.seq
 499851291     gbhtg69.seq
 499821008     gbhtg7.seq
 394058723     gbhtg70.seq
 499999406     gbhtg71.seq
 499890741     gbhtg72.seq
 385409481     gbhtg73.seq
 499951564     gbhtg74.seq
 499970875     gbhtg75.seq
 383567862     gbhtg76.seq
 499964642     gbhtg77.seq
 499999264     gbhtg78.seq
 499814686     gbhtg79.seq
 499933798     gbhtg8.seq
 499762484     gbhtg80.seq
 499890598     gbhtg81.seq
 260093173     gbhtg82.seq
 499899409     gbhtg9.seq
 499902218     gbinv1.seq
 444875064     gbinv10.seq
 500000231     gbinv11.seq
 404109248     gbinv12.seq
 497208834     gbinv13.seq
 500000164     gbinv14.seq
 270485440     gbinv15.seq
 499998696     gbinv16.seq
 499998135     gbinv17.seq
 168931600     gbinv18.seq
 499997922     gbinv19.seq
 452714897     gbinv2.seq
 499997091     gbinv20.seq
 258864046     gbinv21.seq
 499983871     gbinv22.seq
 499999814     gbinv23.seq
 173800088     gbinv24.seq
 499997601     gbinv25.seq
 499997644     gbinv26.seq
 116122055     gbinv27.seq
 499996989     gbinv28.seq
 499997843     gbinv29.seq
 499997672     gbinv3.seq
 103316429     gbinv30.seq
 499999416     gbinv31.seq
 499997809     gbinv32.seq
 106965855     gbinv33.seq
 499997577     gbinv34.seq
 499999464     gbinv35.seq
 187770560     gbinv36.seq
 500000264     gbinv37.seq
 499997984     gbinv38.seq
 234733131     gbinv39.seq
 497370863     gbinv4.seq
 499998310     gbinv40.seq
 499998321     gbinv41.seq
 499999446     gbinv42.seq
 348858400     gbinv43.seq
 499998874     gbinv44.seq
 445991558     gbinv45.seq
 303968231     gbinv46.seq
  54947886     gbinv47.seq
  52917686     gbinv48.seq
 156788939     gbinv49.seq
 150265154     gbinv5.seq
 499998517     gbinv50.seq
 263270462     gbinv51.seq
 499998556     gbinv52.seq
 499997693     gbinv53.seq
 172341791     gbinv54.seq
 499362201     gbinv55.seq
 498953521     gbinv56.seq
 498830419     gbinv57.seq
 155132584     gbinv58.seq
 475486149     gbinv59.seq
 496486982     gbinv6.seq
 498944490     gbinv60.seq
 499242952     gbinv61.seq
 313901813     gbinv62.seq
 499996868     gbinv63.seq
 499997091     gbinv64.seq
 203843141     gbinv65.seq
 499998205     gbinv66.seq
 499998224     gbinv67.seq
 488311441     gbinv68.seq
 476450800     gbinv7.seq
 422530809     gbinv8.seq
 499999932     gbinv9.seq
 499999360     gbmam1.seq
 445458574     gbmam10.seq
 122412955     gbmam11.seq
 451114203     gbmam12.seq
 418062948     gbmam13.seq
 499818197     gbmam14.seq
 462376363     gbmam15.seq
 370510653     gbmam16.seq
 446296425     gbmam17.seq
 431104447     gbmam18.seq
 480602957     gbmam19.seq
  87211417     gbmam2.seq
 479109873     gbmam20.seq
 483903297     gbmam21.seq
 242483322     gbmam22.seq
   9943517     gbmam23.seq
  43989127     gbmam24.seq
  91322474     gbmam25.seq
  88810705     gbmam26.seq
   6365611     gbmam27.seq
  20918356     gbmam28.seq
 449542354     gbmam29.seq
  82812586     gbmam3.seq
 499999846     gbmam30.seq
 499976842     gbmam31.seq
 488223634     gbmam32.seq
  71295437     gbmam4.seq
  22570875     gbmam5.seq
   1268605     gbmam6.seq
 378312072     gbmam7.seq
 338653930     gbmam8.seq
 477859989     gbmam9.seq
  17231245     gbnew.txt
 499998082     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335317137     gbpat107.seq
 499998984     gbpat108.seq
 499999922     gbpat109.seq
 499996320     gbpat11.seq
 207985064     gbpat110.seq
 499857512     gbpat111.seq
 499997697     gbpat112.seq
 173996634     gbpat113.seq
 499999366     gbpat114.seq
 499998400     gbpat115.seq
 499999985     gbpat116.seq
   8433907     gbpat117.seq
 499659150     gbpat118.seq
 382771754     gbpat119.seq
 179041317     gbpat12.seq
 499997445     gbpat120.seq
 499996699     gbpat121.seq
 499993390     gbpat122.seq
 499999144     gbpat123.seq
  56244385     gbpat124.seq
 499988626     gbpat125.seq
 499998444     gbpat126.seq
 208382650     gbpat127.seq
 499999780     gbpat128.seq
 499999546     gbpat129.seq
 499993493     gbpat13.seq
  57204159     gbpat130.seq
 499997548     gbpat131.seq
 499997539     gbpat132.seq
 487285842     gbpat133.seq
 499999157     gbpat134.seq
 499998791     gbpat135.seq
  25826800     gbpat136.seq
 499991541     gbpat137.seq
 385111596     gbpat138.seq
 499999559     gbpat139.seq
 499999601     gbpat14.seq
 500000185     gbpat140.seq
 148478187     gbpat141.seq
 499998954     gbpat142.seq
 314421814     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499985655     gbpat148.seq
 125941966     gbpat149.seq
  62269843     gbpat15.seq
 499989559     gbpat150.seq
 499998073     gbpat151.seq
 499998591     gbpat152.seq
 500000091     gbpat153.seq
 169807234     gbpat154.seq
 500000145     gbpat155.seq
 425267856     gbpat156.seq
 500000202     gbpat157.seq
 500000034     gbpat158.seq
 499836775     gbpat159.seq
 500000081     gbpat16.seq
 353455169     gbpat160.seq
 499999569     gbpat161.seq
 499999181     gbpat162.seq
 289434443     gbpat163.seq
 499999087     gbpat164.seq
 499999151     gbpat165.seq
 499999535     gbpat166.seq
 100295510     gbpat167.seq
 499998267     gbpat168.seq
 499997006     gbpat169.seq
 499999143     gbpat17.seq
 499998122     gbpat170.seq
 499999325     gbpat171.seq
 301646449     gbpat172.seq
 499981153     gbpat173.seq
 499999982     gbpat174.seq
 499998398     gbpat175.seq
 499998753     gbpat176.seq
 354398121     gbpat177.seq
 497266283     gbpat178.seq
 499998457     gbpat179.seq
 421718763     gbpat18.seq
 499998534     gbpat180.seq
  86795664     gbpat181.seq
 499995058     gbpat182.seq
 500000008     gbpat183.seq
 499999825     gbpat184.seq
 499992006     gbpat185.seq
 206775142     gbpat186.seq
 500000054     gbpat187.seq
 499999577     gbpat188.seq
 321705067     gbpat189.seq
 499750534     gbpat19.seq
 499991396     gbpat190.seq
 499963719     gbpat191.seq
 500000213     gbpat192.seq
 419179279     gbpat193.seq
 499999776     gbpat2.seq
 499999569     gbpat20.seq
 499998632     gbpat21.seq
 341398532     gbpat22.seq
 499906384     gbpat23.seq
 499999521     gbpat24.seq
 499764420     gbpat25.seq
 496849354     gbpat26.seq
 161790851     gbpat27.seq
 499999428     gbpat28.seq
 499999886     gbpat29.seq
  61172787     gbpat3.seq
 213205625     gbpat30.seq
 499999775     gbpat31.seq
 406000064     gbpat32.seq
 499999495     gbpat33.seq
 499999994     gbpat34.seq
 125158635     gbpat35.seq
 500000066     gbpat36.seq
 499997510     gbpat37.seq
 499999316     gbpat38.seq
 135698768     gbpat39.seq
 499999196     gbpat4.seq
 500000135     gbpat40.seq
 498916705     gbpat41.seq
 498926787     gbpat42.seq
 499999669     gbpat43.seq
 138438686     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499998785     gbpat47.seq
  87741306     gbpat48.seq
 500000086     gbpat49.seq
 500000260     gbpat5.seq
 500000217     gbpat50.seq
 499999938     gbpat51.seq
 130915371     gbpat52.seq
 499999065     gbpat53.seq
 499999084     gbpat54.seq
 184978330     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 418188693     gbpat6.seq
 499638184     gbpat60.seq
 429847160     gbpat61.seq
 500000255     gbpat62.seq
 320387903     gbpat63.seq
 499999862     gbpat64.seq
 499999431     gbpat65.seq
 305399375     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999497     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499997752     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474414032     gbpat82.seq
 499999777     gbpat83.seq
 325490152     gbpat84.seq
 499999788     gbpat85.seq
 305089567     gbpat86.seq
 499997763     gbpat87.seq
 500000079     gbpat88.seq
 499996274     gbpat89.seq
 316931992     gbpat9.seq
 202392977     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499998879     gbpat93.seq
 252029108     gbpat94.seq
 499995178     gbpat95.seq
 499995832     gbpat96.seq
  81953256     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499987136     gbphg1.seq
 499909914     gbphg2.seq
 251191591     gbphg3.seq
 499998444     gbpln1.seq
 268695070     gbpln10.seq
 499998144     gbpln100.seq
 488886421     gbpln101.seq
 499933500     gbpln102.seq
  57909317     gbpln103.seq
 499999069     gbpln104.seq
 461458550     gbpln105.seq
 402785639     gbpln106.seq
 445924319     gbpln107.seq
 496952966     gbpln108.seq
   9838016     gbpln109.seq
 499902772     gbpln11.seq
  10166055     gbpln110.seq
 766528189     gbpln111.seq
   9205327     gbpln112.seq
 756143249     gbpln113.seq
 878426054     gbpln114.seq
 631056251     gbpln115.seq
 993852367     gbpln116.seq
1020132695     gbpln117.seq
 830166807     gbpln118.seq
 955723315     gbpln119.seq
 497758830     gbpln12.seq
1057964328     gbpln120.seq
 784007552     gbpln121.seq
 947940191     gbpln122.seq
 857511193     gbpln123.seq
 649137171     gbpln124.seq
 903393879     gbpln125.seq
 908180396     gbpln126.seq
 721135945     gbpln127.seq
 786739709     gbpln128.seq
 918070756     gbpln129.seq
 463207289     gbpln13.seq
 603192844     gbpln130.seq
 938102555     gbpln131.seq
 955978436     gbpln132.seq
 813787878     gbpln133.seq
 639701128     gbpln134.seq
 479044200     gbpln135.seq
 489395788     gbpln136.seq
 480728603     gbpln137.seq
 382139953     gbpln138.seq
 499797290     gbpln139.seq
 467751929     gbpln14.seq
 499778179     gbpln140.seq
 499996400     gbpln141.seq
 499998144     gbpln142.seq
  65467408     gbpln143.seq
 408312864     gbpln15.seq
 345401605     gbpln16.seq
 383418401     gbpln17.seq
 203982150     gbpln18.seq
  84491581     gbpln19.seq
 499998624     gbpln2.seq
 477736045     gbpln20.seq
 499901222     gbpln21.seq
 498817745     gbpln22.seq
 323729344     gbpln23.seq
 499081327     gbpln24.seq
 497392106     gbpln25.seq
 499424594     gbpln26.seq
 103293547     gbpln27.seq
 496776773     gbpln28.seq
 498203510     gbpln29.seq
 499913464     gbpln3.seq
 349196026     gbpln30.seq
 482187406     gbpln31.seq
 497060599     gbpln32.seq
 325254605     gbpln33.seq
 458188834     gbpln34.seq
 497320240     gbpln35.seq
 472649754     gbpln36.seq
 478648725     gbpln37.seq
  83738349     gbpln38.seq
 494333229     gbpln39.seq
 499976416     gbpln4.seq
 475206592     gbpln40.seq
 468207974     gbpln41.seq
 477377071     gbpln42.seq
 272302995     gbpln43.seq
 172902036     gbpln44.seq
 454104738     gbpln45.seq
 440355134     gbpln46.seq
 469682338     gbpln47.seq
 344132899     gbpln48.seq
 191029235     gbpln49.seq
 447262286     gbpln5.seq
 365194199     gbpln50.seq
 363399697     gbpln51.seq
 374989723     gbpln52.seq
 329889324     gbpln53.seq
     84604     gbpln54.seq
    354449     gbpln55.seq
 164935257     gbpln56.seq
  40081560     gbpln57.seq
  74904969     gbpln58.seq
 499998789     gbpln59.seq
 499998807     gbpln6.seq
 356183802     gbpln60.seq
 499999353     gbpln61.seq
 499996977     gbpln62.seq
 138381203     gbpln63.seq
 499804164     gbpln64.seq
 499375561     gbpln65.seq
