Release Notes For GenBank Release 234

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2019

               NCBI-GenBank Flat File Release 234.0

                    Distribution Release Notes

 216763706 loci, 386197018538 bases, from 216763706 reported sequences

 This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 234.0
1.2 Cutoff Date
1.3 Important Changes in Release 234.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 234.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 234.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 234.0, incorporates data processed by the INSDC databases
as of Monday October 14 2019 at approximately 1:33AM EDT. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 234.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 76 with this release:
  
  - the BCT division is now composed of 387 files (+22)
  - the CON division is now composed of 211 files (+3)
  - the INV division is now composed of 110 files (+33)
  - the PAT division is now composed of 201 files (+3)
  - the PHG division is now composed of   4 files (+1)
  - the PLN division is now composed of 186 files (+5)
  - the ROD division is now composed of  18 files (+1)
  - the VRT division is now composed of 165 files (+8)

1.3.2 Increase in INV division caused by erroneous redistribution of records

  On Sept 13 2019, over 2 million obsolete ENA-originating records were
erroneously re-distributed. We did not discover (and report) the problem
until after the close-date for GenBank 234.0. Given that the records had
already been available for four weeks, and the amount of time that would
be required to suppress them and then restart the release process, we elected
to complete Release 234.0 with the records included.

  These records (totalling 16.3 gigabases) are the cause of the unusually
large increase of thirty-three files for the INV-division. They will be
re-suppressed by late October, so an overall decrease in the number of
INV files for December's Release 235.0 is likely. We will suggest strategies
to our partners that might help reduce the chances of a problem like this
in the future.

1.4 Upcoming Changes

1.4.1 New evidence value for the /linkage_evidence qualifier

  The set of legal values for the /linkage_evidence qualifier of the
assembly_gap feature will be expanded to include "proximity ligation"
on or after October 15 2019.

  The current working description for proximity ligation is:
"ligation of segments of DNA that were brought into proximity in
chromatin (Hi-C and related technologies)". See also the proposed
AGP 2.1 specification:

https://0-www-ncbi-nlm-nih-gov.brum.beds.ac.uk/assembly/agp/AGP_Specification/proposed-version-2-1/