 499979506     gbpln66.seq
 284162610     gbpln67.seq
 297683191     gbpln68.seq
 210415093     gbpln69.seq
 499958892     gbpln7.seq
 247532391     gbpln70.seq
 185600169     gbpln71.seq
 997331397     gbpln72.seq
  56487055     gbpln73.seq
 487345662     gbpln74.seq
 473525640     gbpln75.seq
 473209476     gbpln76.seq
 467870556     gbpln77.seq
 357033331     gbpln78.seq
 499999123     gbpln79.seq
 224902001     gbpln8.seq
  57048982     gbpln80.seq
 499997285     gbpln81.seq
 499997921     gbpln82.seq
 263468739     gbpln83.seq
 498061585     gbpln84.seq
 499998805     gbpln85.seq
  84485040     gbpln86.seq
 499996765     gbpln87.seq
 463255547     gbpln88.seq
 500000112     gbpln89.seq
 499990067     gbpln9.seq
 411061859     gbpln90.seq
 499991407     gbpln91.seq
 382681597     gbpln92.seq
 499997492     gbpln93.seq
 499997633     gbpln94.seq
 499993969     gbpln95.seq
  55901069     gbpln96.seq
 499997162     gbpln97.seq
 499999084     gbpln98.seq
 373462427     gbpln99.seq
 147957234     gbpri1.seq
 499825466     gbpri10.seq
 499980989     gbpri11.seq
 248926676     gbpri12.seq
 458204388     gbpri13.seq
 162649929     gbpri14.seq
 494708655     gbpri15.seq
 499956353     gbpri16.seq
 499952905     gbpri17.seq
 499961883     gbpri18.seq
 499982427     gbpri19.seq
 499807750     gbpri2.seq
  18245522     gbpri20.seq
 499977085     gbpri21.seq
 499993855     gbpri22.seq
 430416786     gbpri23.seq
 499973263     gbpri24.seq
 499997005     gbpri25.seq
 316303829     gbpri26.seq
 499972212     gbpri27.seq
 418238963     gbpri28.seq
 314294173     gbpri29.seq
 499891257     gbpri3.seq
 258775295     gbpri30.seq
 499997216     gbpri31.seq
 499998871     gbpri32.seq
 142380508     gbpri33.seq
 499855390     gbpri4.seq
 499729136     gbpri5.seq
 393528771     gbpri6.seq
 499802910     gbpri7.seq
 499984908     gbpri8.seq
 499967826     gbpri9.seq
    384878     gbrel.txt
 499863212     gbrod1.seq
 498652216     gbrod10.seq
 499812186     gbrod11.seq
 203924668     gbrod12.seq
 499996148     gbrod13.seq
 499997465     gbrod14.seq
 499998305     gbrod15.seq
 499997728     gbrod16.seq
  94247720     gbrod17.seq
 499802341     gbrod2.seq
 499880319     gbrod3.seq
 499702715     gbrod4.seq
 499960342     gbrod5.seq
  80291490     gbrod6.seq
 499846851     gbrod7.seq
 499742719     gbrod8.seq
 499945822     gbrod9.seq
 499999222     gbsts1.seq
 499998274     gbsts10.seq
 433222712     gbsts11.seq
 499997771     gbsts2.seq
  37828443     gbsts3.seq
 499998792     gbsts4.seq
 499996791     gbsts5.seq
 456729482     gbsts6.seq
 499997334     gbsts7.seq
 499998238     gbsts8.seq
  21531081     gbsts9.seq
 300737279     gbsyn1.seq
 484840204     gbsyn10.seq
 420813585     gbsyn11.seq
 490139104     gbsyn12.seq
 343340338     gbsyn13.seq
 372527180     gbsyn14.seq
 417861037     gbsyn15.seq
 448312645     gbsyn16.seq
 416377964     gbsyn17.seq
 453065454     gbsyn18.seq
 263306948     gbsyn19.seq
 343340340     gbsyn2.seq
 484840198     gbsyn20.seq
 420813579     gbsyn21.seq
 499996190     gbsyn22.seq
 448690210     gbsyn23.seq
 499993129     gbsyn24.seq
 499995405     gbsyn25.seq
 499992357     gbsyn26.seq
 169900024     gbsyn27.seq
 372527185     gbsyn3.seq
 417861045     gbsyn4.seq
 448312656     gbsyn5.seq
  81377273     gbsyn6.seq
 470781350     gbsyn7.seq
 317285074     gbsyn8.seq
 263306950     gbsyn9.seq
 499999287     gbtsa1.seq
 499998301     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 472042620     gbtsa107.seq
 499997664     gbtsa108.seq
 499998091     gbtsa109.seq
 499997965     gbtsa11.seq
 231476173     gbtsa110.seq
 499999916     gbtsa111.seq
 499999178     gbtsa112.seq
 499998485     gbtsa113.seq
 499999035     gbtsa114.seq
  32605644     gbtsa115.seq
 500000071     gbtsa116.seq
 499996732     gbtsa117.seq
 499998477     gbtsa118.seq
 469116009     gbtsa119.seq
 179283998     gbtsa12.seq
 499999748     gbtsa120.seq
 499999035     gbtsa121.seq
 499998875     gbtsa122.seq
 278733702     gbtsa123.seq
 499999266     gbtsa124.seq
 499999256     gbtsa125.seq
 499998286     gbtsa126.seq
 421530147     gbtsa127.seq
 499996235     gbtsa13.seq
 500000138     gbtsa14.seq
 150741018     gbtsa15.seq
 499999603     gbtsa16.seq
 499995762     gbtsa17.seq
 258358910     gbtsa18.seq
 499997252     gbtsa19.seq
 499998984     gbtsa2.seq
 499998175     gbtsa20.seq
 499999260     gbtsa21.seq
  67397747     gbtsa22.seq
 499999604     gbtsa23.seq
 499997273     gbtsa24.seq
 499999960     gbtsa25.seq
 275956906     gbtsa26.seq
 499999635     gbtsa27.seq
 499999791     gbtsa28.seq
  71311344     gbtsa29.seq
 146878920     gbtsa3.seq
 499998196     gbtsa30.seq
 499999529     gbtsa31.seq
 153218059     gbtsa32.seq
 499998835     gbtsa33.seq
 499996513     gbtsa34.seq
 499997585     gbtsa35.seq
 487094675     gbtsa36.seq
 499999485     gbtsa37.seq
 499997575     gbtsa38.seq
 499998617     gbtsa39.seq
 499998567     gbtsa4.seq
 225919334     gbtsa40.seq
 499999675     gbtsa41.seq
 499997165     gbtsa42.seq
 499998635     gbtsa43.seq
 174840812     gbtsa44.seq
 499998997     gbtsa45.seq
 499999560     gbtsa46.seq
 354820880     gbtsa47.seq
 499999373     gbtsa48.seq
 499997080     gbtsa49.seq
 499999940     gbtsa5.seq
 289649000     gbtsa50.seq
 499999814     gbtsa51.seq
 499997752     gbtsa52.seq
 394305971     gbtsa53.seq
 499998483     gbtsa54.seq
 499998629     gbtsa55.seq
 499998068     gbtsa56.seq
 349466573     gbtsa57.seq
 499999428     gbtsa58.seq
 499998837     gbtsa59.seq
  50314135     gbtsa6.seq
 499998097     gbtsa60.seq
 221419020     gbtsa61.seq
 499999964     gbtsa62.seq
 499999918     gbtsa63.seq
 259941502     gbtsa64.seq
 499999212     gbtsa65.seq
 465402653     gbtsa66.seq
 499999280     gbtsa67.seq
 499997713     gbtsa68.seq
 499997088     gbtsa69.seq
 499998877     gbtsa7.seq
 164931383     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499997981     gbtsa75.seq
 499998780     gbtsa76.seq
 131354879     gbtsa77.seq
 499998723     gbtsa78.seq
 499997516     gbtsa79.seq
 499999768     gbtsa8.seq
  30973467     gbtsa80.seq
 499999375     gbtsa81.seq
 499998969     gbtsa82.seq
 499999731     gbtsa83.seq
 499998462     gbtsa84.seq
  45716037     gbtsa85.seq
 500000099     gbtsa86.seq
 499998667     gbtsa87.seq
 499999098     gbtsa88.seq
  84602475     gbtsa89.seq
 266838890     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499995192     gbtsa96.seq
 499998483     gbtsa97.seq
 499999226     gbtsa98.seq
 230571289     gbtsa99.seq
   1119989     gbuna1.seq
 499999127     gbvrl1.seq
 499998305     gbvrl10.seq
 209418729     gbvrl11.seq
 499997540     gbvrl12.seq
 499996960     gbvrl13.seq
 126821932     gbvrl14.seq
 499999747     gbvrl15.seq
 499998991     gbvrl16.seq
 305941333     gbvrl17.seq
 499997500     gbvrl18.seq
 499998226     gbvrl19.seq
 499999904     gbvrl2.seq
 335783109     gbvrl20.seq
 499997971     gbvrl21.seq
 499998376     gbvrl22.seq
 355299348     gbvrl23.seq
 499361920     gbvrl24.seq
 499963171     gbvrl25.seq
 292825354     gbvrl26.seq
 499996599     gbvrl27.seq
 499883014     gbvrl28.seq
 241636837     gbvrl29.seq
 359439027     gbvrl3.seq
 499999819     gbvrl30.seq
 499996129     gbvrl31.seq
 259312155     gbvrl32.seq
 499997615     gbvrl4.seq
 499996679     gbvrl5.seq
 499996398     gbvrl6.seq
 499998961     gbvrl7.seq
 279022284     gbvrl8.seq
 499998976     gbvrl9.seq
 499975120     gbvrt1.seq
  36032850     gbvrt10.seq
  18507952     gbvrt11.seq
 497676663     gbvrt12.seq
 497173924     gbvrt13.seq
 481350583     gbvrt14.seq
 400795564     gbvrt15.seq
 488197715     gbvrt16.seq
 479291185     gbvrt17.seq
 480798341     gbvrt18.seq
 499274554     gbvrt19.seq
 499872568     gbvrt2.seq
 483255170     gbvrt20.seq
 484153821     gbvrt21.seq
  65325604     gbvrt22.seq
 475717955     gbvrt23.seq
  14151693     gbvrt24.seq
  21383246     gbvrt25.seq
  90967413     gbvrt26.seq
 499915959     gbvrt27.seq
 499999550     gbvrt28.seq
 499987788     gbvrt29.seq
 230472474     gbvrt3.seq
  54833294     gbvrt30.seq
 499998450     gbvrt31.seq
 499996970     gbvrt32.seq
 345481720     gbvrt33.seq
 499999866     gbvrt34.seq
 439162905     gbvrt35.seq
 499996839     gbvrt36.seq
  22685599     gbvrt37.seq
 440218428     gbvrt38.seq
 499997373     gbvrt39.seq
 263619472     gbvrt4.seq
 376457377     gbvrt40.seq
 499998708     gbvrt41.seq
 277603616     gbvrt42.seq
 500000038     gbvrt43.seq
 496147322     gbvrt44.seq
 483372893     gbvrt45.seq
 496211753     gbvrt46.seq
 499962112     gbvrt47.seq
 341869765     gbvrt48.seq
 199952251     gbvrt49.seq
 289933855     gbvrt5.seq
 122600608     gbvrt50.seq
 483171124     gbvrt51.seq
 481925504     gbvrt52.seq
 499999199     gbvrt53.seq
 499926681     gbvrt54.seq
 296494910     gbvrt55.seq
 491035603     gbvrt56.seq
 492369611     gbvrt57.seq
 479652387     gbvrt58.seq
 480795619     gbvrt59.seq
  87348310     gbvrt6.seq
 362157432     gbvrt60.seq
 490958306     gbvrt61.seq
 475437714     gbvrt62.seq
 489403698     gbvrt63.seq
 493725244     gbvrt64.seq
 327086286     gbvrt65.seq
 499998105     gbvrt66.seq
  93305039     gbvrt67.seq
 499767198     gbvrt7.seq
 284656235     gbvrt8.seq
  15637436     gbvrt9.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         95843      186180212
BCT10        104        247294913
BCT100       53         217706139
BCT101       89         225179091
BCT102       56         148271596
BCT103       95         227942482
BCT104       73         219469130
BCT105       111        219554043
BCT106       77         192702857
BCT107       151        221211798
BCT108       87         224943829
BCT109       77         217244229
BCT11        158        243728409
BCT110       149        229906489
BCT111       98         221080209
BCT112       85         227577042
BCT113       80         161438713
BCT114       115        225967887
BCT115       92         220409897
BCT116       158        214217907
BCT117       88         207032597
BCT118       140        220978157
BCT119       63         217844098
BCT12        146        239228381
BCT120       90         214900948
BCT121       125        217101319
BCT122       88         223616607
BCT123       21         65066945
BCT124       173        218725809
BCT125       125        222941413
BCT126       123        219745957
BCT127       166        221868080
BCT128       48         154061987
BCT129       103        221969737
BCT13        170        237845538
BCT130       112        217634974
BCT131       142        222969051
BCT132       107        216561771
BCT133       124        222163867
BCT134       90         146588770
BCT135       95         230331606
BCT136       111        223221413
BCT137       95         223357448
BCT138       111        222892418
BCT139       96         223123457
BCT14        175        248045151
BCT140       138        217276911
BCT141       17         35766262