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2543 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct39.seq - Bacterial sequence entries, part 39.
322. gbbct4.seq - Bacterial sequence entries, part 4.
323. gbbct40.seq - Bacterial sequence entries, part 40.
324. gbbct41.seq - Bacterial sequence entries, part 41.
325. gbbct42.seq - Bacterial sequence entries, part 42.
326. gbbct43.seq - Bacterial sequence entries, part 43.
327. gbbct44.seq - Bacterial sequence entries, part 44.
328. gbbct45.seq - Bacterial sequence entries, part 45.
329. gbbct46.seq - Bacterial sequence entries, part 46.
330. gbbct47.seq - Bacterial sequence entries, part 47.
331. gbbct48.seq - Bacterial sequence entries, part 48.
332. gbbct49.seq - Bacterial sequence entries, part 49.
333. gbbct5.seq - Bacterial sequence entries, part 5.
334. gbbct50.seq - Bacterial sequence entries, part 50.
335. gbbct51.seq - Bacterial sequence entries, part 51.
336. gbbct52.seq - Bacterial sequence entries, part 52.
337. gbbct53.seq - Bacterial sequence entries, part 53.
338. gbbct54.seq - Bacterial sequence entries, part 54.
339. gbbct55.seq - Bacterial sequence entries, part 55.
340. gbbct56.seq - Bacterial sequence entries, part 56.
341. gbbct57.seq - Bacterial sequence entries, part 57.
342. gbbct58.seq - Bacterial sequence entries, part 58.
343. gbbct59.seq - Bacterial sequence entries, part 59.
344. gbbct6.seq - Bacterial sequence entries, part 6.
345. gbbct60.seq - Bacterial sequence entries, part 60.
346. gbbct61.seq - Bacterial sequence entries, part 61.
347. gbbct62.seq - Bacterial sequence entries, part 62.
348. gbbct63.seq - Bacterial sequence entries, part 63.
349. gbbct64.seq - Bacterial sequence entries, part 64.
350. gbbct65.seq - Bacterial sequence entries, part 65.
351. gbbct66.seq - Bacterial sequence entries, part 66.
352. gbbct67.seq - Bacterial sequence entries, part 67.
353. gbbct68.seq - Bacterial sequence entries, part 68.
354. gbbct69.seq - Bacterial sequence entries, part 69.
355. gbbct7.seq - Bacterial sequence entries, part 7.
356. gbbct70.seq - Bacterial sequence entries, part 70.
357. gbbct71.seq - Bacterial sequence entries, part 71.
358. gbbct72.seq - Bacterial sequence entries, part 72.
359. gbbct73.seq - Bacterial sequence entries, part 73.
360. gbbct74.seq - Bacterial sequence entries, part 74.
361. gbbct75.seq - Bacterial sequence entries, part 75.
362. gbbct76.seq - Bacterial sequence entries, part 76.
363. gbbct77.seq - Bacterial sequence entries, part 77.
364. gbbct78.seq - Bacterial sequence entries, part 78.
365. gbbct79.seq - Bacterial sequence entries, part 79.
366. gbbct8.seq - Bacterial sequence entries, part 8.
367. gbbct80.seq - Bacterial sequence entries, part 80.
368. gbbct81.seq - Bacterial sequence entries, part 81.
369. gbbct82.seq - Bacterial sequence entries, part 82.
370. gbbct83.seq - Bacterial sequence entries, part 83.
371. gbbct84.seq - Bacterial sequence entries, part 84.
372. gbbct85.seq - Bacterial sequence entries, part 85.
373. gbbct86.seq - Bacterial sequence entries, part 86.
374. gbbct87.seq - Bacterial sequence entries, part 87.
375. gbbct88.seq - Bacterial sequence entries, part 88.
376. gbbct89.seq - Bacterial sequence entries, part 89.
377. gbbct9.seq - Bacterial sequence entries, part 9.
378. gbbct90.seq - Bacterial sequence entries, part 90.
379. gbbct91.seq - Bacterial sequence entries, part 91.
380. gbbct92.seq - Bacterial sequence entries, part 92.
381. gbbct93.seq - Bacterial sequence entries, part 93.
382. gbbct94.seq - Bacterial sequence entries, part 94.
383. gbbct95.seq - Bacterial sequence entries, part 95.
384. gbbct96.seq - Bacterial sequence entries, part 96.
385. gbbct97.seq - Bacterial sequence entries, part 97.
386. gbbct98.seq - Bacterial sequence entries, part 98.
387. gbbct99.seq - Bacterial sequence entries, part 99.
388. gbchg.txt - Accession numbers of entries updated since the previous release.
389. gbcon1.seq - Constructed sequence entries, part 1.
390. gbcon10.seq - Constructed sequence entries, part 10.
391. gbcon100.seq - Constructed sequence entries, part 100.
392. gbcon101.seq - Constructed sequence entries, part 101.
393. gbcon102.seq - Constructed sequence entries, part 102.
394. gbcon103.seq - Constructed sequence entries, part 103.
395. gbcon104.seq - Constructed sequence entries, part 104.
396. gbcon105.seq - Constructed sequence entries, part 105.
397. gbcon106.seq - Constructed sequence entries, part 106.
398. gbcon107.seq - Constructed sequence entries, part 107.
399. gbcon108.seq - Constructed sequence entries, part 108.
400. gbcon109.seq - Constructed sequence entries, part 109.
401. gbcon11.seq - Constructed sequence entries, part 11.
402. gbcon110.seq - Constructed sequence entries, part 110.
403. gbcon111.seq - Constructed sequence entries, part 111.
404. gbcon112.seq - Constructed sequence entries, part 112.
405. gbcon113.seq - Constructed sequence entries, part 113.
406. gbcon114.seq - Constructed sequence entries, part 114.
407. gbcon115.seq - Constructed sequence entries, part 115.
408. gbcon116.seq - Constructed sequence entries, part 116.
409. gbcon117.seq - Constructed sequence entries, part 117.
410. gbcon118.seq - Constructed sequence entries, part 118.
411. gbcon119.seq - Constructed sequence entries, part 119.
412. gbcon12.seq - Constructed sequence entries, part 12.
413. gbcon120.seq - Constructed sequence entries, part 120.
414. gbcon121.seq - Constructed sequence entries, part 121.
415. gbcon122.seq - Constructed sequence entries, part 122.
416. gbcon123.seq - Constructed sequence entries, part 123.
417. gbcon124.seq - Constructed sequence entries, part 124.
418. gbcon125.seq - Constructed sequence entries, part 125.
419. gbcon126.seq - Constructed sequence entries, part 126.
420. gbcon127.seq - Constructed sequence entries, part 127.
421. gbcon128.seq - Constructed sequence entries, part 128.
422. gbcon129.seq - Constructed sequence entries, part 129.
423. gbcon13.seq - Constructed sequence entries, part 13.
424. gbcon130.seq - Constructed sequence entries, part 130.
425. gbcon131.seq - Constructed sequence entries, part 131.
426. gbcon132.seq - Constructed sequence entries, part 132.
427. gbcon133.seq - Constructed sequence entries, part 133.
428. gbcon134.seq - Constructed sequence entries, part 134.
429. gbcon135.seq - Constructed sequence entries, part 135.
430. gbcon136.seq - Constructed sequence entries, part 136.
431. gbcon137.seq - Constructed sequence entries, part 137.
432. gbcon138.seq - Constructed sequence entries, part 138.
433. gbcon139.seq - Constructed sequence entries, part 139.
434. gbcon14.seq - Constructed sequence entries, part 14.
435. gbcon140.seq - Constructed sequence entries, part 140.
436. gbcon141.seq - Constructed sequence entries, part 141.
437. gbcon142.seq - Constructed sequence entries, part 142.
438. gbcon143.seq - Constructed sequence entries, part 143.
439. gbcon144.seq - Constructed sequence entries, part 144.
440. gbcon145.seq - Constructed sequence entries, part 145.
441. gbcon146.seq - Constructed sequence entries, part 146.
442. gbcon147.seq - Constructed sequence entries, part 147.
443. gbcon148.seq - Constructed sequence entries, part 148.
444. gbcon149.seq - Constructed sequence entries, part 149.
445. gbcon15.seq - Constructed sequence entries, part 15.
446. gbcon150.seq - Constructed sequence entries, part 150.
447. gbcon151.seq - Constructed sequence entries, part 151.
448. gbcon152.seq - Constructed sequence entries, part 152.
449. gbcon153.seq - Constructed sequence entries, part 153.
450. gbcon154.seq - Constructed sequence entries, part 154.
451. gbcon155.seq - Constructed sequence entries, part 155.
452. gbcon156.seq - Constructed sequence entries, part 156.
453. gbcon157.seq - Constructed sequence entries, part 157.
454. gbcon158.seq - Constructed sequence entries, part 158.
455. gbcon159.seq - Constructed sequence entries, part 159.
456. gbcon16.seq - Constructed sequence entries, part 16.
457. gbcon160.seq - Constructed sequence entries, part 160.
458. gbcon161.seq - Constructed sequence entries, part 161.
459. gbcon162.seq - Constructed sequence entries, part 162.
460. gbcon163.seq - Constructed sequence entries, part 163.
461. gbcon164.seq - Constructed sequence entries, part 164.
462. gbcon165.seq - Constructed sequence entries, part 165.
463. gbcon166.seq - Constructed sequence entries, part 166.
464. gbcon167.seq - Constructed sequence entries, part 167.
465. gbcon168.seq - Constructed sequence entries, part 168.
466. gbcon169.seq - Constructed sequence entries, part 169.
467. gbcon17.seq - Constructed sequence entries, part 17.
468. gbcon170.seq - Constructed sequence entries, part 170.
469. gbcon171.seq - Constructed sequence entries, part 171.
470. gbcon172.seq - Constructed sequence entries, part 172.
471. gbcon173.seq - Constructed sequence entries, part 173.
472. gbcon174.seq - Constructed sequence entries, part 174.
473. gbcon175.seq - Constructed sequence entries, part 175.
474. gbcon176.seq - Constructed sequence entries, part 176.
475. gbcon177.seq - Constructed sequence entries, part 177.
476. gbcon178.seq - Constructed sequence entries, part 178.
477. gbcon179.seq - Constructed sequence entries, part 179.
478. gbcon18.seq - Constructed sequence entries, part 18.
479. gbcon180.seq - Constructed sequence entries, part 180.
480. gbcon181.seq - Constructed sequence entries, part 181.
481. gbcon182.seq - Constructed sequence entries, part 182.
482. gbcon183.seq - Constructed sequence entries, part 183.
483. gbcon184.seq - Constructed sequence entries, part 184.
484. gbcon185.seq - Constructed sequence entries, part 185.
485. gbcon186.seq - Constructed sequence entries, part 186.
486. gbcon187.seq - Constructed sequence entries, part 187.
487. gbcon188.seq - Constructed sequence entries, part 188.
488. gbcon189.seq - Constructed sequence entries, part 189.
489. gbcon19.seq - Constructed sequence entries, part 19.
490. gbcon190.seq - Constructed sequence entries, part 190.
491. gbcon191.seq - Constructed sequence entries, part 191.
492. gbcon192.seq - Constructed sequence entries, part 192.
493. gbcon193.seq - Constructed sequence entries, part 193.
494. gbcon194.seq - Constructed sequence entries, part 194.
495. gbcon195.seq - Constructed sequence entries, part 195.
496. gbcon196.seq - Constructed sequence entries, part 196.
497. gbcon197.seq - Constructed sequence entries, part 197.
498. gbcon198.seq - Constructed sequence entries, part 198.
499. gbcon199.seq - Constructed sequence entries, part 199.
500. gbcon2.seq - Constructed sequence entries, part 2.
501. gbcon20.seq - Constructed sequence entries, part 20.
502. gbcon200.seq - Constructed sequence entries, part 200.
503. gbcon201.seq - Constructed sequence entries, part 201.
504. gbcon202.seq - Constructed sequence entries, part 202.
505. gbcon203.seq - Constructed sequence entries, part 203.
506. gbcon204.seq - Constructed sequence entries, part 204.
507. gbcon205.seq - Constructed sequence entries, part 205.
508. gbcon206.seq - Constructed sequence entries, part 206.
509. gbcon207.seq - Constructed sequence entries, part 207.
510. gbcon208.seq - Constructed sequence entries, part 208.
511. gbcon209.seq - Constructed sequence entries, part 209.
512. gbcon21.seq - Constructed sequence entries, part 21.
513. gbcon210.seq - Constructed sequence entries, part 210.
514. gbcon211.seq - Constructed sequence entries, part 211.
515. gbcon22.seq - Constructed sequence entries, part 22.
516. gbcon23.seq - Constructed sequence entries, part 23.
517. gbcon24.seq - Constructed sequence entries, part 24.
518. gbcon25.seq - Constructed sequence entries, part 25.
519. gbcon26.seq - Constructed sequence entries, part 26.
520. gbcon27.seq - Constructed sequence entries, part 27.
521. gbcon28.seq - Constructed sequence entries, part 28.
522. gbcon29.seq - Constructed sequence entries, part 29.
523. gbcon3.seq - Constructed sequence entries, part 3.
524. gbcon30.seq - Constructed sequence entries, part 30.
525. gbcon31.seq - Constructed sequence entries, part 31.
526. gbcon32.seq - Constructed sequence entries, part 32.
527. gbcon33.seq - Constructed sequence entries, part 33.
528. gbcon34.seq - Constructed sequence entries, part 34.
529. gbcon35.seq - Constructed sequence entries, part 35.
530. gbcon36.seq - Constructed sequence entries, part 36.
531. gbcon37.seq - Constructed sequence entries, part 37.
532. gbcon38.seq - Constructed sequence entries, part 38.
533. gbcon39.seq - Constructed sequence entries, part 39.
534. gbcon4.seq - Constructed sequence entries, part 4.
535. gbcon40.seq - Constructed sequence entries, part 40.
536. gbcon41.seq - Constructed sequence entries, part 41.
537. gbcon42.seq - Constructed sequence entries, part 42.
538. gbcon43.seq - Constructed sequence entries, part 43.
539. gbcon44.seq - Constructed sequence entries, part 44.
540. gbcon45.seq - Constructed sequence entries, part 45.
541. gbcon46.seq - Constructed sequence entries, part 46.
542. gbcon47.seq - Constructed sequence entries, part 47.
543. gbcon48.seq - Constructed sequence entries, part 48.
544. gbcon49.seq - Constructed sequence entries, part 49.
545. gbcon5.seq - Constructed sequence entries, part 5.
546. gbcon50.seq - Constructed sequence entries, part 50.
547. gbcon51.seq - Constructed sequence entries, part 51.
548. gbcon52.seq - Constructed sequence entries, part 52.
549. gbcon53.seq - Constructed sequence entries, part 53.
550. gbcon54.seq - Constructed sequence entries, part 54.
551. gbcon55.seq - Constructed sequence entries, part 55.
552. gbcon56.seq - Constructed sequence entries, part 56.
553. gbcon57.seq - Constructed sequence entries, part 57.
554. gbcon58.seq - Constructed sequence entries, part 58.
555. gbcon59.seq - Constructed sequence entries, part 59.
556. gbcon6.seq - Constructed sequence entries, part 6.
557. gbcon60.seq - Constructed sequence entries, part 60.
558. gbcon61.seq - Constructed sequence entries, part 61.
559. gbcon62.seq - Constructed sequence entries, part 62.
560. gbcon63.seq - Constructed sequence entries, part 63.
561. gbcon64.seq - Constructed sequence entries, part 64.
562. gbcon65.seq - Constructed sequence entries, part 65.
563. gbcon66.seq - Constructed sequence entries, part 66.
564. gbcon67.seq - Constructed sequence entries, part 67.
565. gbcon68.seq - Constructed sequence entries, part 68.
566. gbcon69.seq - Constructed sequence entries, part 69.
567. gbcon7.seq - Constructed sequence entries, part 7.
568. gbcon70.seq - Constructed sequence entries, part 70.
569. gbcon71.seq - Constructed sequence entries, part 71.
570. gbcon72.seq - Constructed sequence entries, part 72.
571. gbcon73.seq - Constructed sequence entries, part 73.
572. gbcon74.seq - Constructed sequence entries, part 74.
573. gbcon75.seq - Constructed sequence entries, part 75.
574. gbcon76.seq - Constructed sequence entries, part 76.
575. gbcon77.seq - Constructed sequence entries, part 77.
576. gbcon78.seq - Constructed sequence entries, part 78.
577. gbcon79.seq - Constructed sequence entries, part 79.
578. gbcon8.seq - Constructed sequence entries, part 8.
579. gbcon80.seq - Constructed sequence entries, part 80.
580. gbcon81.seq - Constructed sequence entries, part 81.
581. gbcon82.seq - Constructed sequence entries, part 82.
582. gbcon83.seq - Constructed sequence entries, part 83.
583. gbcon84.seq - Constructed sequence entries, part 84.
584. gbcon85.seq - Constructed sequence entries, part 85.
585. gbcon86.seq - Constructed sequence entries, part 86.
586. gbcon87.seq - Constructed sequence entries, part 87.
587. gbcon88.seq - Constructed sequence entries, part 88.
588. gbcon89.seq - Constructed sequence entries, part 89.
589. gbcon9.seq - Constructed sequence entries, part 9.
590. gbcon90.seq - Constructed sequence entries, part 90.
591. gbcon91.seq - Constructed sequence entries, part 91.
592. gbcon92.seq - Constructed sequence entries, part 92.
593. gbcon93.seq - Constructed sequence entries, part 93.
594. gbcon94.seq - Constructed sequence entries, part 94.
595. gbcon95.seq - Constructed sequence entries, part 95.
596. gbcon96.seq - Constructed sequence entries, part 96.
597. gbcon97.seq - Constructed sequence entries, part 97.
598. gbcon98.seq - Constructed sequence entries, part 98.
599. gbcon99.seq - Constructed sequence entries, part 99.
600. gbdel.txt - Accession numbers of entries deleted since the previous release.
601. gbenv1.seq - Environmental sampling sequence entries, part 1.
602. gbenv10.seq - Environmental sampling sequence entries, part 10.
603. gbenv11.seq - Environmental sampling sequence entries, part 11.
604. gbenv12.seq - Environmental sampling sequence entries, part 12.
605. gbenv13.seq - Environmental sampling sequence entries, part 13.
606. gbenv14.seq - Environmental sampling sequence entries, part 14.
607. gbenv15.seq - Environmental sampling sequence entries, part 15.
608. gbenv16.seq - Environmental sampling sequence entries, part 16.
609. gbenv17.seq - Environmental sampling sequence entries, part 17.
610. gbenv18.seq - Environmental sampling sequence entries, part 18.
611. gbenv19.seq - Environmental sampling sequence entries, part 19.
612. gbenv2.seq - Environmental sampling sequence entries, part 2.
613. gbenv20.seq - Environmental sampling sequence entries, part 20.
614. gbenv21.seq - Environmental sampling sequence entries, part 21.
615. gbenv22.seq - Environmental sampling sequence entries, part 22.
616. gbenv23.seq - Environmental sampling sequence entries, part 23.
617. gbenv24.seq - Environmental sampling sequence entries, part 24.
618. gbenv25.seq - Environmental sampling sequence entries, part 25.
619. gbenv26.seq - Environmental sampling sequence entries, part 26.
620. gbenv27.seq - Environmental sampling sequence entries, part 27.
621. gbenv28.seq - Environmental sampling sequence entries, part 28.
622. gbenv29.seq - Environmental sampling sequence entries, part 29.
623. gbenv3.seq - Environmental sampling sequence entries, part 3.
624. gbenv30.seq - Environmental sampling sequence entries, part 30.
625. gbenv31.seq - Environmental sampling sequence entries, part 31.
626. gbenv32.seq - Environmental sampling sequence entries, part 32.
627. gbenv33.seq - Environmental sampling sequence entries, part 33.
628. gbenv34.seq - Environmental sampling sequence entries, part 34.
629. gbenv35.seq - Environmental sampling sequence entries, part 35.
630. gbenv36.seq - Environmental sampling sequence entries, part 36.
631. gbenv37.seq - Environmental sampling sequence entries, part 37.
632. gbenv38.seq - Environmental sampling sequence entries, part 38.
633. gbenv39.seq - Environmental sampling sequence entries, part 39.
634. gbenv4.seq - Environmental sampling sequence entries, part 4.
635. gbenv40.seq - Environmental sampling sequence entries, part 40.
636. gbenv41.seq - Environmental sampling sequence entries, part 41.
637. gbenv42.seq - Environmental sampling sequence entries, part 42.
638. gbenv43.seq - Environmental sampling sequence entries, part 43.
639. gbenv44.seq - Environmental sampling sequence entries, part 44.
640. gbenv45.seq - Environmental sampling sequence entries, part 45.
641. gbenv46.seq - Environmental sampling sequence entries, part 46.
642. gbenv47.seq - Environmental sampling sequence entries, part 47.
643. gbenv48.seq - Environmental sampling sequence entries, part 48.
644. gbenv49.seq - Environmental sampling sequence entries, part 49.
645. gbenv5.seq - Environmental sampling sequence entries, part 5.
646. gbenv50.seq - Environmental sampling sequence entries, part 50.
647. gbenv51.seq - Environmental sampling sequence entries, part 51.
648. gbenv52.seq - Environmental sampling sequence entries, part 52.
649. gbenv53.seq - Environmental sampling sequence entries, part 53.
650. gbenv54.seq - Environmental sampling sequence entries, part 54.
651. gbenv55.seq - Environmental sampling sequence entries, part 55.
652. gbenv56.seq - Environmental sampling sequence entries, part 56.
653. gbenv57.seq - Environmental sampling sequence entries, part 57.
654. gbenv58.seq - Environmental sampling sequence entries, part 58.
655. gbenv6.seq - Environmental sampling sequence entries, part 6.
656. gbenv7.seq - Environmental sampling sequence entries, part 7.
657. gbenv8.seq - Environmental sampling sequence entries, part 8.
658. gbenv9.seq - Environmental sampling sequence entries, part 9.
659. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
660. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
661. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
662. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
663. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
664. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
665. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
666. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
667. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
668. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
669. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
670. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
671. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
672. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
673. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
674. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
675. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
676. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
677. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
678. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
679. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
680. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
681. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
682. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
683. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
684. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
685. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
686. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
687. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
688. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
689. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
690. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
691. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
692. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
693. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
694. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
695. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
696. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
697. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
698. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
699. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
700. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
701. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
702. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
703. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
704. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
705. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
706. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
707. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
708. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
709. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
710. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
711. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
712. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
713. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
714. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
715. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
716. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
717. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
718. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
719. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
720. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
721. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
722. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
723. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
724. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
725. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
726. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
727. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
728. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
729. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
730. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
731. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
732. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
733. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
734. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
735. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
736. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
737. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
738. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
739. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
740. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
741. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
742. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
743. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
744. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
745. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
746. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
747. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
748. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
749. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
750. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
751. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
752. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
753. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
754. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
755. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
756. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
757. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
758. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
759. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
760. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
761. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
762. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
763. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
764. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
765. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
766. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
767. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
768. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
769. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
770. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
771. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
772. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
773. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
774. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
775. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
776. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
777. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
778. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
779. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
780. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
781. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
782. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
783. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
784. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
785. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
786. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
787. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
788. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
789. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
790. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
791. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
792. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
793. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
794. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
795. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
796. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
797. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
798. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
799. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
800. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
801. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
802. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
803. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
804. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
805. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
806. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
807. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
808. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
809. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
810. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
811. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
812. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
813. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
814. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
815. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
816. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
817. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
818. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
819. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
820. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
821. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
822. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
823. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
824. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
825. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
826. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
827. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
828. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
829. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
830. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
831. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
832. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
833. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
834. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
835. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
836. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
837. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
838. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
839. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
840. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
841. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
842. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
843. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
844. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
845. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
846. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
847. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
848. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
849. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
850. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
851. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
852. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
853. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
854. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
855. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
856. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
857. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
858. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
859. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
860. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
861. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
862. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
863. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
864. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
865. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
866. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
867. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
868. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
869. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
870. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
871. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
872. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
873. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
874. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
875. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
876. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
877. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
878. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
879. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
880. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
881. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
882. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
883. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
884. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
885. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
886. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
887. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
888. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
889. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
890. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
891. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
892. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
893. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
894. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
895. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
896. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
897. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
898. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
899. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
900. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
901. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
902. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
903. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
904. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
905. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
906. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
907. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
908. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
909. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
910. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
911. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
912. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
913. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
914. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
915. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
916. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
917. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
918. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
919. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
920. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
921. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
922. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
923. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
924. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
925. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
926. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
927. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
928. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
929. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
930. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
931. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
932. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
933. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
934. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
935. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
936. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
937. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
938. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
939. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
940. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
941. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
942. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
943. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
944. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
945. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
946. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
947. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
948. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
949. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
950. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
951. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
952. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
953. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
954. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
955. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
956. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
957. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
958. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
959. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
960. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
961. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
962. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
963. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
964. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
965. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
966. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
967. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
968. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
969. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
970. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
971. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
972. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
973. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
974. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
975. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
976. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
977. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
978. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
979. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
980. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
981. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
982. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
983. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
984. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
985. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
986. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
987. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
988. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
989. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
990. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
991. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
992. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
993. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
994. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
995. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
996. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
997. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
998. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
999. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1000. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1001. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1002. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1003. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1004. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1005. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1006. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1007. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1008. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1009. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1010. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1011. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1012. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1013. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1014. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1015. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1016. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1017. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1018. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1019. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1020. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1021. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1022. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1023. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1024. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1025. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1026. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1027. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1028. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1029. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1030. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1031. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1032. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1033. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1034. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1035. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1036. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1037. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1038. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1039. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1040. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1041. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1042. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1043. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1044. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1045. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1046. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1047. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1048. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1049. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1050. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1051. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1052. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1053. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1054. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1055. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1056. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1057. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1058. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1059. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1060. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1061. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1062. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1063. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1064. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1065. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1066. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1067. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1068. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1069. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1070. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1071. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1072. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1073. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1074. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1075. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1076. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1077. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1078. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1079. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1080. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1081. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1082. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1083. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1084. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1085. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1086. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1087. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1088. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1089. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1090. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1091. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1092. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1093. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1094. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1095. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1096. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1097. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1098. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1099. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1100. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1101. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1102. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1103. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1104. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1105. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1106. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1107. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1108. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1109. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1110. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1111. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1112. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1113. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1114. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1115. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1116. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1117. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1118. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1119. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1120. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1121. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1122. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1123. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1124. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1125. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1126. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1127. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1128. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1129. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1130. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1131. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1132. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1133. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1134. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1135. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1136. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1137. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1138. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1139. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1140. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1141. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1142. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1143. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1144. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1145. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1146. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1147. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1148. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1149. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1150. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1151. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1152. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1153. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1154. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1155. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1156. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1157. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1158. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1159. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1160. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1161. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1162. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1163. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1164. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1165. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1166. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1167. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1168. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1169. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1170. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1171. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1172. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1173. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1174. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1175. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1176. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1177. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1178. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1179. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1180. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1181. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1182. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1183. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1184. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1185. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1186. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1187. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1188. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1189. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1190. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1191. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1192. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1193. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1194. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1195. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1196. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1197. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1198. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1199. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1200. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1201. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1202. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1203. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1204. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1205. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1206. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1207. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1208. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1209. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1210. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1211. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1212. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1213. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1214. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1215. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1216. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1217. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1218. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1219. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1220. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1221. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1222. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1223. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1224. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1225. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1226. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1227. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1228. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1229. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1230. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1231. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1232. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1233. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1234. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1235. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1236. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1237. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1238. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1239. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1240. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1241. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1242. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1243. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1244. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1245. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1246. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1247. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1248. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1249. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1250. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1251. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1252. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1253. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1254. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1255. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1256. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1257. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1258. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1259. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1260. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1261. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1262. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1263. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1264. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1265. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1266. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1267. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1268. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1269. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1270. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1271. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1272. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1273. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1274. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1275. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1276. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1277. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1278. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1279. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1280. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1281. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1282. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1283. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1284. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1285. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1286. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1287. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1288. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1289. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1290. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1291. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1292. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1293. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1294. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1295. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1296. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1297. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1298. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1299. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1300. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1301. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1302. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1303. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1304. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1305. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1306. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1307. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1308. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1309. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1310. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1311. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1312. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1313. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1314. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1315. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1316. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1317. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1318. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1319. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1320. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1321. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1322. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1323. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1324. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1325. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1326. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1327. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1328. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1329. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1330. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1331. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1332. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1333. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1334. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1335. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1336. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1337. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1338. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1339. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1340. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1341. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1342. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1343. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1344. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1345. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1346. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1347. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1348. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1349. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1350. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1351. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1352. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1353. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1354. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1355. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1356. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1357. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1358. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1359. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1360. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1361. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1362. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1363. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1364. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1365. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1366. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1367. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1368. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1369. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1370. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1371. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1372. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1373. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1374. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1375. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1376. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1377. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1378. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1379. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1380. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1381. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1382. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1383. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1384. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1385. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1386. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1387. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1388. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1389. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1390. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1391. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1392. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1393. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1394. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1395. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1396. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1397. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1398. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1399. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1400. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1401. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1402. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1403. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1404. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1405. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1406. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1407. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1408. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1409. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1410. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1411. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1412. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1413. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1414. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1415. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1416. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1417. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1418. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1419. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1420. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1421. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1422. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1423. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1424. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1425. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1426. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1427. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1428. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1429. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1430. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1431. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1432. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1433. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1434. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1435. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1436. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1437. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1438. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1439. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1440. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1441. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1442. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1443. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1444. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1445. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1446. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1447. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1448. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1449. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1450. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1451. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1452. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1453. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1454. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1455. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1456. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1457. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1458. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1459. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1460. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1461. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1462. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1463. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1464. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1465. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1466. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1467. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1468. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1469. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1470. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1471. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1472. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1473. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1474. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1475. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1476. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1477. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1478. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1479. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1480. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1481. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1482. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1483. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1484. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1485. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1486. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1487. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1488. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1489. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1490. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1491. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1492. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1493. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1494. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1495. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1496. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1497. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1498. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1499. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1500. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1501. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1502. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1503. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1504. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1505. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1506. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1507. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1508. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1509. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1510. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1511. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1512. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1513. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1514. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1515. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1516. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1517. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1518. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1519. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1520. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1521. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1522. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1523. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1524. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1525. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1526. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1527. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1528. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1529. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1530. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1531. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1532. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1533. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1534. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1535. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1536. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1537. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1538. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1539. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1540. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1541. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1542. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1543. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1544. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1545. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1546. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1547. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1548. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1549. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1550. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1551. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1552. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1553. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1554. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1555. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1556. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1557. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1558. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1559. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1560. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1561. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1562. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1563. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1564. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1565. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1566. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1567. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1568. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1569. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1570. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1571. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1572. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1573. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1574. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1575. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1576. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1577. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1578. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1579. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1580. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1581. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1582. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1583. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1584. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1585. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1586. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1587. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1588. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1589. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1590. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1591. gbinv1.seq - Invertebrate sequence entries, part 1.
1592. gbinv10.seq - Invertebrate sequence entries, part 10.
1593. gbinv100.seq - Invertebrate sequence entries, part 100.
1594. gbinv101.seq - Invertebrate sequence entries, part 101.
1595. gbinv102.seq - Invertebrate sequence entries, part 102.
1596. gbinv103.seq - Invertebrate sequence entries, part 103.
1597. gbinv104.seq - Invertebrate sequence entries, part 104.
1598. gbinv105.seq - Invertebrate sequence entries, part 105.
1599. gbinv106.seq - Invertebrate sequence entries, part 106.
1600. gbinv107.seq - Invertebrate sequence entries, part 107.
1601. gbinv108.seq - Invertebrate sequence entries, part 108.
1602. gbinv109.seq - Invertebrate sequence entries, part 109.
1603. gbinv11.seq - Invertebrate sequence entries, part 11.
1604. gbinv110.seq - Invertebrate sequence entries, part 110.
1605. gbinv12.seq - Invertebrate sequence entries, part 12.
1606. gbinv13.seq - Invertebrate sequence entries, part 13.
1607. gbinv14.seq - Invertebrate sequence entries, part 14.
1608. gbinv15.seq - Invertebrate sequence entries, part 15.
1609. gbinv16.seq - Invertebrate sequence entries, part 16.
1610. gbinv17.seq - Invertebrate sequence entries, part 17.
1611. gbinv18.seq - Invertebrate sequence entries, part 18.
1612. gbinv19.seq - Invertebrate sequence entries, part 19.
1613. gbinv2.seq - Invertebrate sequence entries, part 2.
1614. gbinv20.seq - Invertebrate sequence entries, part 20.
1615. gbinv21.seq - Invertebrate sequence entries, part 21.
1616. gbinv22.seq - Invertebrate sequence entries, part 22.
1617. gbinv23.seq - Invertebrate sequence entries, part 23.
1618. gbinv24.seq - Invertebrate sequence entries, part 24.
1619. gbinv25.seq - Invertebrate sequence entries, part 25.
1620. gbinv26.seq - Invertebrate sequence entries, part 26.
1621. gbinv27.seq - Invertebrate sequence entries, part 27.
1622. gbinv28.seq - Invertebrate sequence entries, part 28.
1623. gbinv29.seq - Invertebrate sequence entries, part 29.
1624. gbinv3.seq - Invertebrate sequence entries, part 3.
1625. gbinv30.seq - Invertebrate sequence entries, part 30.
1626. gbinv31.seq - Invertebrate sequence entries, part 31.
1627. gbinv32.seq - Invertebrate sequence entries, part 32.
1628. gbinv33.seq - Invertebrate sequence entries, part 33.
1629. gbinv34.seq - Invertebrate sequence entries, part 34.
1630. gbinv35.seq - Invertebrate sequence entries, part 35.
1631. gbinv36.seq - Invertebrate sequence entries, part 36.
1632. gbinv37.seq - Invertebrate sequence entries, part 37.
1633. gbinv38.seq - Invertebrate sequence entries, part 38.
1634. gbinv39.seq - Invertebrate sequence entries, part 39.
1635. gbinv4.seq - Invertebrate sequence entries, part 4.
1636. gbinv40.seq - Invertebrate sequence entries, part 40.
1637. gbinv41.seq - Invertebrate sequence entries, part 41.
1638. gbinv42.seq - Invertebrate sequence entries, part 42.
1639. gbinv43.seq - Invertebrate sequence entries, part 43.
1640. gbinv44.seq - Invertebrate sequence entries, part 44.
1641. gbinv45.seq - Invertebrate sequence entries, part 45.
1642. gbinv46.seq - Invertebrate sequence entries, part 46.
1643. gbinv47.seq - Invertebrate sequence entries, part 47.
1644. gbinv48.seq - Invertebrate sequence entries, part 48.
1645. gbinv49.seq - Invertebrate sequence entries, part 49.
1646. gbinv5.seq - Invertebrate sequence entries, part 5.
1647. gbinv50.seq - Invertebrate sequence entries, part 50.
1648. gbinv51.seq - Invertebrate sequence entries, part 51.
1649. gbinv52.seq - Invertebrate sequence entries, part 52.
1650. gbinv53.seq - Invertebrate sequence entries, part 53.
1651. gbinv54.seq - Invertebrate sequence entries, part 54.
1652. gbinv55.seq - Invertebrate sequence entries, part 55.
1653. gbinv56.seq - Invertebrate sequence entries, part 56.
1654. gbinv57.seq - Invertebrate sequence entries, part 57.
1655. gbinv58.seq - Invertebrate sequence entries, part 58.
1656. gbinv59.seq - Invertebrate sequence entries, part 59.
1657. gbinv6.seq - Invertebrate sequence entries, part 6.
1658. gbinv60.seq - Invertebrate sequence entries, part 60.
1659. gbinv61.seq - Invertebrate sequence entries, part 61.
1660. gbinv62.seq - Invertebrate sequence entries, part 62.
1661. gbinv63.seq - Invertebrate sequence entries, part 63.
1662. gbinv64.seq - Invertebrate sequence entries, part 64.
1663. gbinv65.seq - Invertebrate sequence entries, part 65.
1664. gbinv66.seq - Invertebrate sequence entries, part 66.
1665. gbinv67.seq - Invertebrate sequence entries, part 67.
1666. gbinv68.seq - Invertebrate sequence entries, part 68.
1667. gbinv69.seq - Invertebrate sequence entries, part 69.
1668. gbinv7.seq - Invertebrate sequence entries, part 7.
1669. gbinv70.seq - Invertebrate sequence entries, part 70.
1670. gbinv71.seq - Invertebrate sequence entries, part 71.
1671. gbinv72.seq - Invertebrate sequence entries, part 72.
1672. gbinv73.seq - Invertebrate sequence entries, part 73.
1673. gbinv74.seq - Invertebrate sequence entries, part 74.
1674. gbinv75.seq - Invertebrate sequence entries, part 75.
1675. gbinv76.seq - Invertebrate sequence entries, part 76.
1676. gbinv77.seq - Invertebrate sequence entries, part 77.
1677. gbinv78.seq - Invertebrate sequence entries, part 78.
1678. gbinv79.seq - Invertebrate sequence entries, part 79.
1679. gbinv8.seq - Invertebrate sequence entries, part 8.
1680. gbinv80.seq - Invertebrate sequence entries, part 80.
1681. gbinv81.seq - Invertebrate sequence entries, part 81.
1682. gbinv82.seq - Invertebrate sequence entries, part 82.
1683. gbinv83.seq - Invertebrate sequence entries, part 83.
1684. gbinv84.seq - Invertebrate sequence entries, part 84.
1685. gbinv85.seq - Invertebrate sequence entries, part 85.
1686. gbinv86.seq - Invertebrate sequence entries, part 86.
1687. gbinv87.seq - Invertebrate sequence entries, part 87.
1688. gbinv88.seq - Invertebrate sequence entries, part 88.
1689. gbinv89.seq - Invertebrate sequence entries, part 89.
1690. gbinv9.seq - Invertebrate sequence entries, part 9.
1691. gbinv90.seq - Invertebrate sequence entries, part 90.
1692. gbinv91.seq - Invertebrate sequence entries, part 91.
1693. gbinv92.seq - Invertebrate sequence entries, part 92.
1694. gbinv93.seq - Invertebrate sequence entries, part 93.
1695. gbinv94.seq - Invertebrate sequence entries, part 94.
1696. gbinv95.seq - Invertebrate sequence entries, part 95.
1697. gbinv96.seq - Invertebrate sequence entries, part 96.
1698. gbinv97.seq - Invertebrate sequence entries, part 97.
1699. gbinv98.seq - Invertebrate sequence entries, part 98.
1700. gbinv99.seq - Invertebrate sequence entries, part 99.
1701. gbmam1.seq - Other mammalian sequence entries, part 1.
1702. gbmam10.seq - Other mammalian sequence entries, part 10.
1703. gbmam11.seq - Other mammalian sequence entries, part 11.
1704. gbmam12.seq - Other mammalian sequence entries, part 12.
1705. gbmam13.seq - Other mammalian sequence entries, part 13.
1706. gbmam14.seq - Other mammalian sequence entries, part 14.
1707. gbmam15.seq - Other mammalian sequence entries, part 15.
1708. gbmam16.seq - Other mammalian sequence entries, part 16.
1709. gbmam17.seq - Other mammalian sequence entries, part 17.
1710. gbmam18.seq - Other mammalian sequence entries, part 18.
1711. gbmam19.seq - Other mammalian sequence entries, part 19.
1712. gbmam2.seq - Other mammalian sequence entries, part 2.
1713. gbmam20.seq - Other mammalian sequence entries, part 20.
1714. gbmam21.seq - Other mammalian sequence entries, part 21.
1715. gbmam22.seq - Other mammalian sequence entries, part 22.
1716. gbmam23.seq - Other mammalian sequence entries, part 23.
1717. gbmam24.seq - Other mammalian sequence entries, part 24.
1718. gbmam25.seq - Other mammalian sequence entries, part 25.
1719. gbmam26.seq - Other mammalian sequence entries, part 26.
1720. gbmam27.seq - Other mammalian sequence entries, part 27.
1721. gbmam28.seq - Other mammalian sequence entries, part 28.
1722. gbmam29.seq - Other mammalian sequence entries, part 29.
1723. gbmam3.seq - Other mammalian sequence entries, part 3.
1724. gbmam30.seq - Other mammalian sequence entries, part 30.
1725. gbmam31.seq - Other mammalian sequence entries, part 31.
1726. gbmam32.seq - Other mammalian sequence entries, part 32.
1727. gbmam33.seq - Other mammalian sequence entries, part 33.
1728. gbmam4.seq - Other mammalian sequence entries, part 4.
1729. gbmam5.seq - Other mammalian sequence entries, part 5.
1730. gbmam6.seq - Other mammalian sequence entries, part 6.
1731. gbmam7.seq - Other mammalian sequence entries, part 7.
1732. gbmam8.seq - Other mammalian sequence entries, part 8.
1733. gbmam9.seq - Other mammalian sequence entries, part 9.
1734. gbnew.txt - Accession numbers of entries new since the previous release.
1735. gbpat1.seq - Patent sequence entries, part 1.
1736. gbpat10.seq - Patent sequence entries, part 10.
1737. gbpat100.seq - Patent sequence entries, part 100.
1738. gbpat101.seq - Patent sequence entries, part 101.
1739. gbpat102.seq - Patent sequence entries, part 102.
1740. gbpat103.seq - Patent sequence entries, part 103.
1741. gbpat104.seq - Patent sequence entries, part 104.
1742. gbpat105.seq - Patent sequence entries, part 105.
1743. gbpat106.seq - Patent sequence entries, part 106.
1744. gbpat107.seq - Patent sequence entries, part 107.
1745. gbpat108.seq - Patent sequence entries, part 108.
1746. gbpat109.seq - Patent sequence entries, part 109.
1747. gbpat11.seq - Patent sequence entries, part 11.
1748. gbpat110.seq - Patent sequence entries, part 110.
1749. gbpat111.seq - Patent sequence entries, part 111.
1750. gbpat112.seq - Patent sequence entries, part 112.
1751. gbpat113.seq - Patent sequence entries, part 113.
1752. gbpat114.seq - Patent sequence entries, part 114.
1753. gbpat115.seq - Patent sequence entries, part 115.
1754. gbpat116.seq - Patent sequence entries, part 116.
1755. gbpat117.seq - Patent sequence entries, part 117.
1756. gbpat118.seq - Patent sequence entries, part 118.
1757. gbpat119.seq - Patent sequence entries, part 119.
1758. gbpat12.seq - Patent sequence entries, part 12.
1759. gbpat120.seq - Patent sequence entries, part 120.
1760. gbpat121.seq - Patent sequence entries, part 121.
1761. gbpat122.seq - Patent sequence entries, part 122.
1762. gbpat123.seq - Patent sequence entries, part 123.
1763. gbpat124.seq - Patent sequence entries, part 124.
1764. gbpat125.seq - Patent sequence entries, part 125.
1765. gbpat126.seq - Patent sequence entries, part 126.
1766. gbpat127.seq - Patent sequence entries, part 127.
1767. gbpat128.seq - Patent sequence entries, part 128.
1768. gbpat129.seq - Patent sequence entries, part 129.
1769. gbpat13.seq - Patent sequence entries, part 13.
1770. gbpat130.seq - Patent sequence entries, part 130.
1771. gbpat131.seq - Patent sequence entries, part 131.
1772. gbpat132.seq - Patent sequence entries, part 132.
1773. gbpat133.seq - Patent sequence entries, part 133.
1774. gbpat134.seq - Patent sequence entries, part 134.
1775. gbpat135.seq - Patent sequence entries, part 135.
1776. gbpat136.seq - Patent sequence entries, part 136.
1777. gbpat137.seq - Patent sequence entries, part 137.
1778. gbpat138.seq - Patent sequence entries, part 138.
1779. gbpat139.seq - Patent sequence entries, part 139.
1780. gbpat14.seq - Patent sequence entries, part 14.
1781. gbpat140.seq - Patent sequence entries, part 140.
1782. gbpat141.seq - Patent sequence entries, part 141.
1783. gbpat142.seq - Patent sequence entries, part 142.
1784. gbpat143.seq - Patent sequence entries, part 143.
1785. gbpat144.seq - Patent sequence entries, part 144.
1786. gbpat145.seq - Patent sequence entries, part 145.
1787. gbpat146.seq - Patent sequence entries, part 146.
1788. gbpat147.seq - Patent sequence entries, part 147.
1789. gbpat148.seq - Patent sequence entries, part 148.
1790. gbpat149.seq - Patent sequence entries, part 149.
1791. gbpat15.seq - Patent sequence entries, part 15.
1792. gbpat150.seq - Patent sequence entries, part 150.
1793. gbpat151.seq - Patent sequence entries, part 151.
1794. gbpat152.seq - Patent sequence entries, part 152.
1795. gbpat153.seq - Patent sequence entries, part 153.
1796. gbpat154.seq - Patent sequence entries, part 154.
1797. gbpat155.seq - Patent sequence entries, part 155.
1798. gbpat156.seq - Patent sequence entries, part 156.
1799. gbpat157.seq - Patent sequence entries, part 157.
1800. gbpat158.seq - Patent sequence entries, part 158.
1801. gbpat159.seq - Patent sequence entries, part 159.
1802. gbpat16.seq - Patent sequence entries, part 16.
1803. gbpat160.seq - Patent sequence entries, part 160.
1804. gbpat161.seq - Patent sequence entries, part 161.
1805. gbpat162.seq - Patent sequence entries, part 162.
1806. gbpat163.seq - Patent sequence entries, part 163.
1807. gbpat164.seq - Patent sequence entries, part 164.
1808. gbpat165.seq - Patent sequence entries, part 165.
1809. gbpat166.seq - Patent sequence entries, part 166.
1810. gbpat167.seq - Patent sequence entries, part 167.
1811. gbpat168.seq - Patent sequence entries, part 168.
1812. gbpat169.seq - Patent sequence entries, part 169.
1813. gbpat17.seq - Patent sequence entries, part 17.
1814. gbpat170.seq - Patent sequence entries, part 170.
1815. gbpat171.seq - Patent sequence entries, part 171.
1816. gbpat172.seq - Patent sequence entries, part 172.
1817. gbpat173.seq - Patent sequence entries, part 173.
1818. gbpat174.seq - Patent sequence entries, part 174.
1819. gbpat175.seq - Patent sequence entries, part 175.
1820. gbpat176.seq - Patent sequence entries, part 176.
1821. gbpat177.seq - Patent sequence entries, part 177.
1822. gbpat178.seq - Patent sequence entries, part 178.
1823. gbpat179.seq - Patent sequence entries, part 179.
1824. gbpat18.seq - Patent sequence entries, part 18.
1825. gbpat180.seq - Patent sequence entries, part 180.
1826. gbpat181.seq - Patent sequence entries, part 181.
1827. gbpat182.seq - Patent sequence entries, part 182.
1828. gbpat183.seq - Patent sequence entries, part 183.
1829. gbpat184.seq - Patent sequence entries, part 184.
1830. gbpat185.seq - Patent sequence entries, part 185.
1831. gbpat186.seq - Patent sequence entries, part 186.
1832. gbpat187.seq - Patent sequence entries, part 187.
1833. gbpat188.seq - Patent sequence entries, part 188.
1834. gbpat189.seq - Patent sequence entries, part 189.
1835. gbpat19.seq - Patent sequence entries, part 19.
1836. gbpat190.seq - Patent sequence entries, part 190.
1837. gbpat191.seq - Patent sequence entries, part 191.
1838. gbpat192.seq - Patent sequence entries, part 192.
1839. gbpat193.seq - Patent sequence entries, part 193.
1840. gbpat194.seq - Patent sequence entries, part 194.
1841. gbpat195.seq - Patent sequence entries, part 195.
1842. gbpat196.seq - Patent sequence entries, part 196.
1843. gbpat197.seq - Patent sequence entries, part 197.
1844. gbpat198.seq - Patent sequence entries, part 198.
1845. gbpat199.seq - Patent sequence entries, part 199.
1846. gbpat2.seq - Patent sequence entries, part 2.
1847. gbpat20.seq - Patent sequence entries, part 20.
1848. gbpat200.seq - Patent sequence entries, part 200.
1849. gbpat201.seq - Patent sequence entries, part 201.
1850. gbpat21.seq - Patent sequence entries, part 21.
1851. gbpat22.seq - Patent sequence entries, part 22.
1852. gbpat23.seq - Patent sequence entries, part 23.
1853. gbpat24.seq - Patent sequence entries, part 24.
1854. gbpat25.seq - Patent sequence entries, part 25.
1855. gbpat26.seq - Patent sequence entries, part 26.
1856. gbpat27.seq - Patent sequence entries, part 27.
1857. gbpat28.seq - Patent sequence entries, part 28.
1858. gbpat29.seq - Patent sequence entries, part 29.
1859. gbpat3.seq - Patent sequence entries, part 3.
1860. gbpat30.seq - Patent sequence entries, part 30.
1861. gbpat31.seq - Patent sequence entries, part 31.
1862. gbpat32.seq - Patent sequence entries, part 32.
1863. gbpat33.seq - Patent sequence entries, part 33.
1864. gbpat34.seq - Patent sequence entries, part 34.
1865. gbpat35.seq - Patent sequence entries, part 35.
1866. gbpat36.seq - Patent sequence entries, part 36.
1867. gbpat37.seq - Patent sequence entries, part 37.
1868. gbpat38.seq - Patent sequence entries, part 38.
1869. gbpat39.seq - Patent sequence entries, part 39.
1870. gbpat4.seq - Patent sequence entries, part 4.
1871. gbpat40.seq - Patent sequence entries, part 40.
1872. gbpat41.seq - Patent sequence entries, part 41.
1873. gbpat42.seq - Patent sequence entries, part 42.
1874. gbpat43.seq - Patent sequence entries, part 43.
1875. gbpat44.seq - Patent sequence entries, part 44.
1876. gbpat45.seq - Patent sequence entries, part 45.
1877. gbpat46.seq - Patent sequence entries, part 46.
1878. gbpat47.seq - Patent sequence entries, part 47.
1879. gbpat48.seq - Patent sequence entries, part 48.
1880. gbpat49.seq - Patent sequence entries, part 49.
1881. gbpat5.seq - Patent sequence entries, part 5.
1882. gbpat50.seq - Patent sequence entries, part 50.
1883. gbpat51.seq - Patent sequence entries, part 51.
1884. gbpat52.seq - Patent sequence entries, part 52.
1885. gbpat53.seq - Patent sequence entries, part 53.
1886. gbpat54.seq - Patent sequence entries, part 54.
1887. gbpat55.seq - Patent sequence entries, part 55.
1888. gbpat56.seq - Patent sequence entries, part 56.
1889. gbpat57.seq - Patent sequence entries, part 57.
1890. gbpat58.seq - Patent sequence entries, part 58.
1891. gbpat59.seq - Patent sequence entries, part 59.
1892. gbpat6.seq - Patent sequence entries, part 6.
1893. gbpat60.seq - Patent sequence entries, part 60.
1894. gbpat61.seq - Patent sequence entries, part 61.
1895. gbpat62.seq - Patent sequence entries, part 62.
1896. gbpat63.seq - Patent sequence entries, part 63.
1897. gbpat64.seq - Patent sequence entries, part 64.
1898. gbpat65.seq - Patent sequence entries, part 65.
1899. gbpat66.seq - Patent sequence entries, part 66.
1900. gbpat67.seq - Patent sequence entries, part 67.
1901. gbpat68.seq - Patent sequence entries, part 68.
1902. gbpat69.seq - Patent sequence entries, part 69.
1903. gbpat7.seq - Patent sequence entries, part 7.
1904. gbpat70.seq - Patent sequence entries, part 70.
1905. gbpat71.seq - Patent sequence entries, part 71.
1906. gbpat72.seq - Patent sequence entries, part 72.
1907. gbpat73.seq - Patent sequence entries, part 73.
1908. gbpat74.seq - Patent sequence entries, part 74.
1909. gbpat75.seq - Patent sequence entries, part 75.
1910. gbpat76.seq - Patent sequence entries, part 76.
1911. gbpat77.seq - Patent sequence entries, part 77.
1912. gbpat78.seq - Patent sequence entries, part 78.
1913. gbpat79.seq - Patent sequence entries, part 79.
1914. gbpat8.seq - Patent sequence entries, part 8.
1915. gbpat80.seq - Patent sequence entries, part 80.
1916. gbpat81.seq - Patent sequence entries, part 81.
1917. gbpat82.seq - Patent sequence entries, part 82.
1918. gbpat83.seq - Patent sequence entries, part 83.
1919. gbpat84.seq - Patent sequence entries, part 84.
1920. gbpat85.seq - Patent sequence entries, part 85.
1921. gbpat86.seq - Patent sequence entries, part 86.
1922. gbpat87.seq - Patent sequence entries, part 87.
1923. gbpat88.seq - Patent sequence entries, part 88.
1924. gbpat89.seq - Patent sequence entries, part 89.
1925. gbpat9.seq - Patent sequence entries, part 9.
1926. gbpat90.seq - Patent sequence entries, part 90.
1927. gbpat91.seq - Patent sequence entries, part 91.
1928. gbpat92.seq - Patent sequence entries, part 92.
1929. gbpat93.seq - Patent sequence entries, part 93.
1930. gbpat94.seq - Patent sequence entries, part 94.
1931. gbpat95.seq - Patent sequence entries, part 95.
1932. gbpat96.seq - Patent sequence entries, part 96.
1933. gbpat97.seq - Patent sequence entries, part 97.
1934. gbpat98.seq - Patent sequence entries, part 98.
1935. gbpat99.seq - Patent sequence entries, part 99.
1936. gbphg1.seq - Phage sequence entries, part 1.
1937. gbphg2.seq - Phage sequence entries, part 2.
1938. gbphg3.seq - Phage sequence entries, part 3.
1939. gbphg4.seq - Phage sequence entries, part 4.
1940. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1941. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1942. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
1943. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
1944. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
1945. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
1946. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
1947. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
1948. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
1949. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
1950. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
1951. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
1952. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1953. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
1954. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
1955. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
1956. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
1957. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
1958. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
1959. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
1960. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
1961. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
1962. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
1963. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1964. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
1965. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
1966. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
1967. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
1968. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
1969. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
1970. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
1971. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
1972. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
1973. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
1974. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
1975. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
1976. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
1977. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
1978. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
1979. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
1980. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
1981. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
1982. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
1983. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
1984. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
1985. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
1986. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
1987. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
1988. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
1989. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
1990. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
1991. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
1992. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
1993. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
1994. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
1995. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
1996. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
1997. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
1998. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