BCT142       169        220902023
BCT143       100        223728003
BCT144       94         222167747
BCT145       101        224519342
BCT146       112        222756483
BCT147       149        238189631
BCT148       72         167524798
BCT149       99         229083667
BCT15        181        248874654
BCT150       104        226756878
BCT151       131        225258273
BCT152       77         220678973
BCT153       18         59578137
BCT154       117        224174805
BCT155       157        225126315
BCT156       70         216329275
BCT157       73         109500594
BCT158       111        216184725
BCT159       156        227708035
BCT16        397        15200880
BCT160       111        220250908
BCT161       89         136614524
BCT162       133        228812779
BCT163       117        214362834
BCT164       93         217373573
BCT165       73         147509593
BCT166       98         220150284
BCT167       133        227889380
BCT168       129        229932945
BCT169       125        240179901
BCT17        5200       7533877
BCT170       103        231017307
BCT171       16         41009273
BCT172       121        222644958
BCT173       91         218856464
BCT174       118        225824719
BCT175       119        222427106
BCT176       17         25062477
BCT177       126        228028581
BCT178       134        253926436
BCT179       131        223944970
BCT18        10402      13141863
BCT180       147        220522923
BCT181       9          11423780
BCT182       119        217568478
BCT183       116        217910420
BCT184       90         217823726
BCT185       103        232818435
BCT186       81         144274574
BCT187       97         234475408
BCT188       102        220656832
BCT189       94         223989940
BCT19        53920      202371561
BCT190       95         224148356
BCT191       98         230743725
BCT192       117        229553595
BCT193       26         58575497
BCT194       100        219242484
BCT195       115        225174005
BCT196       98         227455175
BCT197       54         231340783
BCT198       108        261609132
BCT199       189        218268041
BCT2         105        227253826
BCT20        188        215765559
BCT200       123        224303715
BCT201       102        172414200
BCT202       326        275307797
BCT203       122        222266698
BCT204       130        221535066
BCT205       3          5280481
BCT206       87         223892315
BCT207       84         225983254
BCT208       93         234777807
BCT209       89         200376562
BCT21        103        228704622
BCT210       60         216868170
BCT211       124        228470370
BCT212       91         224572374
BCT213       82         196194727
BCT214       158        275283639
BCT215       75         222415412
BCT216       113        221796819
BCT217       128        260816646
BCT218       139        220892608
BCT219       76         184646339
BCT22        118        231551515
BCT220       144        309044134
BCT221       113        243458610
BCT222       143        231838444
BCT223       125        251870979
BCT224       144        274691892
BCT225       93         254436484
BCT226       35         229811711
BCT227       71         230207678
BCT228       109        214738608
BCT229       81         249316025
BCT23        25         63062813
BCT230       53         128128738
BCT231       129        223909652
BCT232       149        232762725
BCT233       120        232068428
BCT234       111        232664672
BCT235       3          7240707
BCT236       112        224142894
BCT237       77         221795973
BCT238       108        226136533
BCT239       108        233194087
BCT24        104        223253197
BCT240       100        234797307
BCT241       95         226735281
BCT242       20         35241326
BCT243       133        232308460
BCT244       115        242860599
BCT245       133        243208178
BCT246       109        249153132
BCT247       126        224714645
BCT248       113        215267468
BCT249       107        229136091
BCT25        130        222885924
BCT250       142        214759311
BCT251       61         80775013
BCT252       100        229828383
BCT253       126        224502044
BCT254       141        244282854
BCT255       124        230024199
BCT256       38         58631532
BCT257       137        222225894
BCT258       116        218527248
BCT259       104        218135881
BCT26        120        223258256
BCT260       98         184721024
BCT261       126        254951956
BCT262       83         226638967
BCT263       75         226470110
BCT264       53         132681752
BCT265       139        241479810
BCT266       160        225449855
BCT267       116        217883827
BCT268       155        224519925
BCT269       50         36230494
BCT27        134        224264906
BCT270       528        115589384
BCT271       1589       2511957
BCT272       3172       5268484
BCT273       6338       7796395
BCT274       12613      14997690
BCT275       25523      27672494
BCT276       50567      54073142
BCT277       149310     156926262
BCT278       13767      193298413
BCT279       3297       203942569
BCT28        123        220068773
BCT280       2237       213244276
BCT281       47404      187760710
BCT282       75205      183128648
BCT283       10947      200009363
BCT284       24995      203229865
BCT285       142158     152868297
BCT286       149513     156990425
BCT287       84153      88009384
BCT288       144834     151322370
BCT289       25411      25034308
BCT29        191        223126154
BCT290       132802     167902436
BCT291       30535      42230948
BCT292       117007     177787560
BCT293       5826       13928403
BCT294       31238      51767786
BCT295       13048      295114483
BCT296       5443       190963340
BCT297       5035       225442726
BCT298       3862       225775024
BCT299       1431       273419682
BCT3         37536      118572435
BCT30        25         41692054
BCT300       74         220393090
BCT301       57         217796760
BCT302       71         222568017
BCT303       19         70063500
BCT304       69         224394912
BCT305       174        238189889
BCT306       2093       281685842
BCT307       46         94780218
BCT308       87         224654833
BCT309       86         227602753
BCT31        255        228290103
BCT310       2732       240544659
BCT311       1215       110429461
BCT312       1411       259608076
BCT313       47         241352896
BCT314       45         243003094
BCT315       2180       269716913
BCT316       914        54273464
BCT317       1949       277402950
BCT318       85         274540086
BCT319       546        284923713
BCT32        96         216108910
BCT320       2742       220974115
BCT321       11899      19860485
BCT322       24504      40795756
BCT323       122611     186857950
BCT324       52343      99247143
BCT33        102        220140811
BCT34        139        223015436
BCT35        106        222032339
BCT36        161        220965954
BCT37        133        221316823
BCT38        111        220464912
BCT39        123        223234818
BCT4         41293      139254422
BCT40        131        218260172
BCT41        105        232532281
BCT42        130        224240294
BCT43        69         107066299
BCT44        95         230906043
BCT45        117        227983621
BCT46        160        232896345
BCT47        154        221688996
BCT48        128        238275556
BCT49        114        230664549
BCT5         20648      169648440
BCT50        54         123393656
BCT51        300        239582260
BCT52        142        231562727
BCT53        354        225466658
BCT54        111        222677306
BCT55        121        213352665
BCT56        120        227473574
BCT57        98         224926366
BCT58        90         224039666
BCT59        103        223607010
BCT6         2600       37759883
BCT60        52         129132706
BCT61        53         211054879
BCT62        45         210584326
BCT63        45         210864282
BCT64        45         212727898
BCT65        76         222861078
BCT66        40         115080869
BCT67        113        227839626
BCT68        129        231755413
BCT69        98         245089400
BCT7         1310       133308362
BCT70        86         220407149
BCT71        59         181990919
BCT72        95         236396547
BCT73        103        228660329
BCT74        60         226442128
BCT75        61         126664546
BCT76        97         233622957
BCT77        82         229505918
BCT78        100        238937572
BCT79        24         34605195
BCT8         189        237087597
BCT80        94         226656782
BCT81        118        229172918
BCT82        127        232212860
BCT83        90         178403076
BCT84        114        212138354
BCT85        75         222053892
BCT86        112        225347102
BCT87        124        217786851
BCT88        3          5977905
BCT89        246        222259941
BCT9         134        238319576
BCT90        104        221252195
BCT91        102        226655160
BCT92        82         225650595
BCT93        19         78013502
BCT94        68         221578113
BCT95        87         219795379
BCT96        87         223588406
BCT97        81         226971900
BCT98        18         39641829
BCT99        124        217933644
ENV1         190546     141447635
ENV10        186284     146063411
ENV11        209804     131004490
ENV12        176961     144825671
ENV13        155484     156531843
ENV14        250296     68811927
ENV15        87130      20064938
ENV16        220965     118703220
ENV17        255799     108838783
ENV18        202943     127181403
ENV19        22160      21920992
ENV2         164983     152918695
ENV20        152298     158748721
ENV21        201149     103389060
ENV22        68247      51332974
ENV23        213452     108952055
ENV24        170892     153859951
ENV25        135008     163676592
ENV26        11462      15617164
ENV27        179962     128307562
ENV28        218108     118366813
ENV29        78193      41640686
ENV3         79641      206989999
ENV30        143995     98019561
ENV31        100666     112298113
ENV32        130011     79926853
ENV33        173952     138876976
ENV34        165443     138581556
ENV35        177045     112181390
ENV36        200951     107254340
ENV37        196370     109593831
ENV38        110125     97108851
ENV39        158092     134839080
ENV4         184501     159287250
ENV40        145169     136787284
ENV41        168734     47647956
ENV42        172155     133212833
ENV43        211390     99904558
ENV44        140078     61561275
ENV45        216486     84261864
ENV46        212787     92527159
ENV47        107699     43157851
ENV48        224742     98791226
ENV49        224421     92001878
ENV5         21883      2266377
ENV50        139473     90457461
ENV51        198817     110735198
ENV52        179930     90811961
ENV53        181419     99330339
ENV54        227409     115901006
ENV55        227647     98166337
ENV56        205287     100776114
ENV57        51897      55348459
ENV6         219001     102597954
ENV7         176418     159907801
ENV8         19498      17028305
ENV9         204724     124206853
EST1         152690     59075604
EST10        155848     67145433
EST100       152900     76533879
EST101       145290     99396060
EST102       145329     85602108
EST103       149126     92923409
EST104       6703       3981116
EST105       149673     109454459
EST106       135201     99322104
EST107       136257     97452826
EST108       136285     94855143
EST109       2305       1524475
EST11        163604     69204453
EST110       137076     77393860
EST111       176766     106156630
EST112       193842     119060256
EST113       235856     141002574
EST114       7112       4372201
EST115       228229     127103651
EST116       183114     103694875
EST117       191632     94586043
EST118       3390       2617463
EST119       148776     100418839
EST12        150663     64729921
EST120       154737     119075941
EST121       166401     98014596
EST122       21716      15235645
EST123       130041     82536108
EST124       83544      30919585
EST125       36755      12481213
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186794     83521674
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173726     87636772
EST136       170476     77687375
EST137       146470     92460382
EST138       28356      17916849
EST139       141409     87648412
EST14        104647     47789803
EST140       149167     98038984
EST141       157783     78490978
EST142       180947     92631738
EST143       7802       4564495
EST144       141653     76089811
EST145       151608     73215366
EST146       148368     87025355
EST147       155915     83659752
EST148       11530      6799490
EST149       166189     102138931
EST15        197356     111644310
EST150       202211     107328473
EST151       158904     93313314
EST152       102194     51052488
EST153       156480     79482516
EST154       135477     80322193
EST155       141407     87991502
EST156       166678     86186626
EST157       7486       4323274
EST158       179043     104198048
EST159       218733     94430895
EST16        147207     104729580
EST160       145774     85841747
EST161       161649     87789494
EST162       2683       1273073
EST163       141208     82864856
EST164       133361     84329255
EST165       147190     88156848
EST166       146175     80277952
EST167       19595      9942032
EST168       117769     61073260
EST169       115690     61941713
EST17        156552     83419127
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125704     48478849
EST175       165762     83297359
EST176       172200     75566895
EST177       24700      15540223
EST178       147743     104364925
EST179       163429     99358064
EST18        191242     116972941
EST180       205284     116217156
EST181       167195     93390904
EST182       154085     103357321
EST183       134248     92946598
EST184       10651      5945121
EST185       146779     94226149
EST186       155082     81021983
EST187       132004     71138841
EST188       161082     90710230
EST189       12811      8098667
EST19        177594     113223384
EST190       148391     87401995
EST191       153611     95444734
EST192       175584     99196287
EST193       140633     77175244
EST194       5357       4372616
EST195       124150     64387264
EST196       163256     91154836
EST197       172881     99349223
EST198       149929     93111504
EST199       5475       3456868
EST2         157296     60515696
EST20        70515      55348130
EST200       165696     79441379
EST201       122431     84562161
EST202       163946     96609849
EST203       163919     95915492
EST204       12854      6191292
EST205       5847       2580354
EST206       111215     63112536
EST207       151296     87159961
EST208       107003     63421010
EST209       164716     101071760
EST21        194719     109379861
EST210       168459     124870746
EST211       82054      66695266
EST212       186353     95082816
EST213       145808     90575080
EST214       86908      65313355
EST215       142217     85392520
EST216       138361     75187981
EST217       94838      30474438
EST218       146971     86308548
EST219       149277     82730422
EST22        180131     92525031
EST220       141166     94336724
EST221       156070     90317772
EST222       8489       6085268
EST223       162144     99678311
EST224       153932     93687490
EST225       123359     88333195
EST226       145975     90180727
EST227       6782       4105919
EST228       129115     82217406
EST229       127997     89777106
EST23        106727     50177428
EST230       44037      31646845
EST231       156432     83333109
EST232       167399     92029695
EST233       166930     92691537
EST234       158122     88081303
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        191052     61413874
EST240       187909     98489047
EST241       191640     107206156
EST242       168052     100159582
EST243       180324     103395206
EST244       190067     112774100
EST245       186313     113300888
EST246       177976     115378463
EST247       6774       5366330
EST248       140779     86145415
EST249       212398     139361263
EST25        136493     39205181
EST250       223895     109289296
EST251       164077     113921229
EST252       183152     95755613
EST253       198082     98538516
EST254       122211     89202303
EST255       5592       3806885
EST256       140269     82392090
EST257       206504     112915997
EST258       162408     106261273
EST259       94126      93144956
EST26        102352     27613958
EST260       14604      19024659
EST261       147779     99296372
EST262       151103     89976672
EST263       139489     102018713
EST264       217413     99726831
EST265       2682       1845563
EST266       134233     96889460
EST267       131016     91584673
EST268       135741     98214097
EST269       113668     81492229
EST27        201622     85286892
EST270       14850      9378331
EST271       136074     84237789
EST272       126197     86196946
EST273       128323     97050498
EST274       35670      25454263
EST275       126754     89472101
EST276       116718     79174411
EST277       139561     84223451
EST278       145829     114775511
EST279       14744      10384457
EST28        19493      8764926
EST280       125388     117381359
EST281       132659     98909184
EST282       162568     97733706
EST283       165651     104455715
EST284       18820      11787079
EST285       142296     92460744
EST286       169036     115171424
EST287       151612     103866021
EST288       136564     103389794
EST289       3120       2011023
EST29        204108     100212775
EST290       159550     97230714
EST291       222471     90724791
EST292       152859     111337310
EST293       160403     71792412
EST294       10537      1191501
EST295       208923     37984366
EST296       212167     83253891
EST297       150191     115332672
EST298       168091     97752036
EST299       154879     103184574
EST3         156029     54736569
EST30        216063     108845959
EST300       169072     109986615
EST301       149587     109938627
EST302       1951       1320641
EST303       180889     102311713
EST304       178791     93162310
EST305       168896     109553039
EST306       158881     104101523
EST307       2125       1696285
EST308       226903     106725089
EST309       267202     116187840
EST31        153984     67133271
EST310       184609     111769181
EST311       149924     28237311
EST312       230016     100551119
EST313       174912     100162887
EST314       156384     99988273
EST315       158567     94424243
EST316       166394     114093378
EST317       179942     95197248
EST318       143687     97189386
EST319       188156     110324042
EST32        149544     63745823
EST320       187340     49205836
EST321       201870     33893305
EST322       174443     95509367
EST323       14474      9106659
EST324       158346     113326097
EST325       184847     110512493
EST326       167597     97759311
EST327       165576     109591810
EST328       165922     71417216
EST329       127843     80161184
EST33        165218     65709042
EST330       121728     80853125
EST331       146606     101299104
EST332       21746      7720907
EST333       250640     26635193
EST334       254708     23392102
EST335       151991     94206454
EST336       152235     98594976
EST337       151209     99840551
EST338       146032     92250961
EST339       237960     43389500
EST34        147076     64534800
EST340       185341     81293727
EST341       3628       4483387
EST342       169222     99956825
EST343       163584     100952360
EST344       145574     92692626
EST345       189890     103400865
EST346       156004     109697655
EST347       153553     101564796
EST348       1941       735181
EST349       184472     108452820
EST35        162690     70903262
EST350       169895     94652097
EST351       169251     105165364
EST352       178305     59601925
EST353       195038     71941256
EST354       194528     75305704
EST355       197065     74426894
EST356       135405     70508640
EST357       174836     127386098
EST358       148327     85054168
EST359       150553     86668465
EST36        160546     65863471
EST360       122062     95365350
EST361       5311       4222709
EST362       143577     94945899
EST363       155205     94257948
EST364       162176     90178575
EST365       157546     100285752
EST366       22191      9834738
EST367       45656      24624838
EST368       155318     104549016
EST369       137850     97037511
EST37        107955     33687683
EST370       158348     101928828
EST371       153048     110041147
EST372       29869      25446036
EST373       173564     146756127
EST374       163572     85433279
EST375       128159     81338294
EST376       137894     94126530
EST377       50614      35398778
EST378       131494     88185695
EST379       137278     89738637
EST38        99514      30487965
EST380       139731     97256239
EST381       147631     97303309
EST382       50322      40576159
EST383       164182     86552371
EST384       143622     81415127
EST385       144915     86073821
EST386       144157     103713157
EST387       155646     93181756
EST388       138127     87591810
EST389       133463     84875714
EST39        99152      31401585
EST390       19252      11819086
EST391       196902     107235645