1999. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2000. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2001. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2002. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2003. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2004. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2005. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2006. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2007. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2008. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2009. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2010. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2011. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2012. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2013. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2014. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2015. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2016. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2017. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2018. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2019. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2020. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2021. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2022. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2023. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2024. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2025. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2026. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2027. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2028. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2029. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2030. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2031. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2032. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2033. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2034. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2035. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2036. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2037. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2038. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2039. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2040. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2041. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2042. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2043. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2044. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2045. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2046. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2047. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2048. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2049. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2050. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2051. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2052. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2053. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2054. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2055. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2056. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2057. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2058. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2059. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2060. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2061. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2062. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2063. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2064. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2065. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2066. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2067. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2068. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2069. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2070. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2071. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2072. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2073. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2074. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2075. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2076. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2077. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2078. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2079. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2080. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2081. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2082. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2083. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2084. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2085. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2086. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2087. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2088. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2089. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2090. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2091. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2092. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2093. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2094. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2095. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2096. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2097. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2098. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2099. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2100. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2101. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2102. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2103. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2104. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2105. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2106. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2107. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2108. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2109. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2110. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2111. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2112. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2113. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2114. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2115. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2116. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2117. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2118. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2119. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2120. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2121. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2122. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2123. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2124. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2125. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2126. gbpri1.seq - Primate sequence entries, part 1.
2127. gbpri10.seq - Primate sequence entries, part 10.
2128. gbpri11.seq - Primate sequence entries, part 11.
2129. gbpri12.seq - Primate sequence entries, part 12.
2130. gbpri13.seq - Primate sequence entries, part 13.
2131. gbpri14.seq - Primate sequence entries, part 14.
2132. gbpri15.seq - Primate sequence entries, part 15.
2133. gbpri16.seq - Primate sequence entries, part 16.
2134. gbpri17.seq - Primate sequence entries, part 17.
2135. gbpri18.seq - Primate sequence entries, part 18.
2136. gbpri19.seq - Primate sequence entries, part 19.
2137. gbpri2.seq - Primate sequence entries, part 2.
2138. gbpri20.seq - Primate sequence entries, part 20.
2139. gbpri21.seq - Primate sequence entries, part 21.
2140. gbpri22.seq - Primate sequence entries, part 22.
2141. gbpri23.seq - Primate sequence entries, part 23.
2142. gbpri24.seq - Primate sequence entries, part 24.
2143. gbpri25.seq - Primate sequence entries, part 25.
2144. gbpri26.seq - Primate sequence entries, part 26.
2145. gbpri27.seq - Primate sequence entries, part 27.
2146. gbpri28.seq - Primate sequence entries, part 28.
2147. gbpri29.seq - Primate sequence entries, part 29.
2148. gbpri3.seq - Primate sequence entries, part 3.
2149. gbpri30.seq - Primate sequence entries, part 30.
2150. gbpri31.seq - Primate sequence entries, part 31.
2151. gbpri32.seq - Primate sequence entries, part 32.
2152. gbpri33.seq - Primate sequence entries, part 33.
2153. gbpri34.seq - Primate sequence entries, part 34.
2154. gbpri4.seq - Primate sequence entries, part 4.
2155. gbpri5.seq - Primate sequence entries, part 5.
2156. gbpri6.seq - Primate sequence entries, part 6.
2157. gbpri7.seq - Primate sequence entries, part 7.
2158. gbpri8.seq - Primate sequence entries, part 8.
2159. gbpri9.seq - Primate sequence entries, part 9.
2160. gbrel.txt - Release notes (this document).
2161. gbrod1.seq - Rodent sequence entries, part 1.
2162. gbrod10.seq - Rodent sequence entries, part 10.
2163. gbrod11.seq - Rodent sequence entries, part 11.
2164. gbrod12.seq - Rodent sequence entries, part 12.
2165. gbrod13.seq - Rodent sequence entries, part 13.
2166. gbrod14.seq - Rodent sequence entries, part 14.
2167. gbrod15.seq - Rodent sequence entries, part 15.
2168. gbrod16.seq - Rodent sequence entries, part 16.
2169. gbrod17.seq - Rodent sequence entries, part 17.
2170. gbrod18.seq - Rodent sequence entries, part 18.
2171. gbrod2.seq - Rodent sequence entries, part 2.
2172. gbrod3.seq - Rodent sequence entries, part 3.
2173. gbrod4.seq - Rodent sequence entries, part 4.
2174. gbrod5.seq - Rodent sequence entries, part 5.
2175. gbrod6.seq - Rodent sequence entries, part 6.
2176. gbrod7.seq - Rodent sequence entries, part 7.
2177. gbrod8.seq - Rodent sequence entries, part 8.
2178. gbrod9.seq - Rodent sequence entries, part 9.
2179. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2180. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2181. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2182. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2183. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2184. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2185. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2186. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2187. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2188. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2189. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2190. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2191. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2192. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
2193. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
2194. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
2195. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
2196. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
2197. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
2198. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
2199. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
2200. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
2201. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2202. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
2203. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
2204. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
2205. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
2206. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
2207. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
2208. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
2209. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
2210. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2211. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2212. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2213. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2214. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2215. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2216. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2217. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2218. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2219. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2220. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2221. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2222. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2223. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2224. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2225. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2226. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2227. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2228. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2229. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2230. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2231. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2232. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2233. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2234. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2235. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2236. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2237. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2238. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2239. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2240. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2241. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2242. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2243. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2244. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2245. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2246. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2247. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2248. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2249. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2250. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2251. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2252. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2253. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2254. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2255. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2256. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2257. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2258. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2259. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2260. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2261. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2262. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2263. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2264. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2265. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2266. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2267. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2268. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2269. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2270. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2271. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2272. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2273. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2274. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2275. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2276. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2277. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2278. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2279. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2280. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2281. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2282. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2283. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2284. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2285. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2286. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2287. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2288. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2289. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2290. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2291. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2292. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2293. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2294. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2295. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2296. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2297. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2298. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2299. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2300. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2301. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2302. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2303. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2304. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2305. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2306. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2307. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2308. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2309. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2310. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2311. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2312. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2313. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2314. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2315. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2316. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2317. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2318. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2319. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2320. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2321. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2322. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2323. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2324. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2325. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2326. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2327. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2328. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2329. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2330. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2331. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2332. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2333. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2334. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2335. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2336. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2337. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2338. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2339. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2340. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2341. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2342. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2343. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2344. gbuna1.seq - Unannotated sequence entries, part 1.
2345. gbvrl1.seq - Viral sequence entries, part 1.
2346. gbvrl10.seq - Viral sequence entries, part 10.
2347. gbvrl11.seq - Viral sequence entries, part 11.
2348. gbvrl12.seq - Viral sequence entries, part 12.
2349. gbvrl13.seq - Viral sequence entries, part 13.
2350. gbvrl14.seq - Viral sequence entries, part 14.
2351. gbvrl15.seq - Viral sequence entries, part 15.
2352. gbvrl16.seq - Viral sequence entries, part 16.
2353. gbvrl17.seq - Viral sequence entries, part 17.
2354. gbvrl18.seq - Viral sequence entries, part 18.
2355. gbvrl19.seq - Viral sequence entries, part 19.
2356. gbvrl2.seq - Viral sequence entries, part 2.
2357. gbvrl20.seq - Viral sequence entries, part 20.
2358. gbvrl21.seq - Viral sequence entries, part 21.
2359. gbvrl22.seq - Viral sequence entries, part 22.
2360. gbvrl23.seq - Viral sequence entries, part 23.
2361. gbvrl24.seq - Viral sequence entries, part 24.
2362. gbvrl25.seq - Viral sequence entries, part 25.
2363. gbvrl26.seq - Viral sequence entries, part 26.
2364. gbvrl27.seq - Viral sequence entries, part 27.
2365. gbvrl28.seq - Viral sequence entries, part 28.
2366. gbvrl29.seq - Viral sequence entries, part 29.
2367. gbvrl3.seq - Viral sequence entries, part 3.
2368. gbvrl30.seq - Viral sequence entries, part 30.
2369. gbvrl31.seq - Viral sequence entries, part 31.
2370. gbvrl32.seq - Viral sequence entries, part 32.
2371. gbvrl33.seq - Viral sequence entries, part 33.
2372. gbvrl34.seq - Viral sequence entries, part 34.
2373. gbvrl4.seq - Viral sequence entries, part 4.
2374. gbvrl5.seq - Viral sequence entries, part 5.
2375. gbvrl6.seq - Viral sequence entries, part 6.
2376. gbvrl7.seq - Viral sequence entries, part 7.
2377. gbvrl8.seq - Viral sequence entries, part 8.
2378. gbvrl9.seq - Viral sequence entries, part 9.
2379. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2380. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2381. gbvrt100.seq - Other vertebrate sequence entries, part 100.
2382. gbvrt101.seq - Other vertebrate sequence entries, part 101.
2383. gbvrt102.seq - Other vertebrate sequence entries, part 102.
2384. gbvrt103.seq - Other vertebrate sequence entries, part 103.
2385. gbvrt104.seq - Other vertebrate sequence entries, part 104.
2386. gbvrt105.seq - Other vertebrate sequence entries, part 105.
2387. gbvrt106.seq - Other vertebrate sequence entries, part 106.
2388. gbvrt107.seq - Other vertebrate sequence entries, part 107.
2389. gbvrt108.seq - Other vertebrate sequence entries, part 108.
2390. gbvrt109.seq - Other vertebrate sequence entries, part 109.
2391. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2392. gbvrt110.seq - Other vertebrate sequence entries, part 110.
2393. gbvrt111.seq - Other vertebrate sequence entries, part 111.
2394. gbvrt112.seq - Other vertebrate sequence entries, part 112.
2395. gbvrt113.seq - Other vertebrate sequence entries, part 113.
2396. gbvrt114.seq - Other vertebrate sequence entries, part 114.
2397. gbvrt115.seq - Other vertebrate sequence entries, part 115.
2398. gbvrt116.seq - Other vertebrate sequence entries, part 116.
2399. gbvrt117.seq - Other vertebrate sequence entries, part 117.
2400. gbvrt118.seq - Other vertebrate sequence entries, part 118.
2401. gbvrt119.seq - Other vertebrate sequence entries, part 119.
2402. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2403. gbvrt120.seq - Other vertebrate sequence entries, part 120.
2404. gbvrt121.seq - Other vertebrate sequence entries, part 121.
2405. gbvrt122.seq - Other vertebrate sequence entries, part 122.
2406. gbvrt123.seq - Other vertebrate sequence entries, part 123.
2407. gbvrt124.seq - Other vertebrate sequence entries, part 124.
2408. gbvrt125.seq - Other vertebrate sequence entries, part 125.
2409. gbvrt126.seq - Other vertebrate sequence entries, part 126.
2410. gbvrt127.seq - Other vertebrate sequence entries, part 127.
2411. gbvrt128.seq - Other vertebrate sequence entries, part 128.
2412. gbvrt129.seq - Other vertebrate sequence entries, part 129.
2413. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2414. gbvrt130.seq - Other vertebrate sequence entries, part 130.
2415. gbvrt131.seq - Other vertebrate sequence entries, part 131.
2416. gbvrt132.seq - Other vertebrate sequence entries, part 132.
2417. gbvrt133.seq - Other vertebrate sequence entries, part 133.
2418. gbvrt134.seq - Other vertebrate sequence entries, part 134.
2419. gbvrt135.seq - Other vertebrate sequence entries, part 135.
2420. gbvrt136.seq - Other vertebrate sequence entries, part 136.
2421. gbvrt137.seq - Other vertebrate sequence entries, part 137.
2422. gbvrt138.seq - Other vertebrate sequence entries, part 138.
2423. gbvrt139.seq - Other vertebrate sequence entries, part 139.
2424. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2425. gbvrt140.seq - Other vertebrate sequence entries, part 140.
2426. gbvrt141.seq - Other vertebrate sequence entries, part 141.
2427. gbvrt142.seq - Other vertebrate sequence entries, part 142.
2428. gbvrt143.seq - Other vertebrate sequence entries, part 143.
2429. gbvrt144.seq - Other vertebrate sequence entries, part 144.
2430. gbvrt145.seq - Other vertebrate sequence entries, part 145.
2431. gbvrt146.seq - Other vertebrate sequence entries, part 146.
2432. gbvrt147.seq - Other vertebrate sequence entries, part 147.
2433. gbvrt148.seq - Other vertebrate sequence entries, part 148.
2434. gbvrt149.seq - Other vertebrate sequence entries, part 149.
2435. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2436. gbvrt150.seq - Other vertebrate sequence entries, part 150.
2437. gbvrt151.seq - Other vertebrate sequence entries, part 151.
2438. gbvrt152.seq - Other vertebrate sequence entries, part 152.
2439. gbvrt153.seq - Other vertebrate sequence entries, part 153.
2440. gbvrt154.seq - Other vertebrate sequence entries, part 154.
2441. gbvrt155.seq - Other vertebrate sequence entries, part 155.
2442. gbvrt156.seq - Other vertebrate sequence entries, part 156.
2443. gbvrt157.seq - Other vertebrate sequence entries, part 157.
2444. gbvrt158.seq - Other vertebrate sequence entries, part 158.
2445. gbvrt159.seq - Other vertebrate sequence entries, part 159.
2446. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2447. gbvrt160.seq - Other vertebrate sequence entries, part 160.
2448. gbvrt161.seq - Other vertebrate sequence entries, part 161.
2449. gbvrt162.seq - Other vertebrate sequence entries, part 162.
2450. gbvrt163.seq - Other vertebrate sequence entries, part 163.
2451. gbvrt164.seq - Other vertebrate sequence entries, part 164.
2452. gbvrt165.seq - Other vertebrate sequence entries, part 165.
2453. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2454. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2455. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2456. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2457. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2458. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2459. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2460. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2461. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2462. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2463. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2464. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2465. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2466. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2467. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2468. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2469. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2470. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2471. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2472. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2473. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2474. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2475. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2476. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2477. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2478. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2479. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2480. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2481. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2482. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2483. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2484. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2485. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2486. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2487. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2488. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2489. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2490. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2491. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2492. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2493. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2494. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2495. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2496. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2497. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2498. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2499. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2500. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2501. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2502. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2503. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2504. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2505. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2506. gbvrt65.seq - Other vertebrate sequence entries, part 65.
2507. gbvrt66.seq - Other vertebrate sequence entries, part 66.
2508. gbvrt67.seq - Other vertebrate sequence entries, part 67.
2509. gbvrt68.seq - Other vertebrate sequence entries, part 68.
2510. gbvrt69.seq - Other vertebrate sequence entries, part 69.
2511. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2512. gbvrt70.seq - Other vertebrate sequence entries, part 70.
2513. gbvrt71.seq - Other vertebrate sequence entries, part 71.
2514. gbvrt72.seq - Other vertebrate sequence entries, part 72.
2515. gbvrt73.seq - Other vertebrate sequence entries, part 73.
2516. gbvrt74.seq - Other vertebrate sequence entries, part 74.
2517. gbvrt75.seq - Other vertebrate sequence entries, part 75.
2518. gbvrt76.seq - Other vertebrate sequence entries, part 76.
2519. gbvrt77.seq - Other vertebrate sequence entries, part 77.
2520. gbvrt78.seq - Other vertebrate sequence entries, part 78.
2521. gbvrt79.seq - Other vertebrate sequence entries, part 79.
2522. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2523. gbvrt80.seq - Other vertebrate sequence entries, part 80.
2524. gbvrt81.seq - Other vertebrate sequence entries, part 81.
2525. gbvrt82.seq - Other vertebrate sequence entries, part 82.
2526. gbvrt83.seq - Other vertebrate sequence entries, part 83.
2527. gbvrt84.seq - Other vertebrate sequence entries, part 84.
2528. gbvrt85.seq - Other vertebrate sequence entries, part 85.
2529. gbvrt86.seq - Other vertebrate sequence entries, part 86.
2530. gbvrt87.seq - Other vertebrate sequence entries, part 87.
2531. gbvrt88.seq - Other vertebrate sequence entries, part 88.
2532. gbvrt89.seq - Other vertebrate sequence entries, part 89.
2533. gbvrt9.seq - Other vertebrate sequence entries, part 9.
2534. gbvrt90.seq - Other vertebrate sequence entries, part 90.
2535. gbvrt91.seq - Other vertebrate sequence entries, part 91.
2536. gbvrt92.seq - Other vertebrate sequence entries, part 92.
2537. gbvrt93.seq - Other vertebrate sequence entries, part 93.
2538. gbvrt94.seq - Other vertebrate sequence entries, part 94.
2539. gbvrt95.seq - Other vertebrate sequence entries, part 95.
2540. gbvrt96.seq - Other vertebrate sequence entries, part 96.
2541. gbvrt97.seq - Other vertebrate sequence entries, part 97.
2542. gbvrt98.seq - Other vertebrate sequence entries, part 98.
2543. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 234.0 flatfiles require roughly 1091 GB, including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 494884531     gbbct1.seq
 497246199     gbbct10.seq
 499009889     gbbct100.seq
 494100520     gbbct101.seq
 493993541     gbbct102.seq
 331304342     gbbct103.seq
 499974183     gbbct104.seq
 493011248     gbbct105.seq
 496288503     gbbct106.seq
 426967808     gbbct107.seq
 499127107     gbbct108.seq
 496815434     gbbct109.seq
 499940491     gbbct11.seq
 491164613     gbbct110.seq
 499966172     gbbct111.seq
 494096761     gbbct112.seq
 498973073     gbbct113.seq
 331743952     gbbct114.seq
 498286783     gbbct115.seq
 489447997     gbbct116.seq
 499733693     gbbct117.seq
 461296924     gbbct118.seq
 497409372     gbbct119.seq
 450901509     gbbct12.seq
 494975420     gbbct120.seq
 491934302     gbbct121.seq
 495712125     gbbct122.seq
 491609013     gbbct123.seq
 147978507     gbbct124.seq
 496895058     gbbct125.seq
 497682819     gbbct126.seq
 499141254     gbbct127.seq
 497970643     gbbct128.seq
 352907891     gbbct129.seq
 499885124     gbbct13.seq
 496522747     gbbct130.seq
 491127913     gbbct131.seq
 499825975     gbbct132.seq
 487897028     gbbct133.seq
 488248482     gbbct134.seq
 319202889     gbbct135.seq
 497654461     gbbct136.seq
 497791998     gbbct137.seq
 497161593     gbbct138.seq
 492499592     gbbct139.seq
 498316703     gbbct14.seq
 492716760     gbbct140.seq
 497400919     gbbct141.seq
  93783239     gbbct142.seq
 494733009     gbbct143.seq
 491541859     gbbct144.seq
 495158797     gbbct145.seq
 463875812     gbbct146.seq
 489897341     gbbct147.seq
 494844511     gbbct148.seq
 493365717     gbbct149.seq
 497601359     gbbct15.seq
 469340652     gbbct150.seq
 499060181     gbbct151.seq
 497731165     gbbct152.seq
 496030071     gbbct153.seq
 498951663     gbbct154.seq
 129997687     gbbct155.seq
 498936085     gbbct156.seq
 486564218     gbbct157.seq
 499922555     gbbct158.seq
 246295400     gbbct159.seq
 493834117     gbbct16.seq
 495003041     gbbct160.seq
 495929499     gbbct161.seq
 489686065     gbbct162.seq
 303707273     gbbct163.seq
 499222797     gbbct164.seq
 493097277     gbbct165.seq
 496776935     gbbct166.seq
 351584048     gbbct167.seq
 497955952     gbbct168.seq
 499983143     gbbct169.seq
 459752470     gbbct17.seq
 497548321     gbbct170.seq
 492583384     gbbct171.seq
 490886926     gbbct172.seq
 162849952     gbbct173.seq
 497819871     gbbct174.seq
 496358144     gbbct175.seq
 494747059     gbbct176.seq
 499578212     gbbct177.seq
 265632399     gbbct178.seq
 499904726     gbbct179.seq
  21361786     gbbct18.seq
 492389871     gbbct180.seq
 494864434     gbbct181.seq
 496253266     gbbct182.seq
 176738519     gbbct183.seq
 489278867     gbbct184.seq
 496471374     gbbct185.seq
 493691173     gbbct186.seq
 495236441     gbbct187.seq
 342127677     gbbct188.seq
 499899190     gbbct189.seq
  38594271     gbbct19.seq
 496011254     gbbct190.seq
 492244886     gbbct191.seq
 494444373     gbbct192.seq
 495368970     gbbct193.seq
 490041655     gbbct194.seq
 253204654     gbbct195.seq
 496985040     gbbct196.seq
 499768855     gbbct197.seq
 496637812     gbbct198.seq
 328907672     gbbct199.seq
 497838822     gbbct2.seq
 499782261     gbbct20.seq
 484832343     gbbct200.seq
 495623903     gbbct201.seq
 497156832     gbbct202.seq
 496465044     gbbct203.seq
 215747529     gbbct204.seq
 493985875     gbbct205.seq
 494486148     gbbct206.seq
 493780768     gbbct207.seq
  49322911     gbbct208.seq
 493892072     gbbct209.seq
 497820783     gbbct21.seq
 486810518     gbbct210.seq
 499228544     gbbct211.seq
 495507282     gbbct212.seq
  22861062     gbbct213.seq
 494063240     gbbct214.seq
 488280399     gbbct215.seq
 499475914     gbbct216.seq
 495038861     gbbct217.seq
  86124000     gbbct218.seq
 483974565     gbbct219.seq
 493044168     gbbct22.seq
 499891385     gbbct220.seq
 497643808     gbbct221.seq
 313392976     gbbct222.seq
 492192424     gbbct223.seq
 497786814     gbbct224.seq
 493237963     gbbct225.seq
 389609419     gbbct226.seq
 499542980     gbbct227.seq
 493898554     gbbct228.seq
 491091334     gbbct229.seq
 498801702     gbbct23.seq