EST392       137014     75086496
EST393       92962      54579752
EST394       120675     80303449
EST395       23099      14175362
EST396       131518     83245448
EST397       119624     76584579
EST398       147512     80758486
EST399       211519     82955646
EST4         142933     56343102
EST40        98817      29785816
EST400       28787      12175417
EST401       163649     84380495
EST402       163929     99177970
EST403       159177     95841266
EST404       125593     81044797
EST405       12490      8190095
EST406       129141     86476992
EST407       137033     89905278
EST408       178976     112236854
EST409       154128     93135231
EST41        39222      11595646
EST410       28333      12277799
EST411       166744     92046153
EST412       168862     124889300
EST413       87365      56109357
EST414       69679      41103486
EST415       34092      16783013
EST416       137427     79906518
EST417       82516      49468654
EST418       139766     56852944
EST419       148868     30145933
EST42        101326     31351096
EST420       148732     30447498
EST421       163105     80604613
EST422       26341      14195321
EST423       201222     115845880
EST424       237755     108748183
EST425       220202     107509766
EST426       127047     74475061
EST427       128057     85803248
EST428       131704     80409324
EST429       93228      56881081
EST43        102633     36243427
EST430       173975     110008863
EST431       213501     84775693
EST432       106339     28485828
EST433       184755     112765867
EST434       204073     111451866
EST435       178855     105573289
EST436       197595     116862339
EST437       134477     63096462
EST438       110830     60475088
EST439       163287     109043698
EST44        95475      48218258
EST440       182140     116752022
EST441       106403     84554937
EST442       177181     139826371
EST443       150386     90557227
EST444       53982      34345685
EST445       166520     107182981
EST446       178543     101235231
EST447       42175      24141500
EST448       195798     106768392
EST449       185317     95089728
EST45        121121     52335541
EST450       50433      37888207
EST451       189934     115836172
EST452       180026     118008074
EST453       54535      33956141
EST454       196677     133946397
EST455       218231     122863732
EST456       191471     127724121
EST457       184018     144698565
EST458       204243     156003038
EST459       192710     115536227
EST46        55810      33167886
EST460       161421     96720875
EST461       181181     94179059
EST462       6118       508558
EST463       53496      4381716
EST464       158232     12239421
EST465       144975     12987161
EST466       148608     30079541
EST467       149063     29643665
EST468       7062       1471579
EST469       148744     30417064
EST47        177065     89170482
EST470       141747     81732604
EST471       172605     100989345
EST472       161454     110702014
EST473       17171      12297887
EST474       160951     92899014
EST475       150625     104101011
EST476       133698     93221451
EST477       141790     98125501
EST478       16088      8271076
EST479       157380     103682725
EST48        158217     65104402
EST480       146153     105108584
EST481       162018     97570478
EST482       165903     51037876
EST483       12066      1897051
EST484       160514     40367423
EST485       151959     102983137
EST486       149509     98084592
EST487       170922     111825150
EST488       17756      9920308
EST489       132815     75920561
EST49        162348     92226257
EST490       189716     107933724
EST491       149564     109198403
EST492       53155      36073998
EST493       126855     87064282
EST494       146125     90509564
EST495       148638     89545597
EST496       163514     89026598
EST497       34807      17725087
EST498       151814     92135788
EST499       156231     92108182
EST5         162094     62614875
EST50        154207     80123122
EST500       168673     102145685
EST501       136310     85559141
EST502       15299      8507108
EST503       100274     71184924
EST504       78633      60626261
EST505       97623      64860807
EST506       143664     80553208
EST507       36770      20999127
EST508       120992     73607850
EST509       133566     87518958
EST51        156506     74874317
EST510       135575     79506292
EST511       152835     93050651
EST512       44794      24796030
EST513       155676     85797389
EST514       184807     110595728
EST515       121358     79430510
EST516       178199     94655647
EST517       4663       1735339
EST518       52576      18674859
EST519       183577     101191900
EST52        108103     61120240
EST520       152041     81311362
EST521       22152      13410986
EST522       162316     94446797
EST523       211757     123975299
EST524       29664      19024876
EST525       147952     99622109
EST526       158950     98067836
EST527       134310     87388255
EST528       129803     88585688
EST529       24481      15268552
EST53        153908     88947693
EST530       179560     74468277
EST531       179108     79600547
EST532       198743     83525940
EST533       194839     80488133
EST534       3337       1165940
EST535       178841     95307232
EST536       174444     102485197
EST537       180225     107869574
EST538       171856     103650134
EST539       192659     130324466
EST54        154293     84993684
EST540       184929     95563013
EST541       178263     82146788
EST542       119214     81215983
EST543       206771     125126638
EST544       205624     126733200
EST545       193601     113613032
EST546       193784     111741497
EST547       154091     96436815
EST548       187948     117407713
EST549       166670     98999925
EST55        152211     92285204
EST550       133843     98243253
EST551       8876       7222302
EST552       157285     92184364
EST553       170556     85010427
EST554       149108     85057667
EST555       151169     81944839
EST556       11778      7034421
EST557       156517     79983850
EST558       181361     106397624
EST559       162545     103085348
EST56        149923     69877642
EST560       175369     108186389
EST561       3227       2163095
EST562       170744     117107232
EST563       183920     113640835
EST564       129040     83662465
EST565       169422     97775191
EST566       183734     110570774
EST567       31200      20356117
EST568       204465     119127975
EST569       269542     91763948
EST57        142238     76745964
EST570       25664      9425377
EST571       262943     83717893
EST572       157489     57559627
EST573       162302     59144545
EST574       80395      30734692
EST58        151729     83212808
EST59        161295     65822492
EST6         166275     65040988
EST60        144394     70073562
EST61        160487     90001957
EST62        150482     92640532
EST63        150077     99324505
EST64        157763     94524014
EST65        2330       976996
EST66        154964     103565972
EST67        163157     82979234
EST68        166583     84968332
EST69        141939     77577915
EST7         163884     67755466
EST70        148484     82581560
EST71        149150     86200917
EST72        148759     92329771
EST73        150780     87649860
EST74        2437       1423070
EST75        29919      18235506
EST76        186810     102879363
EST77        170381     90703955
EST78        212600     115719905
EST79        179405     103336400
EST8         160905     67785504
EST80        2149       1460388
EST81        196745     121640362
EST82        167598     93368851
EST83        136152     63345204
EST84        128104     62642260
EST85        10956      5611876
EST86        150434     92651323
EST87        154702     97019799
EST88        130185     66307343
EST89        140408     89416206
EST9         169422     69381975
EST90        14132      7325144
EST91        183875     92118813
EST92        204513     119858415
EST93        201907     107931576
EST94        191732     90226571
EST95        204075     87104446
EST96        145903     86977155
EST97        137854     84916039
EST98        158583     76414294
EST99        9280       6073374
GSS1         172838     126579453
GSS10        14938      14424977
GSS100       169816     144809782
GSS101       157708     108873956
GSS102       155981     106353565
GSS103       151962     105164344
GSS104       168005     122783070
GSS105       149829     126592844
GSS106       162068     125197053
GSS107       186640     116036674
GSS108       16014      9794559
GSS109       185786     119804494
GSS11        147201     107527418
GSS110       201450     104020421
GSS111       219926     124042541
GSS112       87280      56947051
GSS113       152300     114320098
GSS114       155174     118808877
GSS115       155139     118868834
GSS116       163490     106671356
GSS117       36986      21467879
GSS118       179848     132289982
GSS119       189894     117148040
GSS12        200919     103951985
GSS120       166036     55080797
GSS121       170071     76702837
GSS122       2028       1303403
GSS123       161778     105245778
GSS124       189210     124956394
GSS125       200987     81591982
GSS126       166850     79919427
GSS127       137307     94457298
GSS128       129872     104613764
GSS129       132040     108783227
GSS13        192063     84639781
GSS130       132451     106046726
GSS131       8003       5920029
GSS132       135214     112032054
GSS133       56598      47104660
GSS134       132584     107786768
GSS135       139149     116140565
GSS136       140043     114408742
GSS137       138251     109584898
GSS138       4155       2820771
GSS139       134784     106426486
GSS14        172473     88914035
GSS140       134049     108003847
GSS141       134400     111531585
GSS142       138188     116474348
GSS143       4675       3643453
GSS144       139468     108106612
GSS145       136810     113648547
GSS146       136898     113473892
GSS147       137299     112649085
GSS148       559        466085
GSS149       137155     110923756
GSS15        168025     83951581
GSS150       134480     106278327
GSS151       133002     107665198
GSS152       138659     116136290
GSS153       1985       1674795
GSS154       127182     92203837
GSS155       174275     105162567
GSS156       184915     110237841
GSS157       162344     108754861
GSS158       176892     102083573
GSS159       197974     129974803
GSS16        160063     81610146
GSS160       201504     133307510
GSS161       200662     134124471
GSS162       178528     124800343
GSS163       198341     136948587
GSS164       196713     139067120
GSS165       196065     138672070
GSS166       174298     134353538