 499202199     gbbct230.seq
 448571180     gbbct231.seq
 491965464     gbbct232.seq
 486610724     gbbct233.seq
 485342485     gbbct234.seq
 489199125     gbbct235.seq
 492787717     gbbct236.seq
 496427731     gbbct237.seq
 494287759     gbbct238.seq
  16474699     gbbct239.seq
 140147824     gbbct24.seq
 495808517     gbbct240.seq
 498958263     gbbct241.seq
 496568693     gbbct242.seq
 487409695     gbbct243.seq
 487383180     gbbct244.seq
 420249344     gbbct245.seq
 493491312     gbbct246.seq
 498913200     gbbct247.seq
 498689934     gbbct248.seq
 496527497     gbbct249.seq
 495704597     gbbct25.seq
 499520596     gbbct250.seq
 494839846     gbbct251.seq
 377258828     gbbct252.seq
 499374029     gbbct253.seq
 499523335     gbbct254.seq
 493857634     gbbct255.seq
 498209957     gbbct256.seq
 498898973     gbbct257.seq
 497088030     gbbct258.seq
 493507023     gbbct259.seq
 495623343     gbbct26.seq
  22418615     gbbct260.seq
 498795127     gbbct261.seq
 490160511     gbbct262.seq
 499892384     gbbct263.seq
 497076151     gbbct264.seq
 496439374     gbbct265.seq
 388139678     gbbct266.seq
 494282260     gbbct267.seq
 497468490     gbbct268.seq
 497945988     gbbct269.seq
 493141115     gbbct27.seq
 497148779     gbbct270.seq
 177619326     gbbct271.seq
 498731748     gbbct272.seq
 499483270     gbbct273.seq
 490839762     gbbct274.seq
 495757047     gbbct275.seq
  71904828     gbbct276.seq
 498365367     gbbct277.seq
 499869903     gbbct278.seq
 496996336     gbbct279.seq
 488227208     gbbct28.seq
 498464821     gbbct280.seq
 172026703     gbbct281.seq
 497465509     gbbct282.seq
 492270510     gbbct283.seq
 497313814     gbbct284.seq
 492520065     gbbct285.seq
  11140765     gbbct286.seq
 493506066     gbbct287.seq
 498421536     gbbct288.seq
 491626273     gbbct289.seq
 498587932     gbbct29.seq
 495889705     gbbct290.seq
 228055476     gbbct291.seq
 495542033     gbbct292.seq
 488568506     gbbct293.seq
 496407785     gbbct294.seq
 498074398     gbbct295.seq
 490661576     gbbct296.seq
 496161465     gbbct297.seq
 109978971     gbbct298.seq
 497606966     gbbct299.seq
 290282395     gbbct3.seq
 498264756     gbbct30.seq
 494367327     gbbct300.seq
 496564649     gbbct301.seq
 495152670     gbbct302.seq
 143908946     gbbct303.seq
 494793833     gbbct304.seq
 495267319     gbbct305.seq
 496274945     gbbct306.seq
 426851149     gbbct307.seq
 494939694     gbbct308.seq
 496097767     gbbct309.seq
 102624786     gbbct31.seq
 498388138     gbbct310.seq
 461374608     gbbct311.seq
 493599801     gbbct312.seq
 483664293     gbbct313.seq
 499989382     gbbct314.seq
 498215268     gbbct315.seq
  41884466     gbbct316.seq
 494190149     gbbct317.seq
 496025997     gbbct318.seq
 494970524     gbbct319.seq
 498940633     gbbct32.seq
 496061720     gbbct320.seq
 265563498     gbbct321.seq
 496098057     gbbct322.seq
 497722248     gbbct323.seq
 496151447     gbbct324.seq
 497004277     gbbct325.seq
 498618178     gbbct326.seq
 313462436     gbbct327.seq
 305664179     gbbct328.seq
   6831604     gbbct329.seq
 483796031     gbbct33.seq
  14104963     gbbct330.seq
  22752436     gbbct331.seq
  44383302     gbbct332.seq
  86378615     gbbct333.seq
 168082559     gbbct334.seq
 499998266     gbbct335.seq
 491936740     gbbct336.seq
 499443147     gbbct337.seq
 499998260     gbbct338.seq
 498560393     gbbct339.seq
 490802049     gbbct34.seq
 499951601     gbbct340.seq
 492279124     gbbct341.seq
 499998330     gbbct342.seq
 474976961     gbbct343.seq
 499998969     gbbct344.seq
 288979979     gbbct345.seq
 499999956     gbbct346.seq
  83694619     gbbct347.seq
 499997158     gbbct348.seq
 121195706     gbbct349.seq
 498363343     gbbct35.seq
 499947621     gbbct350.seq
  41092154     gbbct351.seq
 140958782     gbbct352.seq
 498881114     gbbct353.seq
 393811664     gbbct354.seq
 476912869     gbbct355.seq
 499667266     gbbct356.seq
 499720017     gbbct357.seq
 493228141     gbbct358.seq
 494053180     gbbct359.seq
 495406703     gbbct36.seq
 487506338     gbbct360.seq
 264968386     gbbct361.seq
 494891493     gbbct362.seq
 496974006     gbbct363.seq
 498445347     gbbct364.seq
 206715348     gbbct365.seq
 495956689     gbbct366.seq
 498524774     gbbct367.seq
 497297673     gbbct368.seq
 218706156     gbbct369.seq
 487194660     gbbct37.seq
 499861010     gbbct370.seq
 496187625     gbbct371.seq
 498687169     gbbct372.seq
 227077069     gbbct373.seq
 488354384     gbbct374.seq
 496188422     gbbct375.seq
 497989517     gbbct376.seq
 497812549     gbbct377.seq
 104524609     gbbct378.seq
 494999670     gbbct379.seq
 497645853     gbbct38.seq
 489818247     gbbct380.seq
 497739693     gbbct381.seq
 449114293     gbbct382.seq
  51093689     gbbct383.seq
 106488703     gbbct384.seq
 499997082     gbbct385.seq
 499996718     gbbct386.seq
 119077853     gbbct387.seq
 497403227     gbbct39.seq
 394112477     gbbct4.seq
 493178589     gbbct40.seq
 497802496     gbbct41.seq
 494726321     gbbct42.seq
 495423303     gbbct43.seq
 232010387     gbbct44.seq
 498094837     gbbct45.seq
 499068181     gbbct46.seq
 495851264     gbbct47.seq
 494720538     gbbct48.seq
 499751020     gbbct49.seq
 459252356     gbbct5.seq
 490381157     gbbct50.seq
 257412073     gbbct51.seq
 499968439     gbbct52.seq
 495916767     gbbct53.seq
 486278090     gbbct54.seq
 492100725     gbbct55.seq
 475091483     gbbct56.seq
 490136086     gbbct57.seq
 485836744     gbbct58.seq
 498334127     gbbct59.seq
 102203502     gbbct6.seq
 496791224     gbbct60.seq
 285019305     gbbct61.seq
 491473852     gbbct62.seq
 494313903     gbbct63.seq
 495819854     gbbct64.seq
 498720135     gbbct65.seq
 499102868     gbbct66.seq
 261686574     gbbct67.seq
 498065677     gbbct68.seq
 499516516     gbbct69.seq
 282425543     gbbct7.seq
 498961750     gbbct70.seq
 488107314     gbbct71.seq
 397949660     gbbct72.seq
 494947599     gbbct73.seq
 498005119     gbbct74.seq
 496846743     gbbct75.seq
 279764182     gbbct76.seq
 499905223     gbbct77.seq
 495463394     gbbct78.seq
 496855058     gbbct79.seq
 499564995     gbbct8.seq
  74829632     gbbct80.seq
 489627632     gbbct81.seq
 498990976     gbbct82.seq
 499930780     gbbct83.seq
 389027549     gbbct84.seq
 499874268     gbbct85.seq
 498123825     gbbct86.seq
 499291277     gbbct87.seq
 491407518     gbbct88.seq
  13752575     gbbct89.seq
 496086953     gbbct9.seq
 493145411     gbbct90.seq
 494744932     gbbct91.seq
 495413497     gbbct92.seq
 491066610     gbbct93.seq
 195549943     gbbct94.seq
 494136895     gbbct95.seq
 492528454     gbbct96.seq
 493219111     gbbct97.seq
 496767332     gbbct98.seq
  99479754     gbbct99.seq
   1047926     gbchg.txt
 499956157     gbcon1.seq
 498253734     gbcon10.seq
 499995135     gbcon100.seq
 499656891     gbcon101.seq
 499968206     gbcon102.seq
 499997886     gbcon103.seq
 262179760     gbcon104.seq
 499986454     gbcon105.seq
 499998375     gbcon106.seq
 450899183     gbcon107.seq
 500000206     gbcon108.seq
 499999439     gbcon109.seq
 496565330     gbcon11.seq
 165524598     gbcon110.seq
 499825240     gbcon111.seq
 499997173     gbcon112.seq
 499973052     gbcon113.seq
 293094914     gbcon114.seq
 499999876     gbcon115.seq
 499999395     gbcon116.seq
 222253215     gbcon117.seq
  45836617     gbcon118.seq
 499998034     gbcon119.seq
 495568134     gbcon12.seq
 499996816     gbcon120.seq
 447162778     gbcon121.seq
 499998952     gbcon122.seq
 499998431     gbcon123.seq
 499997716     gbcon124.seq
 196752475     gbcon125.seq
 499998272     gbcon126.seq
 500000035     gbcon127.seq
 238709560     gbcon128.seq
 499999959     gbcon129.seq
 495723585     gbcon13.seq
 466619449     gbcon130.seq
 499999384     gbcon131.seq
 499998553     gbcon132.seq
 267064848     gbcon133.seq
 499998906     gbcon134.seq
 499971162     gbcon135.seq
 500000004     gbcon136.seq
  16899846     gbcon137.seq
 499999192     gbcon138.seq
 499999540     gbcon139.seq
 499977541     gbcon14.seq
 179134232     gbcon140.seq
 499998502     gbcon141.seq
 499998651     gbcon142.seq
  22645865     gbcon143.seq
 499889958     gbcon144.seq
 499998366     gbcon145.seq
 440248761     gbcon146.seq
 499938098     gbcon147.seq
 499972914     gbcon148.seq
 376207853     gbcon149.seq
 494321194     gbcon15.seq
 499993470     gbcon150.seq
 499939497     gbcon151.seq
 367314092     gbcon152.seq
 499995421     gbcon153.seq
 499998207     gbcon154.seq
 200066658     gbcon155.seq
 499999960     gbcon156.seq
 499948878     gbcon157.seq
 499999989     gbcon158.seq
 144765078     gbcon159.seq
 194513614     gbcon16.seq
 499830763     gbcon160.seq
 499984873     gbcon161.seq
 499965360     gbcon162.seq
 336207719     gbcon163.seq
 499997860     gbcon164.seq
 499994785     gbcon165.seq
 407938173     gbcon166.seq
 499999531     gbcon167.seq
 499999045     gbcon168.seq
 499998544     gbcon169.seq
 499995767     gbcon17.seq
 271279165     gbcon170.seq
 499999711     gbcon171.seq
 499999762     gbcon172.seq
 499498334     gbcon173.seq
 499997507     gbcon174.seq
 195634880     gbcon175.seq
 499998061     gbcon176.seq
 499998245     gbcon177.seq
 130145369     gbcon178.seq
 499996337     gbcon179.seq
 499998618     gbcon18.seq
 499999522     gbcon180.seq
 500000037     gbcon181.seq
 285693216     gbcon182.seq
 499949463     gbcon183.seq
 499997562     gbcon184.seq
 454485807     gbcon185.seq
 499995700     gbcon186.seq
 499996978     gbcon187.seq
 397488570     gbcon188.seq
 499944672     gbcon189.seq
 499999439     gbcon19.seq
 499995618     gbcon190.seq
 499995939     gbcon191.seq
 167851200     gbcon192.seq
 499998392     gbcon193.seq
 499998932     gbcon194.seq
  37638463     gbcon195.seq
 499997011     gbcon196.seq
 499998344     gbcon197.seq
 499995927     gbcon198.seq
 500000066     gbcon199.seq
 499997845     gbcon2.seq
  81389816     gbcon20.seq
 500000216     gbcon200.seq
  35784957     gbcon201.seq
 499999559     gbcon202.seq
 459368183     gbcon203.seq
 499953219     gbcon204.seq
 500000079     gbcon205.seq
 499999615     gbcon206.seq
   4728639     gbcon207.seq
 499999130     gbcon208.seq
 500000190     gbcon209.seq
 499998430     gbcon21.seq
 499998668     gbcon210.seq
 308438774     gbcon211.seq
 499998856     gbcon22.seq
 499939241     gbcon23.seq
 284980577     gbcon24.seq
 499480316     gbcon25.seq
 125744383     gbcon26.seq
 126402339     gbcon27.seq
 499989972     gbcon28.seq
 499997151     gbcon29.seq
 499997799     gbcon3.seq
  26019784     gbcon30.seq
 499999414     gbcon31.seq
 499998297     gbcon32.seq
 448007352     gbcon33.seq
 499999057     gbcon34.seq
 499998568     gbcon35.seq
 499999100     gbcon36.seq
  41918782     gbcon37.seq
 500000081     gbcon38.seq
 499998540     gbcon39.seq
 106483843     gbcon4.seq
 277009775     gbcon40.seq
 499996336     gbcon41.seq
 499998469     gbcon42.seq
 270612827     gbcon43.seq
 499996532     gbcon44.seq
 499996905     gbcon45.seq
 385374935     gbcon46.seq
 499997390     gbcon47.seq
 499999185     gbcon48.seq
 176580283     gbcon49.seq
 499901495     gbcon5.seq
 499999848     gbcon50.seq
 499997718     gbcon51.seq
 238773972     gbcon52.seq
 499997628     gbcon53.seq
 499995125     gbcon54.seq
 335698760     gbcon55.seq
 499996299     gbcon56.seq
 499999132     gbcon57.seq
 298461041     gbcon58.seq
 499995314     gbcon59.seq
 494542451     gbcon6.seq
 499999014     gbcon60.seq
 259899669     gbcon61.seq
 499996880     gbcon62.seq
 499997062     gbcon63.seq
 187377116     gbcon64.seq
 499996720     gbcon65.seq
 499999826     gbcon66.seq
 364586197     gbcon67.seq
 499993696     gbcon68.seq
 499999904     gbcon69.seq
 494412992     gbcon7.seq
 386119955     gbcon70.seq
 499993762     gbcon71.seq
 472787618     gbcon72.seq
 173591654     gbcon73.seq
 499999661     gbcon74.seq
  44478791     gbcon75.seq
 499982868     gbcon76.seq
 203591372     gbcon77.seq
 199554915     gbcon78.seq
 499811929     gbcon79.seq
 499919991     gbcon8.seq
 499996413     gbcon80.seq
 386508640     gbcon81.seq
 499527910     gbcon82.seq
 495870137     gbcon83.seq
 499840683     gbcon84.seq
 338010125     gbcon85.seq
 499945226     gbcon86.seq
 499998893     gbcon87.seq
 499999847     gbcon88.seq
 230869232     gbcon89.seq
  69827160     gbcon9.seq
 499999858     gbcon90.seq
 499999247     gbcon91.seq
 131455580     gbcon92.seq
 499998653     gbcon93.seq
 499998569     gbcon94.seq
 500000025     gbcon95.seq
 264905698     gbcon96.seq
 499997490     gbcon97.seq
 500000042     gbcon98.seq
 181295372     gbcon99.seq
    378916     gbdel.txt
 499999851     gbenv1.seq
 499998012     gbenv10.seq
 499999365     gbenv11.seq
 495379002     gbenv12.seq
 499999580     gbenv13.seq
 500000132     gbenv14.seq
 173601577     gbenv15.seq
 499922392     gbenv16.seq
 499999075     gbenv17.seq
 499998446     gbenv18.seq
  70753136     gbenv19.seq
 499998249     gbenv2.seq
 499999305     gbenv20.seq
 499997114     gbenv21.seq
 177738183     gbenv22.seq
 499998380     gbenv23.seq
 499999220     gbenv24.seq
 499999363     gbenv25.seq
  46095495     gbenv26.seq
 499999775     gbenv27.seq
 499999916     gbenv28.seq
 192041412     gbenv29.seq
 499999389     gbenv3.seq
 499999403     gbenv30.seq
 499999470     gbenv31.seq
 333459029     gbenv32.seq
 499998106     gbenv33.seq
 499998874     gbenv34.seq
 463367938     gbenv35.seq
 499999084     gbenv36.seq
 499998036     gbenv37.seq
 334687852     gbenv38.seq
 500000146     gbenv39.seq
 499999939     gbenv4.seq
 499999501     gbenv40.seq
 393690756     gbenv41.seq
 499998926     gbenv42.seq
 499998521     gbenv43.seq
 340300409     gbenv44.seq
 499999738     gbenv45.seq
 499999191     gbenv46.seq
 237898360     gbenv47.seq
 499999515     gbenv48.seq
 500000070     gbenv49.seq
  66539559     gbenv5.seq
 380642633     gbenv50.seq
 499998913     gbenv51.seq
 499998961     gbenv52.seq
 485378672     gbenv53.seq
 499999718     gbenv54.seq
 499998714     gbenv55.seq
 500000249     gbenv56.seq
 499985395     gbenv57.seq
 193098041     gbenv58.seq
 499998029     gbenv6.seq
 499998961     gbenv7.seq
  53680986     gbenv8.seq
 499999203     gbenv9.seq
 499997544     gbest1.seq
 499997880     gbest10.seq
 499999304     gbest100.seq
 499999070     gbest101.seq
 499997497     gbest102.seq
 499998786     gbest103.seq
  24991691     gbest104.seq
 499997691     gbest105.seq
 499999900     gbest106.seq
 499997850     gbest107.seq
 499999519     gbest108.seq
   9359782     gbest109.seq
 499998301     gbest11.seq
 499997562     gbest110.seq
 499998906     gbest111.seq
 499999167     gbest112.seq
 499998397     gbest113.seq
  23934825     gbest114.seq
 499998597     gbest115.seq
 499998248     gbest116.seq
 499998513     gbest117.seq
  11662882     gbest118.seq
 499997809     gbest119.seq
 474178816     gbest12.seq
 499997466     gbest120.seq
 499997861     gbest121.seq
  68177058     gbest122.seq
 499994263     gbest123.seq
 499997786     gbest124.seq
 223701769     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499998143     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 499998259     gbest135.seq
 499997142     gbest136.seq
 499998046     gbest137.seq
  98110136     gbest138.seq
 499998442     gbest139.seq
 249652109     gbest14.seq
 499998861     gbest140.seq
 499998444     gbest141.seq
 499998331     gbest142.seq
  24910309     gbest143.seq
 499997669     gbest144.seq
 499999437     gbest145.seq
 499998859     gbest146.seq
 499998474     gbest147.seq
  30215981     gbest148.seq
 499999670     gbest149.seq
 499998856     gbest15.seq
 499999456     gbest150.seq
 499998412     gbest151.seq
 322521043     gbest152.seq
 499997320     gbest153.seq
 499999385     gbest154.seq
 500000038     gbest155.seq
 499998234     gbest156.seq
  21491766     gbest157.seq
 499999702     gbest158.seq
 499999521     gbest159.seq
 499999798     gbest16.seq
 499996841     gbest160.seq
 499998882     gbest161.seq
   9723108     gbest162.seq
 499999412     gbest163.seq
 500000006     gbest164.seq
 499997360     gbest165.seq
 499996336     gbest166.seq
  81988721     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 420834751     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499999958     gbest174.seq
 499997684     gbest175.seq
 499999843     gbest176.seq
  66106728     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499998530     gbest18.seq
 500000063     gbest180.seq
 499999576     gbest181.seq
 499996415     gbest182.seq
 499999507     gbest183.seq
  42372888     gbest184.seq
 499997635     gbest185.seq
 499998365     gbest186.seq
 499996954     gbest187.seq
 500000013     gbest188.seq
  41783167     gbest189.seq
 499997415     gbest19.seq
 499998666     gbest190.seq
 499999459     gbest191.seq
 499998504     gbest192.seq
 500000025     gbest193.seq
  12148970     gbest194.seq
 499999587     gbest195.seq
 500000013     gbest196.seq
 499998985     gbest197.seq
 499996194     gbest198.seq
  25113925     gbest199.seq
 499998652     gbest2.seq
 260119709     gbest20.seq
 499998542     gbest200.seq
 499996677     gbest201.seq
 500000042     gbest202.seq
 499997977     gbest203.seq
  30654152     gbest204.seq
  13610371     gbest205.seq
 499999221     gbest206.seq
 499998120     gbest207.seq
 328280744     gbest208.seq
 499997323     gbest209.seq
 499999606     gbest21.seq
 499995929     gbest210.seq
 316764106     gbest211.seq
 499998724     gbest212.seq
 499999424     gbest213.seq
 265393648     gbest214.seq
 499999161     gbest215.seq
 499998973     gbest216.seq
 268025739     gbest217.seq
 499996246     gbest218.seq
 499999806     gbest219.seq
 499997789     gbest22.seq
 499997963     gbest220.seq
 500000123     gbest221.seq
  48985942     gbest222.seq
 499999312     gbest223.seq
 499999407     gbest224.seq
 499999479     gbest225.seq
 499995116     gbest226.seq
  46446852     gbest227.seq
 499999053     gbest228.seq
 499996806     gbest229.seq
 242264308     gbest23.seq
 174825403     gbest230.seq
 499997907     gbest231.seq
 499999624     gbest232.seq
 499999509     gbest233.seq
 478341574     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499998838     gbest24.seq
 499999466     gbest240.seq
 499997560     gbest241.seq
 495413728     gbest242.seq
 499998531     gbest243.seq
 499998185     gbest244.seq
 499999561     gbest245.seq
 499998790     gbest246.seq
  24180385     gbest247.seq
 499998259     gbest248.seq
 500000161     gbest249.seq
 499997816     gbest25.seq
 492328492     gbest250.seq
 499995571     gbest251.seq
 499998200     gbest252.seq
 499999520     gbest253.seq
 499997474     gbest254.seq
  15354105     gbest255.seq
 499995865     gbest256.seq
 499996776     gbest257.seq
 499999180     gbest258.seq
 499999310     gbest259.seq
 499999429     gbest26.seq
  72936737     gbest260.seq
 499997472     gbest261.seq
 499997390     gbest262.seq
 499996504     gbest263.seq
 500000069     gbest264.seq
  10773741     gbest265.seq
 499997806     gbest266.seq
 499999532     gbest267.seq
 499999492     gbest268.seq
 499999837     gbest269.seq
 499998571     gbest27.seq
  50717151     gbest270.seq
 499999016     gbest271.seq
 499998969     gbest272.seq
 499998846     gbest273.seq
 119014210     gbest274.seq
 499997034     gbest275.seq
 499998984     gbest276.seq
 499999114     gbest277.seq
 499997896     gbest278.seq
  50688776     gbest279.seq
  48265826     gbest28.seq
 499999317     gbest280.seq
 499997412     gbest281.seq
 499998676     gbest282.seq
 499999719     gbest283.seq
  55628580     gbest284.seq
 499997730     gbest285.seq
 499999980     gbest286.seq
 499997280     gbest287.seq
 499999744     gbest288.seq
  11297119     gbest289.seq
 499999995     gbest29.seq
 499997952     gbest290.seq
 499999795     gbest291.seq
 499999462     gbest292.seq
 499999004     gbest293.seq
  25192615     gbest294.seq
 499998596     gbest295.seq
 499999758     gbest296.seq
 485611090     gbest297.seq
 499997447     gbest298.seq
 499998368     gbest299.seq
 500000081     gbest3.seq
 499998086     gbest30.seq
 499999080     gbest300.seq
 499998825     gbest301.seq
   5318213     gbest302.seq
 499999538     gbest303.seq
 499999813     gbest304.seq
 499998715     gbest305.seq
 499997626     gbest306.seq
   7751764     gbest307.seq
 499998952     gbest308.seq
 499998801     gbest309.seq
 499999100     gbest31.seq
 499997247     gbest310.seq
 421290158     gbest311.seq
 499999515     gbest312.seq
 499997321     gbest313.seq
 499999961     gbest314.seq
 495947129     gbest315.seq
 499998773     gbest316.seq
 499997415     gbest317.seq
 467912070     gbest318.seq
 499999035     gbest319.seq
 486435073     gbest32.seq
 499999258     gbest320.seq
 499999978     gbest321.seq
 499999435     gbest322.seq
  39514259     gbest323.seq
 500000256     gbest324.seq
 500000005     gbest325.seq
 499999466     gbest326.seq
 492917192     gbest327.seq
 499998749     gbest328.seq
 499997759     gbest329.seq
 499998458     gbest33.seq
 499999540     gbest330.seq
 499997875     gbest331.seq
  54900833     gbest332.seq
 499999943     gbest333.seq
 499999960     gbest334.seq
 499998379     gbest335.seq
 469183035     gbest336.seq
 499998299     gbest337.seq
 500000013     gbest338.seq
 499999184     gbest339.seq
 499996133     gbest34.seq
 499996505     gbest340.seq
  18186152     gbest341.seq
 499999196     gbest342.seq
 491105999     gbest343.seq
 499998133     gbest344.seq
 499999973     gbest345.seq
 499997585     gbest346.seq
 499998101     gbest347.seq
   5414791     gbest348.seq
 499999544     gbest349.seq
 499999137     gbest35.seq
 500000150     gbest350.seq
 499999880     gbest351.seq
 445215906     gbest352.seq
 499998629     gbest353.seq
 500000207     gbest354.seq
 499999612     gbest355.seq
 387619783     gbest356.seq
 499998924     gbest357.seq
 499998310     gbest358.seq
 499997427     gbest359.seq
 464707046     gbest36.seq
 499998071     gbest360.seq
  20572711     gbest361.seq
 499998188     gbest362.seq
 500000152     gbest363.seq
 499997517     gbest364.seq
 499999296     gbest365.seq
  55347028     gbest366.seq
 166258344     gbest367.seq
 499998124     gbest368.seq
 499999211     gbest369.seq
 499998459     gbest37.seq
 499998612     gbest370.seq
 499999327     gbest371.seq
  86045134     gbest372.seq
 499997252     gbest373.seq
 499999842     gbest374.seq
 499997446     gbest375.seq
 499996815     gbest376.seq
 164840295     gbest377.seq
 499999594     gbest378.seq
 499999390     gbest379.seq
 499998008     gbest38.seq
 499998915     gbest380.seq
 499997796     gbest381.seq
 152097432     gbest382.seq
 499997221     gbest383.seq
 499999329     gbest384.seq
 499997189     gbest385.seq
 497166396     gbest386.seq
 499997498     gbest387.seq
 499998709     gbest388.seq
 499998596     gbest389.seq
 499997178     gbest39.seq
  64052070     gbest390.seq
 499998385     gbest391.seq
 499998728     gbest392.seq
 499996496     gbest393.seq
 499997691     gbest394.seq
  83414510     gbest395.seq
 499996944     gbest396.seq
 499996739     gbest397.seq
 499998928     gbest398.seq
 499998615     gbest399.seq
 434603060     gbest4.seq
 499997938     gbest40.seq
  85748854     gbest400.seq
 499997855     gbest401.seq
 499998092     gbest402.seq
 499999582     gbest403.seq
 499998843     gbest404.seq
  50565406     gbest405.seq
 499998820     gbest406.seq
 499997816     gbest407.seq
 499999702     gbest408.seq
 499997206     gbest409.seq
 191357351     gbest41.seq
  90214994     gbest410.seq
 499998673     gbest411.seq
 499998288     gbest412.seq
 499996967     gbest413.seq
 499996677     gbest414.seq
 124589880     gbest415.seq
 499998079     gbest416.seq
 328943837     gbest417.seq
 500000254     gbest418.seq
 499998835     gbest419.seq
 499997364     gbest42.seq
 499999607     gbest420.seq
 500000112     gbest421.seq
  54509541     gbest422.seq
 499999330     gbest423.seq
 499999774     gbest424.seq
 499996219     gbest425.seq
 409977293     gbest426.seq
 499997260     gbest427.seq
 499999283     gbest428.seq
 335979604     gbest429.seq
 499997237     gbest43.seq
 499999949     gbest430.seq
 500000227     gbest431.seq
 261230544     gbest432.seq
 499999296     gbest433.seq
 499998341     gbest434.seq
 458264768     gbest435.seq
 499998830     gbest436.seq
 500000090     gbest437.seq
 307334807     gbest438.seq
 499997288     gbest439.seq
 499997245     gbest44.seq
 499999169     gbest440.seq
 329772669     gbest441.seq
 499997075     gbest442.seq
 499998558     gbest443.seq
 187654716     gbest444.seq
 499999916     gbest445.seq
 499997943     gbest446.seq
 118594788     gbest447.seq
 499998627     gbest448.seq
 500000126     gbest449.seq
 499996431     gbest45.seq
 140963965     gbest450.seq
 500000200     gbest451.seq
 499999541     gbest452.seq
 146594251     gbest453.seq
 499998942     gbest454.seq
 500000199     gbest455.seq
 499997329     gbest456.seq
 487788892     gbest457.seq
 499999035     gbest458.seq
 499997432     gbest459.seq
 189558363     gbest46.seq
 499999676     gbest460.seq
 499999224     gbest461.seq
  19780988     gbest462.seq
 170019681     gbest463.seq
 499998234     gbest464.seq
 499997948     gbest465.seq
 499996964     gbest466.seq
 499998273     gbest467.seq
  23774165     gbest468.seq
 499999458     gbest469.seq
 499999613     gbest47.seq
 499998882     gbest470.seq
 499999419     gbest471.seq
 500000249     gbest472.seq
  60660807     gbest473.seq
 499996946     gbest474.seq
 499996532     gbest475.seq
 499997210     gbest476.seq
 499999838     gbest477.seq
  57553133     gbest478.seq
 499999428     gbest479.seq
 499997471     gbest48.seq
 499998005     gbest480.seq
 499997648     gbest481.seq
 499999115     gbest482.seq
  37372779     gbest483.seq
 499999913     gbest484.seq
 499999267     gbest485.seq
 499998565     gbest486.seq
 499997811     gbest487.seq
  64482510     gbest488.seq
 499997662     gbest489.seq
 499999473     gbest49.seq
 499999130     gbest490.seq
 499999934     gbest491.seq
 206715962     gbest492.seq
 499996334     gbest493.seq
 500000191     gbest494.seq
 499999946     gbest495.seq
 499999608     gbest496.seq
  89183879     gbest497.seq
 499998125     gbest498.seq
 499998609     gbest499.seq
 499998155     gbest5.seq
 474503948     gbest50.seq
 499998196     gbest500.seq
 499996254     gbest501.seq
  53400515     gbest502.seq
 499998717     gbest503.seq
 499997860     gbest504.seq
 499999996     gbest505.seq
 499999277     gbest506.seq
 141956910     gbest507.seq
 499999254     gbest508.seq
 499996708     gbest509.seq
 499998341     gbest51.seq
 499998452     gbest510.seq
 499998301     gbest511.seq
 139192325     gbest512.seq
 499997763     gbest513.seq
 499998155     gbest514.seq
 499999016     gbest515.seq
 500000145     gbest516.seq
  16904523     gbest517.seq
 174254470     gbest518.seq
 499998928     gbest519.seq
 355703064     gbest52.seq
 499998021     gbest520.seq
  83063372     gbest521.seq
 499997944     gbest522.seq
 499998345     gbest523.seq
  75363186     gbest524.seq
 499999291     gbest525.seq
 499999095     gbest526.seq
 499998072     gbest527.seq
 499996371     gbest528.seq
  94416764     gbest529.seq
 499997477     gbest53.seq
 499999382     gbest530.seq
 499998790     gbest531.seq
 499998249     gbest532.seq
 499997618     gbest533.seq
   9145532     gbest534.seq
 499999430     gbest535.seq
 499998660     gbest536.seq
 499998262     gbest537.seq
 477035449     gbest538.seq
 499998366     gbest539.seq
 499999368     gbest54.seq
 499998262     gbest540.seq
 499997502     gbest541.seq
 335836960     gbest542.seq
 499998900     gbest543.seq
 499999161     gbest544.seq
 499998712     gbest545.seq
 467601983     gbest546.seq
 499998997     gbest547.seq
 499998220     gbest548.seq
 499998640     gbest549.seq
 499997371     gbest55.seq
 499997208     gbest550.seq
  33772444     gbest551.seq
 499997037     gbest552.seq
 499997866     gbest553.seq
 499996671     gbest554.seq
 499999192     gbest555.seq
  44069972     gbest556.seq
 499996534     gbest557.seq
 499998978     gbest558.seq
 499999762     gbest559.seq
 483256451     gbest56.seq
 499998286     gbest560.seq
   9393571     gbest561.seq
 499998309     gbest562.seq
 499998494     gbest563.seq
 392782285     gbest564.seq
 499998337     gbest565.seq
 499998854     gbest566.seq
  93817727     gbest567.seq
 499998740     gbest568.seq
 499998391     gbest569.seq
 499998261     gbest57.seq
  50311057     gbest570.seq
 499999914     gbest571.seq
 499998798     gbest572.seq
 499999072     gbest573.seq
 254441988     gbest574.seq
 500000177     gbest58.seq
 499998973     gbest59.seq
 499998099     gbest6.seq
 463542876     gbest60.seq
 499998917     gbest61.seq
 500000255     gbest62.seq
 499997023     gbest63.seq
 499999022     gbest64.seq
   6679648     gbest65.seq
 499997671     gbest66.seq
 499999950     gbest67.seq
 499999464     gbest68.seq
 482653845     gbest69.seq
 499997442     gbest7.seq
 499999010     gbest70.seq
 499997870     gbest71.seq
 499997326     gbest72.seq
 499997397     gbest73.seq
   7339577     gbest74.seq
 123216203     gbest75.seq
 499999005     gbest76.seq
 499999378     gbest77.seq
 499999069     gbest78.seq
 499999812     gbest79.seq
 469301331     gbest8.seq
   5450770     gbest80.seq
 499998041     gbest81.seq
 499998813     gbest82.seq
 500000097     gbest83.seq
 499998347     gbest84.seq
  45764394     gbest85.seq
 499999280     gbest86.seq
 499998745     gbest87.seq
 499999478     gbest88.seq
 499999455     gbest89.seq
 499997802     gbest9.seq
  53156141     gbest90.seq
 499998745     gbest91.seq
 499999084     gbest92.seq
 499998525     gbest93.seq
 470693125     gbest94.seq
 499999715     gbest95.seq
 499996811     gbest96.seq
 499996652     gbest97.seq
 498437646     gbest98.seq
  35234983     gbest99.seq
 500000192     gbgss1.seq
  55278190     gbgss10.seq
 499999066     gbgss100.seq
 499998323     gbgss101.seq
 499999275     gbgss102.seq
 466499750     gbgss103.seq
 499997164     gbgss104.seq
 499999629     gbgss105.seq
 500000188     gbgss106.seq
 499999848     gbgss107.seq
  40292488     gbgss108.seq
 499997736     gbgss109.seq
 499998998     gbgss11.seq
 500000122     gbgss110.seq
 500000164     gbgss111.seq
 316319609     gbgss112.seq
 499998282     gbgss113.seq
 499998924     gbgss114.seq
 499998333     gbgss115.seq
 499997840     gbgss116.seq
 103720750     gbgss117.seq
 499998525     gbgss118.seq
 499998144     gbgss119.seq
 499998117     gbgss12.seq
 499998256     gbgss120.seq
 499999634     gbgss121.seq
   5770896     gbgss122.seq
 499999867     gbgss123.seq
 499999676     gbgss124.seq
 499999794     gbgss125.seq
 449066275     gbgss126.seq
 499997882     gbgss127.seq
 499997140     gbgss128.seq
 499999220     gbgss129.seq
 500000264     gbgss13.seq
 499996616     gbgss130.seq
  29590310     gbgss131.seq
 499997877     gbgss132.seq
 209679641     gbgss133.seq
 500000110     gbgss134.seq
 499999602     gbgss135.seq
 499997969     gbgss136.seq
 500000125     gbgss137.seq
  14831686     gbgss138.seq
 499996726     gbgss139.seq
 497018253     gbgss14.seq
 499997951     gbgss140.seq
 499999528     gbgss141.seq
 499997001     gbgss142.seq
  16786266     gbgss143.seq
 499997786     gbgss144.seq
 499996974     gbgss145.seq
 499999546     gbgss146.seq
 499996547     gbgss147.seq
   2045398     gbgss148.seq
 499997382     gbgss149.seq
 499998519     gbgss15.seq
 499998165     gbgss150.seq
 499998480     gbgss151.seq
 499997367     gbgss152.seq
   6835799     gbgss153.seq
 373479550     gbgss154.seq
 499999264     gbgss155.seq
 499999385     gbgss156.seq
 499997177     gbgss157.seq
 447628034     gbgss158.seq
 499998740     gbgss159.seq
 499998176     gbgss16.seq
 500000150     gbgss160.seq
 499997781     gbgss161.seq
 452001882     gbgss162.seq
 499997998     gbgss163.seq
 499999955     gbgss164.seq
 499997965     gbgss165.seq
 456856217     gbgss166.seq
 499997324     gbgss167.seq
 499998331     gbgss168.seq
 499998722     gbgss169.seq
 499998646     gbgss17.seq
 362069154     gbgss170.seq
 499999614     gbgss171.seq
 499999108     gbgss172.seq
 215505768     gbgss173.seq
 499998125     gbgss174.seq
 499998134     gbgss175.seq
  67002892     gbgss176.seq
 499999079     gbgss177.seq
 499999336     gbgss178.seq
 499998518     gbgss179.seq
 480737047     gbgss18.seq
 499999975     gbgss180.seq
  49671428     gbgss181.seq
 500000156     gbgss182.seq
 499999211     gbgss183.seq
 500000209     gbgss184.seq
 499999501     gbgss185.seq
  39656212     gbgss186.seq
 499999015     gbgss187.seq
 500000221     gbgss188.seq
  23203602     gbgss189.seq
 499998653     gbgss19.seq
 499998791     gbgss190.seq
 499996639     gbgss191.seq
 499998774     gbgss192.seq
 495024971     gbgss193.seq
 499999000     gbgss194.seq
 499999251     gbgss195.seq
 499999609     gbgss196.seq
 499999185     gbgss197.seq
   4843731     gbgss198.seq
 499998820     gbgss199.seq
 499998288     gbgss2.seq
 324867797     gbgss20.seq
 499998733     gbgss200.seq
 499997041     gbgss201.seq
 479851147     gbgss202.seq
 499997737     gbgss203.seq
 499997752     gbgss204.seq
  56421213     gbgss205.seq
 499997703     gbgss206.seq
 500000150     gbgss207.seq
 499999163     gbgss208.seq
 481473475     gbgss209.seq
 499999364     gbgss21.seq
 499999908     gbgss210.seq
 499997933     gbgss211.seq
 499998148     gbgss212.seq
 488124681     gbgss213.seq
 499999175     gbgss214.seq
 499999239     gbgss215.seq
 499999176     gbgss216.seq
 467990953     gbgss217.seq
 499999749     gbgss218.seq
 499999749     gbgss219.seq
 499997480     gbgss22.seq
 499997938     gbgss220.seq
   6989681     gbgss221.seq
 499999723     gbgss222.seq
 499999684     gbgss223.seq