GSS167       144791     97546246
GSS168       138200     80523134
GSS169       165330     73398615
GSS17        156179     85682013
GSS170       129814     57820242
GSS171       163014     141019316
GSS172       170950     113527672
GSS173       80812      52920567
GSS174       191881     129015715
GSS175       196554     117983862
GSS176       28456      14940540
GSS177       180225     98140530
GSS178       181302     123365801
GSS179       178800     126906476
GSS18        152931     95652982
GSS180       181098     127179984
GSS181       19114      12799890
GSS182       165902     130533276
GSS183       170977     155597399
GSS184       219919     123799690
GSS185       216581     103401654
GSS186       17290      8049466
GSS187       210015     95106166
GSS188       156579     134385514
GSS189       6807       6749646
GSS19        153777     72780066
GSS190       125540     102753347
GSS191       122235     93469471
GSS192       156847     154495780
GSS193       167720     158232911
GSS194       131396     104305071
GSS195       146409     106045244
GSS196       171951     142160534
GSS197       176113     118230948
GSS198       1822       1024249
GSS199       181316     133971324
GSS2         173589     107819426
GSS20        106476     59071274
GSS200       184911     120117379
GSS201       180126     93029105
GSS202       172829     121726073
GSS203       189216     117024741
GSS204       189414     116726891
GSS205       21729      12651457
GSS206       200615     129990067
GSS207       215712     142629172
GSS208       217635     140382802
GSS209       166429     136402995
GSS21        132536     64638951
GSS210       152471     108703336
GSS211       160065     120654204
GSS212       160039     145460383
GSS213       158365     140331734
GSS214       160859     145750229
GSS215       162431     144534355
GSS216       163049     142910892
GSS217       159417     122903915
GSS218       168345     139695448
GSS219       161743     115993986
GSS22        125191     56725897
GSS220       180530     88689585
GSS221       2575       1768585
GSS222       251369     52150506
GSS223       262481     40466091
GSS224       262523     40408947
GSS225       122800     38229504
GSS226       253355     52912344
GSS227       182565     86129448
GSS228       189053     56109501
GSS229       154111     118306719
GSS23        134196     73094577
GSS230       177033     144334259
GSS231       160568     145787944
GSS232       159531     147010793
GSS233       174549     109955224
GSS234       238210     57319690
GSS235       198151     101373468
GSS236       229425     39759432
GSS237       119092     74589582
GSS238       174037     112053848
GSS239       147876     90054034
GSS24        143035     74371292
GSS240       140667     84084607
GSS241       159799     149653479
GSS242       5867       4995483
GSS243       112668     95722541
GSS244       180351     149222837
GSS245       173686     123006410
GSS246       201811     127826090
GSS247       191231     122224152
GSS248       166175     94403497
GSS249       159875     84508026
GSS25        12092      5172754
GSS250       156434     119873333
GSS251       203514     148104231
GSS252       14295      9396358
GSS253       171523     67875770
GSS254       176683     96454754
GSS255       195475     152072364
GSS256       199776     154504000
GSS257       7495       6183699
GSS258       197814     157230621
GSS259       197524     124135449
GSS26        140902     65659537
GSS260       194877     142594284
GSS261       692        477602
GSS262       214689     131396752
GSS263       189975     57643041
GSS264       218563     111965788
GSS265       170728     153965245
GSS266       175902     156532860
GSS267       245739     138577664
GSS268       146727     77741519
GSS27        159866     79842837
GSS28        156781     92819331
GSS29        165485     85429158
GSS3         138092     115755431
GSS30        9306       4806100
GSS31        171978     102877480
GSS32        182794     109078835
GSS33        182358     87083745
GSS34        172892     102148238
GSS35        191042     104301903
GSS36        162180     112295088
GSS37        160408     98256513
GSS38        173347     108754664
GSS39        3661       2627008
GSS4         140177     112446622
GSS40        183985     122974505
GSS41        181701     117299100
GSS42        52326      27358639
GSS43        177832     102911728
GSS44        164530     141989063
GSS45        179635     148565674
GSS46        139660     92477151
GSS47        182857     132009511
GSS48        181606     114545298
GSS49        204426     116967806
GSS5         11594      8658736
GSS50        185610     99476531
GSS51        211954     108037045
GSS52        211747     108318359
GSS53        197315     132797049
GSS54        158211     124808059
GSS55        185589     139410158
GSS56        196775     63134337
GSS57        171826     96464104
GSS58        157611     106106204
GSS59        23373      13575160
GSS6         152749     116375726
GSS60        166616     156645100
GSS61        177157     98801574
GSS62        161196     115202462
GSS63        172331     112351434
GSS64        173858     117792409
GSS65        184259     127656414
GSS66        205711     128748740
GSS67        189997     113286859
GSS68        200558     134122723
GSS69        215694     158345734
GSS7         170895     120028346
GSS70        189083     138049901
GSS71        173833     107710090
GSS72        198219     111980277
GSS73        140725     76414851
GSS74        163079     95884017
GSS75        10697      6814502
GSS76        159270     97756741
GSS77        159481     96970229
GSS78        172285     114351414
GSS79        170749     109399099
GSS8         177171     108971404
GSS80        174370     122402741
GSS81        188943     105261510
GSS82        174817     125816253
GSS83        164286     106564743
GSS84        1705       1353768
GSS85        189622     108717597
GSS86        182037     114287769
GSS87        167147     118346472
GSS88        193343     106201902
GSS89        7220       4213495
GSS9         141896     118706688
GSS90        213933     107583686
GSS91        227285     89235627
GSS92        213465     139505605
GSS93        182539     91847418
GSS94        94686      37020965
GSS95        193805     75823638
GSS96        201086     123394316
GSS97        191020     122180795
GSS98        156116     139401502
GSS99        16660      10968419
HTC1         41206      63404125
HTC2         32318      72275691
HTC3         32080      77890442
HTC4         84836      50647832
HTC5         129901     161568308
HTC6         124887     122729216
HTC7         137621     130765689
HTC8         56339      46258825
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2973       383248998
HTG6         2          386956
HTG60        884        128257683
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3185       360470245
HTG68        3130       368040867
HTG69        2900       377541628
HTG7         2327       375791086
HTG70        1733       294388029
HTG71        3421       365667463
HTG72        2072       381392462
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384516557
HTG79        3219       384047688
HTG8         1500       384347777
HTG80        2165       384532378
HTG81        3034       373057359
HTG82        1876       197116771
HTG9         1582       384062276
INV1         153788     141722381
INV10        142437     115071212
INV11        167401     134506110
INV12        126598     112158971
INV13        37137      273258075
INV14        131269     159885370
INV15        79339      66866211
INV16        29436      324471105
INV17        155599     109714649
INV18        52330      38499393
INV19        152929     110112720
INV2         2278       314161114
INV20        153404     116016775
INV21        76855      50942294
INV22        155194     113636990
INV23        153761     120475167
INV24        52680      35266930
INV25        153130     109611892
INV26        153510     115678314
INV27        36737      31705246
INV28        149882     93618507
INV29        153287     100340392
INV3         105432     182468273
INV30        30376      21961259
INV31        151863     99354249
INV32        148267     86613609
INV33        29989      18127197
INV34        139200     83024805
INV35        138188     82844637
INV36        52562      34798237
INV37        140709     84416616
INV38        135592     99943517
INV39        71477      55609579
INV4         58596      271553260
INV40        142762     107552932
INV41        152192     119680605
INV42        155246     121351164
INV43        61336      193211558
INV44        183035     236941459
INV45        216228     165877386
INV46        40104      198530143
INV47        800        42674647
INV48        566        40635863
INV49        8037       115580217
INV5         37198      48524427
INV50        23563      332261945
INV51        23021      169885588
INV52        68041      305365919
INV53        123287     266863020
INV54        64375      76908791
INV55        180571     237306452
INV56        16565      338954050
INV57        286        393419010
INV58        380        122009666
INV59        788        368703245
INV6         129146     165852864
INV60        5516       354418677
INV61        14177      308735820
INV62        21702      168022092
INV63        149525     104641950
INV64        152917     93220035
INV65        62263      36091449
INV66        151348     93639474
INV67        148623     119241674
INV68        130658     143439924
INV7         207        346774014
INV8         85         322154899
INV9         10622      374973757
MAM1         34492      321314279
MAM10        3          325384739
MAM11        1          90795278
MAM12        4          322903327
MAM13        4          298795355
MAM14        6          353843759
MAM15        5          329700903
MAM16        2          289079565
MAM17        3          348530310
MAM18        4          336581445
MAM19        5          375256260
MAM2         21042      32454808
MAM20        6          373952570
MAM21        8          377813420
MAM22        10         189786622
MAM23        54         7614329
MAM24        215        34073042
MAM25        431        71272130
MAM26        861        68509101
MAM27        1706       2411269
MAM28        6836       6159435
MAM29        110526     193401644
MAM3         26813      24993470
MAM30        146741     135857362
MAM31        118332     168391941
MAM32        69665      262380474
MAM4         13731      20581276
MAM5         3445       7368868
MAM6         107        699953
MAM7         20         277696380
MAM8         1          249270926
MAM9         2          343930246
PAT1         420100     157390049