 499998774     gbgss224.seq
 264582471     gbgss225.seq
 499998308     gbgss226.seq
 499997919     gbgss227.seq
 499999010     gbgss228.seq
 429127642     gbgss229.seq
 499997001     gbgss23.seq
 499998680     gbgss230.seq
 499997412     gbgss231.seq
 499999464     gbgss232.seq
 468539336     gbgss233.seq
 499999119     gbgss234.seq
 499999511     gbgss235.seq
 499996654     gbgss236.seq
 418138488     gbgss237.seq
 499999568     gbgss238.seq
 499996782     gbgss239.seq
 499998002     gbgss24.seq
 499999250     gbgss240.seq
 499998270     gbgss241.seq
  16446436     gbgss242.seq
 315572447     gbgss243.seq
 499997744     gbgss244.seq
 499998238     gbgss245.seq
 499998492     gbgss246.seq
 467298948     gbgss247.seq
 499998755     gbgss248.seq
 499999852     gbgss249.seq
  47915040     gbgss25.seq
 499999457     gbgss250.seq
 499998339     gbgss251.seq
  36094621     gbgss252.seq
 499998608     gbgss253.seq
 499997686     gbgss254.seq
 499998198     gbgss255.seq
 499999134     gbgss256.seq
  19020583     gbgss257.seq
 499999905     gbgss258.seq
 499998046     gbgss259.seq
 499998203     gbgss26.seq
 499999794     gbgss260.seq
   1598075     gbgss261.seq
 499999437     gbgss262.seq
 499999239     gbgss263.seq
 499999430     gbgss264.seq
 480892291     gbgss265.seq
 499999638     gbgss266.seq
 499998584     gbgss267.seq
 449914870     gbgss268.seq
 499997734     gbgss27.seq
 500000177     gbgss28.seq
 499999547     gbgss29.seq
 499997141     gbgss3.seq
  28355345     gbgss30.seq
 499999620     gbgss31.seq
 499999369     gbgss32.seq
 499999471     gbgss33.seq
 474344661     gbgss34.seq
 499997672     gbgss35.seq
 499999711     gbgss36.seq
 499998766     gbgss37.seq
 499999331     gbgss38.seq
  10249803     gbgss39.seq
 499999376     gbgss4.seq
 499998043     gbgss40.seq
 500000104     gbgss41.seq
 168816398     gbgss42.seq
 499998215     gbgss43.seq
 499997776     gbgss44.seq
 499997935     gbgss45.seq
 487170352     gbgss46.seq
 500000097     gbgss47.seq
 499997981     gbgss48.seq
 499999384     gbgss49.seq
  37736809     gbgss5.seq
 444017100     gbgss50.seq
 499998446     gbgss51.seq
 500000163     gbgss52.seq
 499998853     gbgss53.seq
 420972611     gbgss54.seq
 499999264     gbgss55.seq
 499999392     gbgss56.seq
 499998883     gbgss57.seq
 427742687     gbgss58.seq
  67685650     gbgss59.seq
 499999011     gbgss6.seq
 500000215     gbgss60.seq
 499997984     gbgss61.seq
 500000021     gbgss62.seq
 493791092     gbgss63.seq
 499998150     gbgss64.seq
 500000146     gbgss65.seq
 500000101     gbgss66.seq
 499534168     gbgss67.seq
 499998193     gbgss68.seq
 499999621     gbgss69.seq
 499997695     gbgss7.seq
 499997616     gbgss70.seq
 419666508     gbgss71.seq
 499999747     gbgss72.seq
 499998402     gbgss73.seq
 499998080     gbgss74.seq
  33896316     gbgss75.seq
 499997046     gbgss76.seq
 499999706     gbgss77.seq
 499999836     gbgss78.seq
 490829495     gbgss79.seq
 499997766     gbgss8.seq
 499997550     gbgss80.seq
 499999765     gbgss81.seq
 499999304     gbgss82.seq
 499999239     gbgss83.seq
   6078731     gbgss84.seq
 499997751     gbgss85.seq
 499999999     gbgss86.seq
 500000054     gbgss87.seq
 499999314     gbgss88.seq
  23821801     gbgss89.seq
 500000135     gbgss9.seq
 500000224     gbgss90.seq
 499999829     gbgss91.seq
 499999704     gbgss92.seq
 462802247     gbgss93.seq
 244248654     gbgss94.seq
 499999492     gbgss95.seq
 499998457     gbgss96.seq
 500000176     gbgss97.seq
 499997669     gbgss98.seq
  44651519     gbgss99.seq
 499991077     gbhtc1.seq
 499994049     gbhtc2.seq
 499986002     gbhtc3.seq
 330777725     gbhtc4.seq
 499999497     gbhtc5.seq
 437691770     gbhtc6.seq
 500000216     gbhtc7.seq
 183851116     gbhtc8.seq
 499943248     gbhtg1.seq
 499980491     gbhtg10.seq
 485099884     gbhtg11.seq
 499977093     gbhtg12.seq
 499847932     gbhtg13.seq
 499963690     gbhtg14.seq
 499701795     gbhtg15.seq
 474637971     gbhtg16.seq
 499709434     gbhtg17.seq
 499810579     gbhtg18.seq
 499965524     gbhtg19.seq
 499844091     gbhtg2.seq
 499990560     gbhtg20.seq
 473197912     gbhtg21.seq
 499918188     gbhtg22.seq
 499967590     gbhtg23.seq
 499097010     gbhtg24.seq
 499958810     gbhtg25.seq
 484456082     gbhtg26.seq
 499961346     gbhtg27.seq
 499870385     gbhtg28.seq
 268060905     gbhtg29.seq
 499869235     gbhtg3.seq
 499926573     gbhtg30.seq
 499802593     gbhtg31.seq
 224936253     gbhtg32.seq
 499948706     gbhtg33.seq
 499915552     gbhtg34.seq
 265459787     gbhtg35.seq
 499837354     gbhtg36.seq
 499950747     gbhtg37.seq
 223150986     gbhtg38.seq
 499802479     gbhtg39.seq
 499834959     gbhtg4.seq
 499974749     gbhtg40.seq
 234953070     gbhtg41.seq
 499825843     gbhtg42.seq
 499886984     gbhtg43.seq
 202126258     gbhtg44.seq
 499786893     gbhtg45.seq
 499928497     gbhtg46.seq
 205798564     gbhtg47.seq
 499978046     gbhtg48.seq
 499930426     gbhtg49.seq
 499930133     gbhtg5.seq
 193865093     gbhtg50.seq
 499927425     gbhtg51.seq
 499937279     gbhtg52.seq
 161358152     gbhtg53.seq
 499996941     gbhtg54.seq
 499996869     gbhtg55.seq
 252726342     gbhtg56.seq
 499940699     gbhtg57.seq
 499966944     gbhtg58.seq
 499998074     gbhtg59.seq
    507366     gbhtg6.seq
 167066155     gbhtg60.seq
 499929777     gbhtg61.seq
 499926029     gbhtg62.seq
 499877486     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499964636     gbhtg67.seq
 499900384     gbhtg68.seq
 499865174     gbhtg69.seq
 499821008     gbhtg7.seq
 397731163     gbhtg70.seq
 499999854     gbhtg71.seq
 499890741     gbhtg72.seq
 385409481     gbhtg73.seq
 499951564     gbhtg74.seq
 499970875     gbhtg75.seq
 383567862     gbhtg76.seq
 499964642     gbhtg77.seq
 499988496     gbhtg78.seq
 499994525     gbhtg79.seq
 499933798     gbhtg8.seq
 499991153     gbhtg80.seq
 499923586     gbhtg81.seq
 263656893     gbhtg82.seq
 499899409     gbhtg9.seq
 499768806     gbinv1.seq
 490451253     gbinv10.seq
 498886702     gbinv100.seq
 498671143     gbinv101.seq
 171535447     gbinv102.seq
 499999159     gbinv103.seq
 499997622     gbinv104.seq
 247477726     gbinv105.seq
 499997583     gbinv106.seq
 499999595     gbinv107.seq
 499997505     gbinv108.seq
 499998185     gbinv109.seq
 491062219     gbinv11.seq
 262370359     gbinv110.seq
 499998612     gbinv12.seq
 397426656     gbinv13.seq
 499999709     gbinv14.seq
 404239629     gbinv15.seq
 497206061     gbinv16.seq
 499999519     gbinv17.seq
 308441409     gbinv18.seq
 499998294     gbinv19.seq
 453756822     gbinv2.seq
 499997048     gbinv20.seq
 275996525     gbinv21.seq
 499999811     gbinv22.seq
 499997924     gbinv23.seq
 357338859     gbinv24.seq
 499997260     gbinv25.seq
 499998496     gbinv26.seq
 173868103     gbinv27.seq
 499999466     gbinv28.seq
 499999780     gbinv29.seq
 499999903     gbinv3.seq
 116080448     gbinv30.seq
 499997760     gbinv31.seq
 499999120     gbinv32.seq
 147464209     gbinv33.seq
 499996765     gbinv34.seq
 499998924     gbinv35.seq
 155775628     gbinv36.seq
 500000049     gbinv37.seq
 499998619     gbinv38.seq
 190233830     gbinv39.seq
 499042142     gbinv4.seq
 499998310     gbinv40.seq
 499998425     gbinv41.seq
 244567579     gbinv42.seq
 499997572     gbinv43.seq
 499998835     gbinv44.seq
 499998576     gbinv45.seq
 396924006     gbinv46.seq
 499998874     gbinv47.seq
 445991558     gbinv48.seq
 499976732     gbinv49.seq
 150847268     gbinv5.seq
 499931605     gbinv50.seq
 499836131     gbinv51.seq
 464410450     gbinv52.seq
 499991661     gbinv53.seq
 499998811     gbinv54.seq
  46095865     gbinv55.seq
 499962019     gbinv56.seq
 499947664     gbinv57.seq
 499974438     gbinv58.seq
 499998628     gbinv59.seq
 496541042     gbinv6.seq
 464067643     gbinv60.seq
 499980694     gbinv61.seq
 499995845     gbinv62.seq
 499999515     gbinv63.seq
 499998882     gbinv64.seq
  16421223     gbinv65.seq
 499993060     gbinv66.seq
 499995424     gbinv67.seq
 499974762     gbinv68.seq
 331807587     gbinv69.seq
 476450800     gbinv7.seq
 499848766     gbinv70.seq
 499969110     gbinv71.seq
 499957615     gbinv72.seq
 499996900     gbinv73.seq
 386562725     gbinv74.seq
 499997625     gbinv75.seq
 499969750     gbinv76.seq
 499991898     gbinv77.seq
 278388955     gbinv78.seq
 499908338     gbinv79.seq
 422530809     gbinv8.seq
 499975101     gbinv80.seq
 499738620     gbinv81.seq
 499909318     gbinv82.seq
 499884197     gbinv83.seq
 337327845     gbinv84.seq
 499998401     gbinv85.seq
  56631430     gbinv86.seq
 499979826     gbinv87.seq
 499992604     gbinv88.seq
 145593135     gbinv89.seq
 173964300     gbinv9.seq
 499998556     gbinv90.seq
 499997693     gbinv91.seq
 172341791     gbinv92.seq
 499362201     gbinv93.seq
 498197561     gbinv94.seq
 499624591     gbinv95.seq
 241509040     gbinv96.seq
 487222486     gbinv97.seq
 383787509     gbinv98.seq
 496195604     gbinv99.seq
 500000088     gbmam1.seq
 445458574     gbmam10.seq
 122412955     gbmam11.seq
 451114203     gbmam12.seq
 418062948     gbmam13.seq
 499818197     gbmam14.seq
 462376363     gbmam15.seq
 370510653     gbmam16.seq
 446296425     gbmam17.seq
 431104447     gbmam18.seq
 480602957     gbmam19.seq
  87215354     gbmam2.seq
 479109873     gbmam20.seq
 483903297     gbmam21.seq
 242483322     gbmam22.seq
   9943517     gbmam23.seq
  43989127     gbmam24.seq
  91322474     gbmam25.seq
  88810627     gbmam26.seq
   6365674     gbmam27.seq
  20919287     gbmam28.seq
 449544274     gbmam29.seq
  82813304     gbmam3.seq
 499999652     gbmam30.seq
 499979735     gbmam31.seq
 499999775     gbmam32.seq
  64491308     gbmam33.seq
  71295759     gbmam4.seq
  22570875     gbmam5.seq
   1268605     gbmam6.seq
 378312072     gbmam7.seq
 338653930     gbmam8.seq
 477859989     gbmam9.seq
  44751997     gbnew.txt
 499997421     gbpat1.seq
 499999978     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335317137     gbpat107.seq
 499999113     gbpat108.seq
 500000238     gbpat109.seq
 499996607     gbpat11.seq
 207985176     gbpat110.seq
 499860769     gbpat111.seq
 499997695     gbpat112.seq
 173996634     gbpat113.seq
 499999438     gbpat114.seq
 499998688     gbpat115.seq
 500000227     gbpat116.seq
   8433907     gbpat117.seq
 499659145     gbpat118.seq
 382771705     gbpat119.seq
 179058839     gbpat12.seq
 499997445     gbpat120.seq
 499996699     gbpat121.seq
 499993390     gbpat122.seq
 499999308     gbpat123.seq
  56244385     gbpat124.seq
 499988626     gbpat125.seq
 499998444     gbpat126.seq
 208382650     gbpat127.seq
 499999601     gbpat128.seq
 499999973     gbpat129.seq
 499999505     gbpat13.seq
  57210893     gbpat130.seq
 499999479     gbpat131.seq
 499997567     gbpat132.seq
 487291944     gbpat133.seq
 500000047     gbpat134.seq
 499998784     gbpat135.seq
  25836905     gbpat136.seq
 499991581     gbpat137.seq
 385111596     gbpat138.seq
 499999583     gbpat139.seq
 499999741     gbpat14.seq
 500000185     gbpat140.seq
 148478187     gbpat141.seq
 499999269     gbpat142.seq
 314421814     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499985891     gbpat148.seq
 125941966     gbpat149.seq
  62278700     gbpat15.seq
 499989559     gbpat150.seq
 499997996     gbpat151.seq
 499998591     gbpat152.seq
 500000091     gbpat153.seq
 169807505     gbpat154.seq
 500000067     gbpat155.seq
 425267956     gbpat156.seq
 499998631     gbpat157.seq
 499999966     gbpat158.seq
 499839144     gbpat159.seq
 499998696     gbpat16.seq
 353456507     gbpat160.seq
 499992358     gbpat161.seq
 500000149     gbpat162.seq
 289441963     gbpat163.seq
 499999224     gbpat164.seq
 499999149     gbpat165.seq
 499999551     gbpat166.seq
 100295510     gbpat167.seq
 499998414     gbpat168.seq
 499997006     gbpat169.seq
 499999480     gbpat17.seq
 499998122     gbpat170.seq
 499999325     gbpat171.seq
 301646449     gbpat172.seq
 499981290     gbpat173.seq
 499998558     gbpat174.seq
 499995515     gbpat175.seq
 500000026     gbpat176.seq
 499998698     gbpat177.seq
  39613737     gbpat178.seq
 497266283     gbpat179.seq
 421727733     gbpat18.seq
 499998496     gbpat180.seq
 499998552     gbpat181.seq
  86795664     gbpat182.seq
 499995066     gbpat183.seq
 500000008     gbpat184.seq
 499999767     gbpat185.seq
  39653349     gbpat186.seq
 499256433     gbpat187.seq
 499999501     gbpat188.seq
 499994151     gbpat189.seq
 499751485     gbpat19.seq
 198754499     gbpat190.seq
 500000054     gbpat191.seq
 499999577     gbpat192.seq
 321705067     gbpat193.seq
 499991396     gbpat194.seq
 499963719     gbpat195.seq
 350635988     gbpat196.seq
 497506292     gbpat197.seq
 499869540     gbpat198.seq
 499997634     gbpat199.seq
 499999776     gbpat2.seq
 499998746     gbpat20.seq
 499999919     gbpat200.seq
 186481330     gbpat201.seq
 499998260     gbpat21.seq
 341413196     gbpat22.seq
 499906648     gbpat23.seq
 499999976     gbpat24.seq
 499766008     gbpat25.seq
 496849353     gbpat26.seq
 161790851     gbpat27.seq
 499999344     gbpat28.seq
 499999886     gbpat29.seq
  61172787     gbpat3.seq
 213205625     gbpat30.seq
 499999775     gbpat31.seq
 406000765     gbpat32.seq
 499998897     gbpat33.seq
 499999841     gbpat34.seq
 125158635     gbpat35.seq
 500000066     gbpat36.seq
 499997510     gbpat37.seq
 499999435     gbpat38.seq
 135698768     gbpat39.seq
 500000095     gbpat4.seq
 500000135     gbpat40.seq
 498916705     gbpat41.seq
 498926787     gbpat42.seq
 499999985     gbpat43.seq
 138438686     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499999186     gbpat47.seq
  87741306     gbpat48.seq
 499999114     gbpat49.seq
 500000049     gbpat5.seq
 499999765     gbpat50.seq
 499999813     gbpat51.seq
 130922406     gbpat52.seq
 499998907     gbpat53.seq
 499999084     gbpat54.seq
 184978330     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 418187865     gbpat6.seq
 499638184     gbpat60.seq
 429847084     gbpat61.seq
 499999918     gbpat62.seq
 320388396     gbpat63.seq
 499998851     gbpat64.seq
 500000240     gbpat65.seq
 305401333     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999681     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499997697     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474414032     gbpat82.seq
 499999777     gbpat83.seq
 325490152     gbpat84.seq
 499999628     gbpat85.seq
 305092461     gbpat86.seq
 499996922     gbpat87.seq
 499999833     gbpat88.seq
 499997306     gbpat89.seq
 316931964     gbpat9.seq
 202399938     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499947736     gbpat93.seq
 252089818     gbpat94.seq
 499995090     gbpat95.seq
 499996848     gbpat96.seq
  81953256     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499999608     gbphg1.seq
 499899798     gbphg2.seq
 499966273     gbphg3.seq
  15427283     gbphg4.seq
 499997955     gbpln1.seq
 268695070     gbpln10.seq
 499999729     gbpln100.seq
 464714523     gbpln101.seq
 500000011     gbpln102.seq
 411122823     gbpln103.seq
 499990612     gbpln104.seq
 383335559     gbpln105.seq
 499999712     gbpln106.seq
 499797534     gbpln107.seq
 499998895     gbpln108.seq
  59954427     gbpln109.seq
 499903125     gbpln11.seq
 499999267     gbpln110.seq
 499999249     gbpln111.seq
 382209105     gbpln112.seq
 499995104     gbpln113.seq
 499758740     gbpln114.seq
 499215500     gbpln115.seq
 122003027     gbpln116.seq
 493512051     gbpln117.seq
 490277682     gbpln118.seq
 498916017     gbpln119.seq
 498290458     gbpln12.seq
 149937417     gbpln120.seq
 445924319     gbpln121.seq
 486190265     gbpln122.seq
 727944807     gbpln123.seq
 995775608     gbpln124.seq
 907290209     gbpln125.seq
 842377801     gbpln126.seq
 875382694     gbpln127.seq
 763260087     gbpln128.seq
 865789945     gbpln129.seq
 463207289     gbpln13.seq
 480459592     gbpln130.seq
 487356390     gbpln131.seq
 424014038     gbpln132.seq
   9838016     gbpln133.seq
  10166055     gbpln134.seq
 766528189     gbpln135.seq
   9917305     gbpln136.seq
 756143249     gbpln137.seq
 878426054     gbpln138.seq
 631056251     gbpln139.seq
 467751929     gbpln14.seq
 993852367     gbpln140.seq
1020132695     gbpln141.seq
 830166807     gbpln142.seq
 955723315     gbpln143.seq
1057964328     gbpln144.seq
 784007552     gbpln145.seq
 947940191     gbpln146.seq
 857511193     gbpln147.seq
 649137171     gbpln148.seq
 903393879     gbpln149.seq
 499407929     gbpln15.seq
 908180396     gbpln150.seq
 721135945     gbpln151.seq
 786739709     gbpln152.seq
 918070756     gbpln153.seq
 603192844     gbpln154.seq
 938102555     gbpln155.seq
 955978436     gbpln156.seq
 813787878     gbpln157.seq
 639701128     gbpln158.seq
 432028229     gbpln159.seq
 251822831     gbpln16.seq
 499417730     gbpln160.seq
 499087394     gbpln161.seq
  17805492     gbpln162.seq
 768129678     gbpln163.seq
 891209633     gbpln164.seq
1017177961     gbpln165.seq
1036708108     gbpln166.seq
 980496603     gbpln167.seq
1096870510     gbpln168.seq
 964601805     gbpln169.seq
 345414603     gbpln17.seq
 883690282     gbpln170.seq
 879367269     gbpln171.seq
 922136688     gbpln172.seq
 805432021     gbpln173.seq
 912345991     gbpln174.seq
 954500353     gbpln175.seq
 944560088     gbpln176.seq
  29467656     gbpln177.seq
 392417124     gbpln178.seq
 499999944     gbpln179.seq
 383407370     gbpln18.seq
 499998868     gbpln180.seq
 343789801     gbpln181.seq
 499998194     gbpln182.seq
 499998922     gbpln183.seq
 499999900     gbpln184.seq
 499998307     gbpln185.seq
  24017125     gbpln186.seq
 203983960     gbpln19.seq
 499983266     gbpln2.seq
  84497167     gbpln20.seq
 477736047     gbpln21.seq
 499901688     gbpln22.seq
 498817745     gbpln23.seq
 323729344     gbpln24.seq
 499081327     gbpln25.seq
 497392106     gbpln26.seq
 499424594     gbpln27.seq
 103293547     gbpln28.seq
 496565850     gbpln29.seq
 499889712     gbpln3.seq
 498203510     gbpln30.seq
 349196026     gbpln31.seq
 482187406     gbpln32.seq
 497060599     gbpln33.seq
 325254605     gbpln34.seq
 458188834     gbpln35.seq
 497320240     gbpln36.seq
 472649754     gbpln37.seq
 478648725     gbpln38.seq
  83738349     gbpln39.seq
 499974105     gbpln4.seq
 494333229     gbpln40.seq
 475206592     gbpln41.seq
 468207974     gbpln42.seq
 477377071     gbpln43.seq
 272302995     gbpln44.seq
 172901760     gbpln45.seq
 454103898     gbpln46.seq
 440354294     gbpln47.seq
 469681218     gbpln48.seq
 344132339     gbpln49.seq
 461095488     gbpln5.seq
 191028955     gbpln50.seq
 365193639     gbpln51.seq
 363399137     gbpln52.seq
 374989163     gbpln53.seq
 491937705     gbpln54.seq
 408713394     gbpln55.seq
 476592824     gbpln56.seq
 434249106     gbpln57.seq
 440487254     gbpln58.seq
 444203819     gbpln59.seq
 499998032     gbpln6.seq
 189178941     gbpln60.seq
 488639738     gbpln61.seq
 449154467     gbpln62.seq
 457872487     gbpln63.seq
 464870664     gbpln64.seq
 498221420     gbpln65.seq
 196083148     gbpln66.seq
     84604     gbpln67.seq
    354449     gbpln68.seq
 164935257     gbpln69.seq
 499958898     gbpln7.seq
  40081560     gbpln70.seq
  74904989     gbpln71.seq
 499999145     gbpln72.seq
 356280646     gbpln73.seq
 499998829     gbpln74.seq
 499996771     gbpln75.seq
 138766477     gbpln76.seq
 499842320     gbpln77.seq
 499382720     gbpln78.seq
 499979502     gbpln79.seq
 224901859     gbpln8.seq
 284174723     gbpln80.seq
 297797176     gbpln81.seq
 210413183     gbpln82.seq
 247529348     gbpln83.seq
 185599660     gbpln84.seq
 997331397     gbpln85.seq
  56487071     gbpln86.seq
 487345662     gbpln87.seq
 473525640     gbpln88.seq
 473209476     gbpln89.seq
 499990067     gbpln9.seq
 467870556     gbpln90.seq
 357033525     gbpln91.seq
 499999976     gbpln92.seq
  61975268     gbpln93.seq
 499998961     gbpln94.seq
 499999708     gbpln95.seq
 265854926     gbpln96.seq
 498123722     gbpln97.seq
 499999294     gbpln98.seq
  84509137     gbpln99.seq
 147957234     gbpri1.seq
 499825466     gbpri10.seq
 499980989     gbpri11.seq
 248926676     gbpri12.seq
 499853606     gbpri13.seq
 140347179     gbpri14.seq
 162651203     gbpri15.seq
 494708592     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499961883     gbpri19.seq
 499816667     gbpri2.seq
 499985531     gbpri20.seq
  18245522     gbpri21.seq
 499987105     gbpri22.seq
 499998955     gbpri23.seq
 430424317     gbpri24.seq
 499971439     gbpri25.seq
 499999388     gbpri26.seq
 316321149     gbpri27.seq
 499967838     gbpri28.seq
 425111553     gbpri29.seq
 499891257     gbpri3.seq
 314294173     gbpri30.seq
 258775295     gbpri31.seq
 499999114     gbpri32.seq
 499995838     gbpri33.seq
 284210174     gbpri34.seq
 499855390     gbpri4.seq
 499729136     gbpri5.seq
 393528771     gbpri6.seq
 499802910     gbpri7.seq
 499984908     gbpri8.seq
 499967826     gbpri9.seq
    413045     gbrel.txt
 499859017     gbrod1.seq
 499994003     gbrod10.seq
   3477389     gbrod11.seq
 499812195     gbrod12.seq
 203924668     gbrod13.seq
 499993880     gbrod14.seq
 499997569     gbrod15.seq
 499997884     gbrod16.seq
 499997346     gbrod17.seq
 126521891     gbrod18.seq
 499802341     gbrod2.seq
 499880319     gbrod3.seq
 499702715     gbrod4.seq
 499960342     gbrod5.seq
  80291490     gbrod6.seq
 499846851     gbrod7.seq
 499742719     gbrod8.seq
 499945822     gbrod9.seq
 499998676     gbsts1.seq
 499998274     gbsts10.seq
 433222712     gbsts11.seq
 499997771     gbsts2.seq
  37828443     gbsts3.seq
 499998792     gbsts4.seq
 499996791     gbsts5.seq
 456729482     gbsts6.seq
 499997334     gbsts7.seq
 499998238     gbsts8.seq
  21531081     gbsts9.seq
 300737586     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 500000171     gbsyn22.seq
 455584145     gbsyn23.seq
 499993129     gbsyn24.seq
 499995740     gbsyn25.seq
 499994127     gbsyn26.seq
 186858604     gbsyn27.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999287     gbtsa1.seq
 499998301     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 472042620     gbtsa107.seq
 499997664     gbtsa108.seq
 499998091     gbtsa109.seq
 499997965     gbtsa11.seq
 231476173     gbtsa110.seq
 499999916     gbtsa111.seq
 499999178     gbtsa112.seq
 499998485     gbtsa113.seq
 499999039     gbtsa114.seq
  32605644     gbtsa115.seq
 500000071     gbtsa116.seq
 499996732     gbtsa117.seq
 499998477     gbtsa118.seq
 469116011     gbtsa119.seq
 179283998     gbtsa12.seq
 499999748     gbtsa120.seq
 499999037     gbtsa121.seq
 499998875     gbtsa122.seq
 278733702     gbtsa123.seq
 499999266     gbtsa124.seq
 499999256     gbtsa125.seq
 499998286     gbtsa126.seq
 421530147     gbtsa127.seq
 499996235     gbtsa13.seq
 499999964     gbtsa14.seq
 151618535     gbtsa15.seq
 499999603     gbtsa16.seq
 499996688     gbtsa17.seq
 258373800     gbtsa18.seq
 499997252     gbtsa19.seq
 499998984     gbtsa2.seq
 499998175     gbtsa20.seq
 499999260     gbtsa21.seq
  67397747     gbtsa22.seq
 499999604     gbtsa23.seq
 499997273     gbtsa24.seq
 499999492     gbtsa25.seq
 275956906     gbtsa26.seq
 499999635     gbtsa27.seq
 499999791     gbtsa28.seq
  71311344     gbtsa29.seq
 146878920     gbtsa3.seq
 499998196     gbtsa30.seq
 499999529     gbtsa31.seq
 153218059     gbtsa32.seq
 499998835     gbtsa33.seq
 499996513     gbtsa34.seq
 499997585     gbtsa35.seq
 487094675     gbtsa36.seq
 499999485     gbtsa37.seq
 499997575     gbtsa38.seq
 499998617     gbtsa39.seq
 499998567     gbtsa4.seq
 225919334     gbtsa40.seq
 499999675     gbtsa41.seq
 499997165     gbtsa42.seq
 499998635     gbtsa43.seq
 174840812     gbtsa44.seq
 499998997     gbtsa45.seq
 499999560     gbtsa46.seq
 354820880     gbtsa47.seq
 499999373     gbtsa48.seq
 499997080     gbtsa49.seq
 499999940     gbtsa5.seq
 289649000     gbtsa50.seq
 499999814     gbtsa51.seq
 499997752     gbtsa52.seq
 394305971     gbtsa53.seq
 499998483     gbtsa54.seq
 499998629     gbtsa55.seq
 499998068     gbtsa56.seq
 349466573     gbtsa57.seq
 499999428     gbtsa58.seq
 499998837     gbtsa59.seq
  50314135     gbtsa6.seq
 499998097     gbtsa60.seq
 221419020     gbtsa61.seq
 499999964     gbtsa62.seq
 499999918     gbtsa63.seq
 259941502     gbtsa64.seq
 499999212     gbtsa65.seq
 465402653     gbtsa66.seq
 499999280     gbtsa67.seq
 499997713     gbtsa68.seq
 499997088     gbtsa69.seq
 499998877     gbtsa7.seq
 164931383     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499997981     gbtsa75.seq
 499998780     gbtsa76.seq
 131354879     gbtsa77.seq
 499998723     gbtsa78.seq
 499997516     gbtsa79.seq
 499999768     gbtsa8.seq
  30973467     gbtsa80.seq
 499999375     gbtsa81.seq
 499998969     gbtsa82.seq
 499999731     gbtsa83.seq
 499998462     gbtsa84.seq
  45716037     gbtsa85.seq
 499997106     gbtsa86.seq
 499998546     gbtsa87.seq
 499998114     gbtsa88.seq
  81423881     gbtsa89.seq
 266838890     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499995192     gbtsa96.seq
 499998487     gbtsa97.seq
 499999226     gbtsa98.seq
 230571289     gbtsa99.seq
   1745264     gbuna1.seq
 499997483     gbvrl1.seq
 499998470     gbvrl10.seq
 209381890     gbvrl11.seq
 499999015     gbvrl12.seq
 499997004     gbvrl13.seq
 126562014     gbvrl14.seq
 499996727     gbvrl15.seq
 499999445     gbvrl16.seq
 305944549     gbvrl17.seq
 499998697     gbvrl18.seq
 499994912     gbvrl19.seq
 499998939     gbvrl2.seq
 335759910     gbvrl20.seq
 499999232     gbvrl21.seq
 499998932     gbvrl22.seq
 358825231     gbvrl23.seq
 499493361     gbvrl24.seq
 499996599     gbvrl25.seq
 297237623     gbvrl26.seq
 499994891     gbvrl27.seq
 499997691     gbvrl28.seq
 298952814     gbvrl29.seq
 360633377     gbvrl3.seq
 499703961     gbvrl30.seq
 499962943     gbvrl31.seq
 499999742     gbvrl32.seq
 499996634     gbvrl33.seq
 351665352     gbvrl34.seq
 499997615     gbvrl4.seq
 499996679     gbvrl5.seq
 499999240     gbvrl6.seq
 499997983     gbvrl7.seq
 278998092     gbvrl8.seq
 500000196     gbvrl9.seq
 499778310     gbvrt1.seq
  36032850     gbvrt10.seq
  58362214     gbvrt100.seq
 436487263     gbvrt101.seq
 486733599     gbvrt102.seq
 492783918     gbvrt103.seq
 423399197     gbvrt104.seq
 280513212     gbvrt105.seq
 475547766     gbvrt106.seq
 480350778     gbvrt107.seq
 495756533     gbvrt108.seq
  63702925     gbvrt109.seq
  18507952     gbvrt11.seq
 979124861     gbvrt110.seq
 838606404     gbvrt111.seq
 678361887     gbvrt112.seq
 476489691     gbvrt113.seq
 461392781     gbvrt114.seq
 438813789     gbvrt115.seq
 394333916     gbvrt116.seq
 313817861     gbvrt117.seq
 288999337     gbvrt118.seq
 280185755     gbvrt119.seq
 497676663     gbvrt12.seq
 407764323     gbvrt120.seq
 420699777     gbvrt121.seq
 478932645     gbvrt122.seq
 480028007     gbvrt123.seq
 438022009     gbvrt124.seq
 174441466     gbvrt125.seq
 487902327     gbvrt126.seq
 456814572     gbvrt127.seq
 462308879     gbvrt128.seq
 168814011     gbvrt129.seq
 497173924     gbvrt13.seq
 455912137     gbvrt130.seq
 469532514     gbvrt131.seq
 479131053     gbvrt132.seq
 211426449     gbvrt133.seq
 481245397     gbvrt134.seq
 475910738     gbvrt135.seq
 457651990     gbvrt136.seq
 489556664     gbvrt137.seq
 272030140     gbvrt138.seq
 484470033     gbvrt139.seq
 481350583     gbvrt14.seq
 499012241     gbvrt140.seq
 498420127     gbvrt141.seq
 286264069     gbvrt142.seq
 464881586     gbvrt143.seq
 697335102     gbvrt144.seq
 670835455     gbvrt145.seq
 524090205     gbvrt146.seq
 413419778     gbvrt147.seq
 345316796     gbvrt148.seq
 329840741     gbvrt149.seq
 400795564     gbvrt15.seq
 250750069     gbvrt150.seq
 486599694     gbvrt151.seq
 364885015     gbvrt152.seq
 448394487     gbvrt153.seq
 471481480     gbvrt154.seq
 393642546     gbvrt155.seq
 355134426     gbvrt156.seq
 470602761     gbvrt157.seq
 448657503     gbvrt158.seq
 384724573     gbvrt159.seq
 488197715     gbvrt16.seq
 432320943     gbvrt160.seq
 474598726     gbvrt161.seq
 476176571     gbvrt162.seq
  92249616     gbvrt163.seq
 499997211     gbvrt164.seq
 408926909     gbvrt165.seq
 479291185     gbvrt17.seq
 480798341     gbvrt18.seq
 499274554     gbvrt19.seq
 499818389     gbvrt2.seq
 483255170     gbvrt20.seq
 484153821     gbvrt21.seq
  65325604     gbvrt22.seq
   4698304     gbvrt23.seq
  14151693     gbvrt24.seq
  21383246     gbvrt25.seq
  90967413     gbvrt26.seq
 499915959     gbvrt27.seq
 499997736     gbvrt28.seq
 499996860     gbvrt29.seq
 234318767     gbvrt3.seq
  54841031     gbvrt30.seq
 499998194     gbvrt31.seq
 499999774     gbvrt32.seq
 363552735     gbvrt33.seq
 499999352     gbvrt34.seq
 439230930     gbvrt35.seq
 499999491     gbvrt36.seq
  27627403     gbvrt37.seq
 443445524     gbvrt38.seq
 499999072     gbvrt39.seq
 263630224     gbvrt4.seq
 377639273     gbvrt40.seq
 499996674     gbvrt41.seq
 278018594     gbvrt42.seq
 499998676     gbvrt43.seq
 497944391     gbvrt44.seq
 495812897     gbvrt45.seq
 499526914     gbvrt46.seq
 495704980     gbvrt47.seq
 360164448     gbvrt48.seq
 199952251     gbvrt49.seq
 289935611     gbvrt5.seq
 122600608     gbvrt50.seq
 483171124     gbvrt51.seq
 481925504     gbvrt52.seq
 499999199     gbvrt53.seq
 499926681     gbvrt54.seq
 296494910     gbvrt55.seq
 491035870     gbvrt56.seq
 492369611     gbvrt57.seq
 479652387     gbvrt58.seq
 480795619     gbvrt59.seq
  87348322     gbvrt6.seq
 362157432     gbvrt60.seq
 490931275     gbvrt61.seq
 475376599     gbvrt62.seq
 489403698     gbvrt63.seq
 352278492     gbvrt64.seq
 465343303     gbvrt65.seq
 488761954     gbvrt66.seq
 189335727     gbvrt67.seq
 443535502     gbvrt68.seq
 421190409     gbvrt69.seq
 499767198     gbvrt7.seq
 391875588     gbvrt70.seq
 372304558     gbvrt71.seq
 293994257     gbvrt72.seq
 265964554     gbvrt73.seq
 252405654     gbvrt74.seq
 496924908     gbvrt75.seq
 428777944     gbvrt76.seq
 385782563     gbvrt77.seq
 401943336     gbvrt78.seq
 480032615     gbvrt79.seq
 284656235     gbvrt8.seq
 474823439     gbvrt80.seq
 480706138     gbvrt81.seq
  89575236     gbvrt82.seq
 435875138     gbvrt83.seq
 487966705     gbvrt84.seq
 497561523     gbvrt85.seq
 468903694     gbvrt86.seq
1063697024     gbvrt87.seq
1045817107     gbvrt88.seq
 754876349     gbvrt89.seq
  15637436     gbvrt9.seq
 616753639     gbvrt90.seq
 490283567     gbvrt91.seq
 470650802     gbvrt92.seq
 397152541     gbvrt93.seq
 351566465     gbvrt94.seq
 339881205     gbvrt95.seq
 404715121     gbvrt96.seq
 489464188     gbvrt97.seq
 499106074     gbvrt98.seq
 486716912     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         96643      186730229
BCT10        104        247294913
BCT100       124        217933644
BCT101       53         217706139
BCT102       89         225179091
BCT103       56         148271596
BCT104       95         227942482
BCT105       73         219469130
BCT106       112        221134503
BCT107       78         197436808
BCT108       151        221211798
BCT109       87         224943829
BCT11        158        243728409
BCT110       77         217244229
BCT111       134        226822806
BCT112       97         220860781
BCT113       89         227801861
BCT114       74         152992742
BCT115       115        225967887
BCT116       92         220409897
BCT117       158        214217907
BCT118       88         207032597
BCT119       140        221673291
BCT12        146        239228381
BCT120       63         218436112
BCT121       90         215069748
BCT122       125        215786686
BCT123       87         220066149
BCT124       21         65066945
BCT125       174        220602790
BCT126       125        222941413
BCT127       123        219745957
BCT128       166        221868080
BCT129       48         154061987
BCT13        170        237845538
BCT130       103        221969738
BCT131       112        217634974
BCT132       142        222969051
BCT133       107        216561771
BCT134       124        222163867
BCT135       90         146588770
BCT136       95         229134325
BCT137       107        223244277
BCT138       100        225740402
BCT139       110        221794950
BCT14        170        248109197
BCT140       93         220088855
BCT141       140        219818715
BCT142       20         41808279
BCT143       169        220902023
BCT144       100        223728003
BCT145       94         222167747
BCT146       93         209436870
BCT147       70         219951767
BCT148       119        231773125
BCT149       149        226774948
BCT15        181        249189521
BCT150       78         203290351
BCT151       99         229083667
BCT152       104        226756878
BCT153       131        225258273
BCT154       77         220678973
BCT155       18         59578137
BCT156       117        224174805
BCT157       157        225126315
BCT158       70         216329275
BCT159       73         109500594
BCT16        109        223475906
BCT160       111        216184725
BCT161       156        227708035
BCT162       111        220250908
BCT163       89         136614524
BCT164       133        229717687
BCT165       115        210541088
BCT166       97         219597650
BCT167       76         160434643
BCT168       98         220150284
BCT169       132        228483677
BCT17        522        214086124
BCT170       123        226320100
BCT171       120        243829191
BCT172       114        230157651
BCT173       25         72374358
BCT174       138        219191771
BCT175       86         222769161
BCT176       108        224413134
BCT177       118        222428501
BCT178       67         117928221
BCT179       127        226982633
BCT18        5200       7533877
BCT180       135        255022614