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185611     168252742
PAT109       194883     145515917
PAT11        235983     217045687
PAT110       97904      55961896
PAT111       244010     110313663
PAT112       143108     226392216
PAT113       78455      27179427
PAT114       88298      271849570
PAT115       224917     124892818
PAT116       225549     104937982
PAT117       1384       4376046
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83498      75717880
PAT120       94887      123404429
PAT121       98575      119757116
PAT122       81936      115813086
PAT123       203243     107718932
PAT124       26007      9048673
PAT125       203754     100553637
PAT126       183515     80730519
PAT127       117380     19495889
PAT128       249680     208804722
PAT129       386274     114660325
PAT13        242995     211972296
PAT130       52275      7524746
PAT131       284011     180150443
PAT132       123569     298400403
PAT133       110159     303172775
PAT134       393193     122434304
PAT135       291035     159031736
PAT136       12273      8260588
PAT137       287143     182661675
PAT138       409358     14024130
PAT139       496818     33315474
PAT14        328689     148260006
PAT140       525210     7878150
PAT141       153452     3896483
PAT142       377433     123822899
PAT143       245689     106280372
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140528     153756176
PAT149       6430       91690961
PAT15        63316      1582900
PAT150       177885     181303248
PAT151       71549      185117590
PAT152       75797      115785873
PAT153       75754      115777597
PAT154       46228      38672101
PAT155       245596     68644699
PAT156       201617     63079802
PAT157       264585     57807748
PAT158       309606     83974622
PAT159       458690     54677131
PAT16        197505     165335809
PAT160       227775     118065838
PAT161       360581     132776187
PAT162       287957     50152101
PAT163       153953     4619268
PAT164       229300     77216284
PAT165       228264     72764380
PAT166       281031     19059514
PAT167       63876      6659969
PAT168       153386     170244271
PAT169       73419      134972964
PAT17        217934     141818487
PAT170       74138      123434478
PAT171       137245     84262620
PAT172       175172     2627580
PAT173       234159     99508566
PAT174       116895     127298342
PAT175       134034     101070438
PAT176       276433     32241449
PAT177       208961     3134415
PAT178       278538     10765362
PAT179       99592      135918967
PAT18        217695     104541309
PAT180       220914     105893965
PAT181       23911      35257067
PAT182       144001     206631238
PAT183       173336     186681447
PAT184       70092      243273682
PAT185       177507     110447422
PAT186       137771     82587687
PAT187       268658     230373189
PAT188       282624     222310160
PAT189       192664     139614235
PAT19        238917     105580979
PAT190       276098     235021090
PAT191       188385     291326630
PAT192       235742     256338125
PAT193       298822     119472233
PAT2         329721     203005132
PAT20        217557     131791905
PAT21        297655     56074749
PAT22        144749     92171121
PAT23        196060     155924286
PAT24        282758     74820945
PAT25        225471     151042311
PAT26        211290     135894183
PAT27        60374      52824381
PAT28        304664     206981310
PAT29        321053     202865066
PAT3         50116      20254906
PAT30        69599      127456494
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255802     169074296
PAT34        232595     137945215
PAT35        62038      29214913
PAT36        159617     193124839
PAT37        187242     152015394
PAT38        213077     134531422
PAT39        96793      9793208
PAT4         329664     180394651
PAT40        350808     21634684
PAT41        267992     107287746
PAT42        168        393677758
PAT43        14062      377884877
PAT44        84773      5054855
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188209     183534698
PAT48        31086      33386746
PAT49        100029     274299234
PAT5         262318     200084268
PAT50        347927     22043243
PAT51        356635     6776065
PAT52        92410      1755790
PAT53        351490     15876307
PAT54        360979     6858601
PAT55        133549     2537431
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217103     164392957
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481513     50384338
PAT63        225625     89296787
PAT64        255086     194811748
PAT65        328513     204100668
PAT66        171055     140485615
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247455     122528556
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224378     103187726
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        488743     57546523
PAT84        319875     49164952
PAT85        461170     84798921
PAT86        153284     113720706
PAT87        167292     186488595
PAT88        316772     151076204
PAT89        223928     179966082
PAT9         153185     77970330
PAT90        160480     39727117
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509423     32552297
PAT94        211220     45718319
PAT95        257695     203243540
PAT96        388347     141459376
PAT97        39406      44066854
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8952       216002877
PHG2         5250       221740769
PHG3         2482       106715723
PLN1         135508     172321078
PLN10        18921      157294990
PLN100       118846     172699347
PLN101       71178      208045683
PLN102       818        383279116
PLN103       18809      17241691
PLN104       19738      363693682
PLN105       9361       313004062
PLN106       302        288936846
PLN107       5          324373291
PLN108       16325      355785638
PLN109       5636       1862075
PLN11        29377      278503063
PLN110       5217       2473234
PLN111       1          563502314
PLN112       1507       4152934
PLN113       1          594102056
PLN114       1          689851870
PLN115       1          495453186
PLN116       1          780798557
PLN117       1          801256715
PLN118       1          651852609
PLN119       1          750843639
PLN12        2634       333135348
PLN120       1          830829764
PLN121       1          615552423
PLN122       1          744588157
PLN123       1          673617499
PLN124       1          509857067
PLN125       1          709773743
PLN126       1          713149757
PLN127       1          566080677
PLN128       1          618079260
PLN129       1          720988478
PLN13        34         326120762
PLN130       1          473592718
PLN131       1          736706236
PLN132       1          750620385
PLN133       1          638686055
PLN134       1          480980714
PLN135       6529       351670233
PLN136       3679       362923676
PLN137       23476      296175964
PLN138       90683      134946942
PLN139       105901     177432850
PLN14        51         343512393
PLN140       89790      205014024
PLN141       108243     181427156
PLN142       120670     169451691
PLN143       11698      25207046
PLN15        22026      263490956
PLN16        96549      101321073
PLN17        113216     117350159
PLN18        57311      72144648
PLN19        28689      28923180
PLN2         38873      283976710
PLN20        2648       194594881
PLN21        344        254550430
PLN22        400        261235914
PLN23        198        168828441
PLN24        298        258873545
PLN25        339        265493888
PLN26        485        350911896
PLN27        112        80604200
PLN28        455        379571541
PLN29        127        379253996
PLN3         3695       380522152
PLN30        91         241350431
PLN31        107        353068716
PLN32        21         391404607
PLN33        229        244592824
PLN34        149        350028887
PLN35        15         388403916
PLN36        22         360710420
PLN37        6          376299569
PLN38        1          65870126
PLN39        93         388494695
PLN4         3520       387730866
PLN40        15         373888800
PLN41        9          363551984
PLN42        60         374148929
PLN43        14         212654302
PLN44        74         124609184
PLN45        8          358353307
PLN46        3          347496433
PLN47        4          370651368
PLN48        2          271593360
PLN49        1          150766190
PLN5         97581      187580586
PLN50        2          288204953
PLN51        2          286787940
PLN52        2          295931502
PLN53        86         255610544
PLN54        37         16871
PLN55        149        79314
PLN56        2469       93786416
PLN57        7181       18795412
PLN58        14346      29953091
PLN59        97956      209511377
PLN6         111715     128125956
PLN60        129179     89891482
PLN61        159271     148618904
PLN62        162857     146931022
PLN63        57135      30587130
PLN64        181643     125937972
PLN65        49809      255464815
PLN66        41702      287594351
PLN67        71192      107438341
PLN68        98511      85385759
PLN69        49500      72635104
PLN7         64096      185002034
PLN70        25061      110565816
PLN71        13561      89764040
PLN72        1          774434471
PLN73        8305       28494037
PLN74        1861       361385154
PLN75        5          372618381
PLN76        6          372447772
PLN77        6          368295254
PLN78        12433      261969826
PLN79        176785     124182630
PLN8         21745      106564214
PLN80        20369      14688348
PLN81        148923     156648458
PLN82        149695     145300512
PLN83        84719      70757112
PLN84        154197     132601769
PLN85        164380     118663497
PLN86        22196      25375628
PLN87        147061     135205449
PLN88        121007     151498599
PLN89        167645     121560767
PLN9         35233      291274408
PLN90        113637     118664880
PLN91        133885     150549803
PLN92        101342     119490857
PLN93        136246     150008663
PLN94        126571     163645489
PLN95        120874     166267973
PLN96        16973      15413844
PLN97        124007     164465260
PLN98        114181     171506641
PLN99        77428      141162476
PRI1         23034      59762327
PRI10        2265       387936439
PRI11        4375       381729455
PRI12        2069       191983096
PRI13        17644      327838292
PRI14        27929      79132146
PRI15        96050      166265556
PRI16        11025      363947920
PRI17        3741       383223079
PRI18        15303      353911286
PRI19        59152      259982806
PRI2         23834      319327553
PRI20        3806       7249854
PRI21        53142      193856228
PRI22        87997      233145698
PRI23        90504      166075609
PRI24        74324      199940085
PRI25        54431      215566184
PRI26        34617      144325926
PRI27        69634      214262041
PRI28        88427      147858682
PRI29        1          229594237
PRI3         2613       370370379
PRI30        1          190673448
PRI31        9936       358260762
PRI32        57785      209586232
PRI33        33282      60558111
PRI4         2409       360399901
PRI5         2593       353874487
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38423      309721413
ROD10        16349      349356400
ROD11        22214      347968494
ROD12        1002       157743814
ROD13        53467      238712732
ROD14        21665      310366963
ROD15        228388     97433373
ROD16        155687     121127002
ROD17        25523      29406235
ROD2         1810       346957759
ROD3         1885       352024250
ROD4         1943       360884621
ROD5         1990       363733749
ROD6         306        57843793
ROD7         1975       368354297
ROD8         1990       369693686
ROD9         1959       368016559
STS1         170595     86876605
STS10        202217     61356397
STS11        167008     59456917
STS2         143470     63350935
STS3         8190       4809522
STS4         108725     63673512
STS5         110379     70040590
STS6         106166     81423611
STS7         122521     86625645
STS8         198745     60874554
STS9         8950       2430284
SYN1         54438      100569347
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        2064       389447958
SYN23        64284      183080760
SYN24        9183       352928592
SYN25        17246      334467878
SYN26        109056     160396415
SYN27        22364      66554059
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233380     79653983
TSA10        155900     159219814
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       156762     150055175
TSA109       183850     102660564
TSA11        161235     134468030
TSA110       46133      105547678
TSA111       136931     166476864
TSA112       166663     125028887
TSA113       97439      238063556
TSA114       99621      234258577
TSA115       12096      5797980
TSA116       134299     172499287
TSA117       127822     180391048
TSA118       129653     177320123
TSA119       120977     167690794
TSA12        65188      48720110
TSA120       161752     123773928
TSA121       122463     187577773
TSA122       148092     145309800
TSA123       94145      61033986
TSA124       136345     168539405
TSA125       159333     125157880
TSA126       156667     125822948
TSA127       123052     121148961
TSA13        144445     166877725
TSA14        183584     128290093
TSA15        63326      19254096
TSA16        207559     109270376
TSA17        186917     104029522
TSA18        49378      65164288
TSA19        154786     149639718
TSA2         222501     88764704
TSA20        217000     100217335
TSA21        205868     104176652
TSA22        22636      12494410
TSA23        159463     127641062
TSA24        173240     148979716
TSA25        215107     83751466
TSA26        105264     74950797
TSA27        172910     71716168
TSA28        221930     89798997
TSA29        26888      19147632
TSA3         74593      22546411
TSA30        206110     106021139
TSA31        179811     146674399
TSA32        67801      29056436
TSA33        188743     126584843
TSA34        147134     171674811
TSA35        163216     142606986
TSA36        149293     161200389
TSA37        167355     152088001
TSA38        141407     134166635
TSA39        170803     157995856
TSA4         200107     117397278
TSA40        68091      94849454
TSA41        171892     122248327
TSA42        190161     129023053
TSA43        179527     129657126
TSA44        74666      42475669
TSA45        179837     148961559
TSA46        157618     110427650
TSA47        134614     95382384
TSA48        185173     132793697
TSA49        208467     104145310
TSA5         215390     134315100
TSA50        79060      109863998
TSA51        193451     109714322
TSA52        179795     119290087
TSA53        111831     116819755
TSA54        155188     135994981
TSA55        161488     91817715
TSA56        130888     143857547
TSA57        137093     81293196
TSA58        155281     162331143
TSA59        162871     156980202
TSA6         15756      19456676
TSA60        194209     122378904
TSA61        57557      94587557
TSA62        173905     118336916
TSA63        151865     162169607
TSA64        60980      124236262
TSA65        201109     152115772
TSA66        185638     143700395
TSA67        163479     121752466
TSA68        182133     137371012
TSA69        170697     97722816
TSA7         194553     54897033
TSA70        40596      38103163
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        152989     102336522
TSA76        156503     143538644
TSA77        40595      33645981
TSA78        177556     139010934
TSA79        162022     159228390
TSA8         158334     121004747
TSA80        10510      8595284
TSA81        185669     115791752
TSA82        143419     147913350
TSA83        177759     145455461
TSA84        159235     177039745
TSA85        17013      11869134
TSA86        167225     128050588
TSA87        156455     150256384
TSA88        195037     125807910
TSA89        33297      23299259
TSA9         98089      68621619
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141044     144633048
TSA97        106079     76616395
TSA98        74427      65411867
TSA99        33717      32835466
UNA1         451        310615
VRL1         133660     139548026
VRL10        121769     139940405
VRL11        49039      61702659
VRL12        114746     145945923
VRL13        113577     148411835
VRL14        24673      42839042
VRL15        91389      159464671
VRL16        98034      150765502
VRL17        59010      97771127
VRL18        93191      166854740
VRL19        91509      165030328
VRL2         128895     151161987
VRL20        52708      118856678
VRL21        83669      173666051
VRL22        87103      167896633
VRL23        66165      116170425
VRL24        83309      169000426
VRL25        83674      168364261
VRL26        47220      104542997
VRL27        91702      181924939
VRL28        76363      189592504
VRL29        34998      93683333
VRL3         95978      101239519
VRL30        69553      180394181
VRL31        77366      188534495
VRL32        52755      84694727
VRL4         95794      150913808
VRL5         88097      145947713
VRL6         96112      145819871
VRL7         132186     142078864
VRL8         63493      83262564
VRL9         122022     145464550
VRT1         69910      272964557
VRT10        1171       26255719
VRT11        293        13983146
VRT12        37         392789976
VRT13        13         392458500
VRT14        12         379958897
VRT15        11         316368323
VRT16        13         385338369
VRT17        14         372163844
VRT18        14         352781625
VRT19        19         384683297
VRT2         72838      271751092
VRT20        16         379729070
VRT21        16         381718727
VRT22        2          51507477
VRT23        49         375308914
VRT24        147        10842596
VRT25        586        15797052
VRT26        2343       67436863
VRT27        19198      357652178
VRT28        54166      304747906
VRT29        158712     137275991
VRT3         39387      102657653
VRT30        17783      13201283
VRT31        117710     200750748
VRT32        158343     126811796
VRT33        114476     80792544
VRT34        185786     123664390
VRT35        146905     104386745
VRT36        168222     113354781
VRT37        6661       5689298
VRT38        131868     104758104
VRT39        157810     117877636
VRT4         74944      70626785
VRT40        137332     84459750
VRT41        188417     120021259
VRT42        102542     60818711
VRT43        158505     119036468
VRT44        125574     178934155
VRT45        145        377366600
VRT46        426        386435010
VRT47        2478       386159880
VRT48        92703      179275356
VRT49        145106     21008965
VRT5         37396      74041292
VRT50        75789      25336814
VRT51        13375      365641119
VRT52        20         379347618
VRT53        270        393447049
VRT54        3067       391133617
VRT55        3471       230588304
VRT56        6442       378554759
VRT57        16         388667304
VRT58        16         378559418
VRT59        12         379509384
VRT6         18698      27611025
VRT60        7          285874095
VRT61        12         387543838
VRT62        18         375291615
VRT63        16         386329687
VRT64        2913       383910933
VRT65        14525      231405299
VRT66        140402     130806203
VRT67        28279      23646263
VRT7         5986       380511905
VRT8         3363       217068541
VRT9         4685       4674270

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 230.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, and uncultured sequences:

Entries        Bases   Species

26783344 20171575165   Homo sapiens
1936766  17185381446   Triticum aestivum
1001659  10441290703   Mus musculus
2200308   6530276527   Rattus norvegicus
2233587   5433102583   Bos taurus
4211297   5249184898   Zea mays
3302074   5077107024   Sus scrofa
129360    4115985873   Escherichia coli
1346987   3237333494   Hordeum vulgare subsp. vulgare
1729739   3191543353   Danio rerio
1239331   2836978459   Oryzias latipes
311622    2682473374   Arachis hypogaea
72        2590574434   Ovis canadensis canadensis
747479    2573289502   Solanum lycopersicum
112       2290222948   Bos mutus
205573    1836778742   Cyprinus carpio
13587     1800144763   Klebsiella pneumoniae
1733      1769022461   Bordetella pertussis
1379185   1727468203   Oryza sativa Japonica Group
327071    1595512836   Apteryx australis mantelli

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (net decrease; Section 1.3.1 of GB 227.0 release notes)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2019

                NCBI-GenBank Flat File Release 230.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Benson DA, Cavanaugh M, Clark K, Karsch-Mizrachi I, Lipman DJ,
   Ostell J, Sayers EW
   GenBank. Nucleic Acids Res. 45(D1):D37-D42 (2017)

   DOI:   10.1093/nar/gkw1070
   PMID:  27899564
   PMCID: PMC5210553

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Benson, D. et al, Nucleic Acids Res. 45(D1):D37-D42 (2017)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Jim Ostell, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell : Director, NCBI
	Kim Pruitt : Acting Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center