BCT181       114        226333191
BCT182       158        220019044
BCT183       42         78130485
BCT184       119        217568478
BCT185       116        217910420
BCT186       90         217823726
BCT187       102        230884613
BCT188       93         163366605
BCT189       97         234475408
BCT19        10402      13141863
BCT190       102        220656832
BCT191       91         222992603
BCT192       96         223719123
BCT193       98         226089117
BCT194       110        227124159
BCT195       56         119273433
BCT196       104        221661048
BCT197       111        224603392
BCT198       103        230176873
BCT199       59         244185181
BCT2         105        227253826
BCT20        53919      202370649
BCT200       75         254647899
BCT201       106        225367374
BCT202       177        219018371
BCT203       136        225791127
BCT204       51         98172813
BCT205       324        275336670
BCT206       120        220759703
BCT207       125        219329262
BCT208       13         20819789
BCT209       89         220099828
BCT21        188        215790006
BCT210       86         225281672
BCT211       96         237278947
BCT212       102        235605233
BCT213       3          9857960
BCT214       60         216868170
BCT215       120        221119124
BCT216       87         227479657
BCT217       89         223478018
BCT218       18         38638072
BCT219       158        275283723
BCT22        103        228704622
BCT220       76         226380288
BCT221       113        221341421
BCT222       96         135592067
BCT223       109        262921422
BCT224       72         221876383
BCT225       92         215446897
BCT226       67         172210098
BCT227       144        309044214
BCT228       72         238379041
BCT229       94         218003556
BCT23        118        231551515
BCT230       143        231839334
BCT231       131        266235783
BCT232       146        273570514
BCT233       99         253123186
BCT234       35         229277923
BCT235       68         227137462
BCT236       107        217894639
BCT237       89         243130337
BCT238       86         227348436
BCT239       7          7131389
BCT24        25         63062813
BCT240       125        215030391
BCT241       113        223212915
BCT242       133        229431005
BCT243       117        227614670
BCT244       101        224643254
BCT245       114        197420278
BCT246       107        219875030
BCT247       83         221095984
BCT248       103        230521646
BCT249       116        226753845
BCT25        103        220877412
BCT250       80         239852532
BCT251       102        228182732
BCT252       89         172307388
BCT253       138        231521589
BCT254       158        212726346
BCT255       162        210282110
BCT256       120        247478758
BCT257       119        227278841
BCT258       148        247264583
BCT259       121        240550175
BCT26        131        225261716
BCT260       2          9857457
BCT261       138        226476297
BCT262       110        215196592
BCT263       103        233368804
BCT264       113        222011951
BCT265       149        217320596
BCT266       116        181152790
BCT267       111        234329468
BCT268       105        218156141
BCT269       69         222365591
BCT27        119        219809790
BCT270       111        216177043
BCT271       54         90446965
BCT272       88         244048892
BCT273       97         229058335
BCT274       80         218289907
BCT275       76         218087666
BCT276       21         31166565
BCT277       122        221619234
BCT278       95         220106052
BCT279       137        215395284
BCT28        125        219253793
BCT280       98         224070092
BCT281       52         77768499
BCT282       125        251716997
BCT283       92         221626656
BCT284       53         224669383
BCT285       105        228272846
BCT286       1          4856831
BCT287       127        239991130
BCT288       220        232363582
BCT289       119        214722673
BCT29        128        223087901
BCT290       129        214504321
BCT291       70         101077909
BCT292       139        226313598
BCT293       112        222605070
BCT294       49         232607910
BCT295       97         232956592
BCT296       1248       221357811
BCT297       100        235111913
BCT298       19         47237057
BCT299       96         221953223
BCT3         37536      118572435
BCT30        195        224497881
BCT300       135        218830907
BCT301       119        227206395
BCT302       116        221044074
BCT303       32         61473892
BCT304       121        219405460
BCT305       136        225808938
BCT306       135        223319310
BCT307       97         203984302
BCT308       128        236860095
BCT309       138        228968348
BCT31        26         45760778
BCT310       133        220217272
BCT311       84         213010822
BCT312       98         232633168
BCT313       108        219055098
BCT314       67         225204524
BCT315       123        231804623
BCT316       47         17894637
BCT317       192        229827881
BCT318       125        223931426
BCT319       187        223498575
BCT32        255        228290103
BCT320       98         256678632
BCT321       69         130403705
BCT322       98         224673511
BCT323       107        235142146
BCT324       104        221239511
BCT325       140        246037539
BCT326       121        261341601
BCT327       472        142206173
BCT328       528        115589384
BCT329       1589       2511957
BCT33        96         216108910
BCT330       3172       5268484
BCT331       6338       7796395
BCT332       12613      14997690
BCT333       25523      27672494
BCT334       50567      54073229
BCT335       149292     156918370
BCT336       13786      193307340
BCT337       3297       203942569
BCT338       2237       213244276
BCT339       47403      187670329
BCT34        102        220140811
BCT340       75205      183128617
BCT341       10947      200009363
BCT342       24994      203229741
BCT343       142160     152871802
BCT344       149500     156995605
BCT345       84164      87986791
BCT346       144827     151316809
BCT347       25418      25040087
BCT348       132792     167895829
BCT349       30559      42259983
BCT35        139        223015436
BCT350       116288     178943018
BCT351       7148       16025806
BCT352       31331      52028781
BCT353       18792      283747220
BCT354       5629       211504943
BCT355       4625       215147662
BCT356       4271       229040500
BCT357       1448       277561113
BCT358       100        220928620
BCT359       56         217589903
BCT36        106        222032339
BCT360       69         216396579
BCT361       31         120171960
BCT362       69         224394912
BCT363       174        238189889
BCT364       699        290259660
BCT365       283        102664051
BCT366       693        229074666
BCT367       338        384426038
BCT368       1866       292082078
BCT369       47         97327917
BCT37        161        220965954
BCT370       87         224654833
BCT371       86         227602753
BCT372       2725       241544493
BCT373       1226       117084402
BCT374       1411       259608076
BCT375       47         241352896
BCT376       45         243003094
BCT377       2180       269716913
BCT378       945        54278114
BCT379       2274       268989543
BCT38        133        221316823
BCT380       83         274582043
BCT381       416        278590055
BCT382       3013       250249261
BCT383       11929      19895144
BCT384       24820      41501507
BCT385       118839     188943268
BCT386       123474     196122081
BCT387       22082      43160415
BCT39        111        220464912
BCT4         41293      139254422
BCT40        123        223234818
BCT41        131        218260172
BCT42        105        232532281
BCT43        130        224240294
BCT44        69         107066299
BCT45        95         230912422
BCT46        117        227983621
BCT47        160        232896345
BCT48        154        221688996
BCT49        128        238275556
BCT5         20648      169648440
BCT50        114        230664549
BCT51        54         123393656
BCT52        300        239582260
BCT53        142        231562727
BCT54        354        225466658
BCT55        111        222677306
BCT56        121        213352665
BCT57        120        227473574
BCT58        98         224926366
BCT59        90         224039666
BCT6         2600       37759883
BCT60        103        223607010
BCT61        52         129132706
BCT62        53         211054879
BCT63        45         210584326
BCT64        45         210864282
BCT65        45         212727898
BCT66        76         222861078
BCT67        40         115080869
BCT68        112        227959956
BCT69        129        231316827
BCT7         1310       133308362
BCT70        99         245428056
BCT71        87         223381451
BCT72        59         181990919
BCT73        95         236396547
BCT74        104        227684880
BCT75        60         225896168
BCT76        62         130720693
BCT77        97         233622726
BCT78        82         229505918
BCT79        100        238937572
BCT8         189        237087597
BCT80        24         34605195
BCT81        94         226656782
BCT82        118        229172918
BCT83        127        232212861
BCT84        90         178403076
BCT85        114        212138354
BCT86        75         222053892
BCT87        112        225347102
BCT88        124        217786851
BCT89        3          5977905
BCT9         134        238319576
BCT90        246        222259941
BCT91        104        221252195
BCT92        100        224644129
BCT93        83         222703364
BCT94        21         86233168
BCT95        68         221578114
BCT96        87         219795379
BCT97        87         223588406
BCT98        80         226287962
BCT99        20         45564131
ENV1         190091     141901631
ENV10        186276     146052765
ENV11        209775     130999459
ENV12        177002     144842116
ENV13        155469     156528738
ENV14        250296     68811440
ENV15        87145      20068530
ENV16        220965     118700470
ENV17        255797     108838221
ENV18        202937     127155612
ENV19        22309      22029863
ENV2         165535     152025721
ENV20        152297     158748216
ENV21        201147     103385449
ENV22        68250      51337090
ENV23        213445     108950534
ENV24        170894     153854262
ENV25        135008     163677002
ENV26        11467      15623893
ENV27        179959     128306849
ENV28        218106     118363046
ENV29        78198      41645195
ENV3         70838      218563586
ENV30        143995     98019561
ENV31        100666     112298113
ENV32        130011     79912996
ENV33        173950     138875558
ENV34        165427     138576238
ENV35        177063     112187548
ENV36        200945     107251196
ENV37        196365     109590974
ENV38        110136     97113630
ENV39        158086     134837061
ENV4         181731     162174783
ENV40        145151     136789097
ENV41        168817     47679954
ENV42        172142     133204407
ENV43        211376     99903708
ENV44        140105     61567130
ENV45        216486     84261864
ENV46        212761     92654041
ENV47        108047     43413204
ENV48        224727     98785870
ENV49        224440     91990121
ENV5         35661      7929902
ENV50        140824     90782127
ENV51        198811     110735154
ENV52        179931     90609657
ENV53        198001     105624634
ENV54        220363     125757455
ENV55        227355     98906676
ENV56        196417     109735247
ENV57        154019     151104009
ENV58        33819      82751107
ENV6         218994     102591558
ENV7         176411     159905867
ENV8         19512      17036635
ENV9         204720     124206041
EST1         152690     59075604
EST10        155848     67145433
EST100       152900     76533879
EST101       145310     99404929
EST102       145325     85607865
EST103       149132     92919202
EST104       6681       3970697
EST105       149700     109472275
EST106       135201     99323583
EST107       136256     97451505
EST108       136283     94853558
EST109       2281       1508086
EST11        163604     69204453
EST110       136944     77336980
EST111       176776     106124108
EST112       193739     119008213
EST113       235935     141052448
EST114       7258       4463772
EST115       228229     127103651
EST116       183114     103694875
EST117       191632     94586043
EST118       3390       2617463
EST119       148776     100418839
EST12        150663     64729921
EST120       154737     119075941
EST121       166401     98014596
EST122       21716      15235645
EST123       130041     82536108
EST124       83544      30919585
EST125       36755      12481213
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186794     83521674
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173726     87636772
EST136       170476     77687375
EST137       146473     92462403
EST138       28353      17914828
EST139       141414     87650732
EST14        104647     47789803
EST140       149167     98040854
EST141       157785     78490306
EST142       180945     92631162
EST143       7797       4561553
EST144       141653     76089811
EST145       151608     73215366
EST146       148403     87052362
EST147       155950     83674655
EST148       11460      6757580
EST149       166189     102138931
EST15        197356     111644310
EST150       202211     107328473
EST151       158904     93313314
EST152       102194     51052488
EST153       156480     79482516
EST154       135477     80322193
EST155       141407     87991502
EST156       166678     86186626
EST157       7486       4323274
EST158       179043     104198048
EST159       218733     94430895
EST16        147207     104729580
EST160       145774     85841747
EST161       161649     87789494
EST162       2683       1273073
EST163       141208     82864856
EST164       133361     84329255
EST165       147190     88156848
EST166       146175     80277952
EST167       19595      9942032
EST168       117769     61073260
EST169       115690     61941713
EST17        156552     83419127
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125704     48478849
EST175       165762     83297359
EST176       172200     75566895
EST177       24700      15540223
EST178       147743     104364925
EST179       163429     99358064
EST18        191244     116974070
EST180       205284     116217156
EST181       167196     93392797
EST182       154088     103355718
EST183       134248     92949098
EST184       10655      5947216
EST185       146779     94226149
EST186       155082     81021983
EST187       132003     71138046
EST188       160658     90440156
EST189       13236      8369536
EST19        177593     113222957
EST190       148391     87401995
EST191       153610     95444112
EST192       175584     99196439
EST193       140633     77174967
EST194       5358       4373363
EST195       124150     64387264
EST196       163256     91154836
EST197       172881     99349223
EST198       149929     93111504
EST199       5475       3456868
EST2         157296     60515696
EST20        70514      55347428
EST200       165696     79441379
EST201       122431     84562161
EST202       163946     96609849
EST203       163919     95915492
EST204       12854      6191292
EST205       5847       2580354
EST206       111215     63112536
EST207       151296     87159961
EST208       107003     63421010
EST209       164716     101071760
EST21        194719     109379861
EST210       168459     124870746
EST211       82054      66695266
EST212       186353     95082816
EST213       145799     90568241
EST214       86917      65320194
EST215       142217     85392520
EST216       138361     75187981
EST217       94838      30474438
EST218       146971     86308548
EST219       149277     82730422
EST22        180131     92525031
EST220       141166     94336724
EST221       156070     90317772
EST222       8489       6085268
EST223       162144     99678311
EST224       153932     93687490
EST225       123359     88333195
EST226       145975     90180727
EST227       6782       4105919
EST228       129115     82217406
EST229       127997     89777106
EST23        106727     50177428
EST230       44037      31646845
EST231       156432     83333109
EST232       167399     92029695
EST233       166930     92691537
EST234       158122     88081303
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        191052     61413874
EST240       187909     98489047
EST241       191640     107206156
EST242       168052     100159582
EST243       180324     103395206
EST244       190067     112774100
EST245       186313     113300888
EST246       177976     115378463
EST247       6774       5366330
EST248       140163     85868119
EST249       212048     138999540
EST25        136493     39205181
EST250       224878     109933473
EST251       164077     113921229
EST252       183152     95755613
EST253       198082     98538516
EST254       122211     89202303
EST255       5592       3806885
EST256       140278     82397271
EST257       206503     112917666
EST258       162404     106256999
EST259       94133      93154138
EST26        102352     27613958
EST260       14593      19012901
EST261       147779     99296372
EST262       151103     89976672
EST263       139489     102018713
EST264       217413     99726831
EST265       2682       1845563
EST266       134233     96889460
EST267       131016     91584673
EST268       135741     98214097
EST269       113668     81492229
EST27        201622     85286892
EST270       14850      9378331
EST271       136074     84237789
EST272       126197     86196946
EST273       128323     97050498
EST274       35670      25454263
EST275       126754     89472101
EST276       116718     79174411
EST277       139559     84221793
EST278       145829     114775573
EST279       14746      10386053
EST28        19493      8764926
EST280       125388     117381359
EST281       132659     98909184
EST282       162568     97733706
EST283       165650     104454839
EST284       18821      11787955
EST285       142296     92460744
EST286       169036     115171424
EST287       151612     103866021
EST288       136564     103389794
EST289       3120       2011023
EST29        204108     100212775
EST290       159550     97230714
EST291       222471     90724791
EST292       152859     111337310
EST293       160411     71793266
EST294       10529      1190647
EST295       208923     37984366
EST296       212167     83253891
EST297       150191     115332672
EST298       168091     97752036
EST299       154879     103184574
EST3         156028     54736237
EST30        216063     108845959
EST300       169072     109986615
EST301       149587     109938627
EST302       1951       1320641
EST303       180875     102305456
EST304       178791     93163079
EST305       168899     109550180
EST306       158882     104101268
EST307       2135       1704887
EST308       226903     106725089
EST309       267202     116187840
EST31        153984     67133271
EST310       184609     111769181
EST311       149924     28237311
EST312       230050     100569626
EST313       174895     100153828
EST314       156386     99989906
EST315       158548     94413162
EST316       166394     114093378
EST317       179942     95197248
EST318       143687     97189386
EST319       188156     110324042
EST32        149544     63745823
EST320       187345     49208208
EST321       201870     33894008
EST322       174443     95509500
EST323       14472      9105625
EST324       158346     113326097
EST325       184847     110512493
EST326       167601     97760823
EST327       165572     109590298
EST328       165922     71417216
EST329       127843     80161184
EST33        165218     65709042
EST330       121728     80853125
EST331       146606     101299104
EST332       21746      7720907
EST333       250640     26635193
EST334       254708     23392102
EST335       151991     94206454
EST336       152235     98594976
EST337       151209     99840551
EST338       145954     92203211
EST339       237889     43423093
EST34        147085     64539532
EST340       185433     81237254
EST341       3685       4554017
EST342       169321     100001066
EST343       163485     100908119
EST344       145649     92756666
EST345       189916     103387744
EST346       155962     109693704
EST347       153571     101545456
EST348       1864       707553
EST349       184472     108452820
EST35        162706     70909504
EST350       169895     94652097
EST351       169251     105165364
EST352       178305     59601925
EST353       195038     71941256
EST354       194528     75305704
EST355       197065     74426894
EST356       135405     70508640
EST357       174836     127386098
EST358       148407     85117807
EST359       150566     86648213
EST36        160521     65852497
EST360       122052     95387840
EST361       5228       4156832
EST362       143577     94945899
EST363       155634     94558686
EST364       162062     90080072
EST365       157801     100316004
EST366       21621      9602251
EST367       45656      24624838
EST368       155318     104549016
EST369       137850     97037511
EST37        107955     33687683
EST370       158528     102036132
EST371       153057     110091631
EST372       29680      25288248
EST373       173564     146756127
EST374       163572     85433279
EST375       128159     81338294
EST376       137894     94126530
EST377       50614      35398778
EST378       131494     88185695
EST379       137434     89857472
EST38        99514      30487965
EST380       139740     97251188
EST381       147676     97316524
EST382       50112      40449160
EST383       164182     86552371
EST384       143622     81415127
EST385       144915     86073821
EST386       144157     103713157
EST387       155646     93181756
EST388       138127     87591810
EST389       133463     84875714
EST39        99152      31401585
EST390       19252      11819086
EST391       196902     107235645
EST392       137014     75086496
EST393       92962      54579752
EST394       120675     80303449
EST395       23099      14175362
EST396       131518     83245448
EST397       119624     76584579
EST398       147516     80760184
EST399       210531     82594033
EST4         142934     56343434
EST40        98817      29785816
EST400       29771      12535332
EST401       163649     84380495
EST402       163929     99177970
EST403       159177     95841266
EST404       125633     81071284
EST405       12450      8163608
EST406       129141     86476992
EST407       137033     89905278
EST408       178976     112236854
EST409       154128     93135231
EST41        39222      11595646
EST410       28333      12277799
EST411       166745     92047209
EST412       168862     124889078
EST413       87364      56108523
EST414       69679      41103486
EST415       34092      16783013
EST416       137530     79965946
EST417       82413      49409226
EST418       139766     56852944
EST419       148868     30145933
EST42        101326     31351096
EST420       148732     30447498
EST421       163273     80663592
EST422       26173      14136342
EST423       201222     115845880
EST424       237755     108748183
EST425       220202     107509766
EST426       127047     74475061
EST427       128057     85803248
EST428       131704     80409324
EST429       93228      56881081
EST43        102633     36243427
EST430       173975     110008863
EST431       213501     84775693
EST432       106339     28485828
EST433       184755     112765867
EST434       204073     111451866
EST435       178855     105573289
EST436       197595     116862339
EST437       134477     63096462
EST438       110830     60475088
EST439       163287     109043698
EST44        95475      48218258
EST440       182140     116752022
EST441       106403     84554937
EST442       177181     139826371
EST443       150386     90557227
EST444       53982      34345685
EST445       166520     107182981
EST446       178543     101235231
EST447       42175      24141500
EST448       195798     106768392
EST449       185317     95089728
EST45        121121     52335541
EST450       50433      37888207
EST451       189934     115836172
EST452       180026     118008074
EST453       54535      33956141
EST454       196677     133946397
EST455       218252     122876729
EST456       191464     127720063
EST457       184004     144689626
EST458       204243     156003038
EST459       192710     115536227
EST46        55810      33167886
EST460       161445     96690107
EST461       181214     94252913
EST462       6221       516980
EST463       53496      4381716
EST464       158232     12239421
EST465       144975     12987161
EST466       148608     30079541
EST467       149063     29643665
EST468       7062       1471579
EST469       148744     30417064
EST47        177065     89170482
EST470       141747     81732604
EST471       172605     100989345
EST472       161454     110702014
EST473       17171      12297887
EST474       160968     92911974
EST475       150622     104098642
EST476       133699     93222175
EST477       141789     98123728
EST478       16074      8261534
EST479       157380     103682725
EST48        158217     65104402
EST480       146153     105108584
EST481       162018     97570478
EST482       165903     51037876
EST483       12066      1897051
EST484       160514     40367423
EST485       151959     102983137
EST486       149514     98087391
EST487       170921     111823466
EST488       17752      9919193
EST489       132815     75920561
EST49        162351     92228248
EST490       189716     107933724
EST491       149564     109198403
EST492       53155      36073998
EST493       126855     87064282
EST494       145706     90285405
EST495       148633     89486113
EST496       163483     89071242
EST497       35262      17964086
EST498       151814     92135788
EST499       156231     92108182
EST5         162094     62614875
EST50        154204     80121131
EST500       168657     102137390
EST501       136319     85561957
EST502       15306      8512587
EST503       100274     71184924
EST504       78633      60626261
EST505       97623      64860807
EST506       143664     80553208
EST507       36770      20999127
EST508       120992     73607850
EST509       133540     87501363
EST51        156506     74874317
EST510       135574     79506177
EST511       152825     93053797
EST512       44831      24810594
EST513       155676     85797389
EST514       184807     110595728
EST515       121358     79430510
EST516       178199     94655647
EST517       4663       1735339
EST518       52576      18674859
EST519       183577     101191900
EST52        108103     61120240
EST520       152041     81311362
EST521       22152      13410986
EST522       162316     94446797
EST523       211757     123975299
EST524       29664      19024876
EST525       147952     99622109
EST526       158950     98067836
EST527       134310     87388255
EST528       129803     88585688
EST529       24481      15268552
EST53        153908     88947693
EST530       179560     74468277
EST531       179108     79600547
EST532       198743     83525940
EST533       194839     80488133
EST534       3337       1165940
EST535       178841     95307232
EST536       174444     102485197
EST537       180225     107869574
EST538       171856     103650134
EST539       192659     130324466
EST54        154293     84993684
EST540       184929     95563013
EST541       178263     82146788
EST542       119214     81215983
EST543       206771     125126638
EST544       205624     126733200
EST545       193601     113613032
EST546       193784     111741497
EST547       154091     96436815
EST548       187948     117407713
EST549       166670     98999925
EST55        152223     92300142
EST550       133843     98243253
EST551       8876       7222302
EST552       157285     92184364
EST553       170556     85010427
EST554       149108     85057667
EST555       151169     81944839
EST556       11778      7034421
EST557       156517     79983850
EST558       181361     106397624
EST559       162545     103085348
EST56        149911     69862704
EST560       175369     108186389
EST561       3227       2163095
EST562       170744     117107232
EST563       183920     113640835
EST564       129040     83662465
EST565       169422     97775191
EST566       184311     110391842
EST567       33748      22025698
EST568       204465     119127975
EST569       269542     91763948
EST57        142238     76745964
EST570       25664      9425377
EST571       262943     83717893
EST572       157489     57559627
EST573       162302     59144545
EST574       80395      30734692
EST58        151729     83212808
EST59        161295     65822492
EST6         166275     65040988
EST60        144394     70073562
EST61        160487     90001957
EST62        150491     92643807
EST63        150082     99330151
EST64        157768     94520372
EST65        2311       971717
EST66        154938     103546856
EST67        163153     82990748
EST68        166587     84960637
EST69        141965     77593212
EST7         163866     67745545
EST70        148484     82581560
EST71        149150     86200917
EST72        148767     92333130
EST73        150780     87650245
EST74        2429       1419326
EST75        29919      18235506
EST76        186810     102879363
EST77        170381     90703955
EST78        212600     115719905
EST79        179405     103336400
EST8         160923     67795425
EST80        2149       1460388
EST81        196745     121640362
EST82        167598     93368851
EST83        136170     63353526
EST84        128101     62642854
EST85        10941      5602960
EST86        150434     92651323
EST87        154703     97020497
EST88        130185     66307353
EST89        140133     89266942
EST9         169422     69381975
EST90        14406      7473700
EST91        183875     92118813
EST92        204513     119858415
EST93        201907     107931576
EST94        191732     90226571
EST95        204075     87104446
EST96        145905     86978261
EST97        137870     84930613
EST98        158565     76398614
EST99        9280       6073374
GSS1         172838     126579453
GSS10        14938      14424977
GSS100       169816     144809782
GSS101       157708     108873956
GSS102       155981     106353565
GSS103       151962     105164344
GSS104       168005     122783070
GSS105       149829     126592844
GSS106       162068     125197053
GSS107       186640     116036674
GSS108       16014      9794559
GSS109       185786     119804494
GSS11        147201     107527418
GSS110       201450     104020421
GSS111       219926     124042541
GSS112       87280      56947051
GSS113       152300     114320098
GSS114       155174     118808877
GSS115       155139     118868834
GSS116       163490     106671356
GSS117       36986      21467879
GSS118       179848     132289982
GSS119       189894     117148040
GSS12        200919     103951985
GSS120       166036     55080797
GSS121       170071     76702837
GSS122       2028       1303403
GSS123       161778     105245778
GSS124       189210     124956394
GSS125       200987     81591982
GSS126       166850     79919427
GSS127       137307     94457298
GSS128       129872     104613764
GSS129       132040     108783227
GSS13        191985     84604372
GSS130       132451     106046726
GSS131       8003       5920029
GSS132       135214     112032054
GSS133       56598      47104660
GSS134       132584     107786768
GSS135       139149     116140565
GSS136       140043     114408742
GSS137       138251     109584898
GSS138       4155       2820771
GSS139       134784     106426486
GSS14        172551     88949444
GSS140       134049     108003847
GSS141       134400     111531585
GSS142       138188     116474348
GSS143       4675       3643453
GSS144       139468     108106612
GSS145       136810     113648547
GSS146       136898     113473892
GSS147       137299     112649085
GSS148       559        466085
GSS149       137155     110923756
GSS15        167893     83900319
GSS150       134480     106278327
GSS151       133002     107665198
GSS152       138659     116136290
GSS153       1985       1674795
GSS154       127182     92203837
GSS155       174275     105162567
GSS156       184915     110237841
GSS157       162344     108754861
GSS158       176892     102083573
GSS159       197974     129974803
GSS16        160068     81602385
GSS160       201504     133307510
GSS161       200662     134124471
GSS162       178528     124800343
GSS163       198341     136948587
GSS164       196713     139067120
GSS165       196065     138672070
GSS166       174298     134353538
GSS167       144791     97546246
GSS168       138200     80523134
GSS169       165330     73398615
GSS17        156158     85669955
GSS170       129814     57820242
GSS171       163014     141019316
GSS172       170950     113527672
GSS173       80812      52920567
GSS174       191881     129015715
GSS175       196554     117983862
GSS176       28456      14940540
GSS177       180225     98140530
GSS178       181302     123365801
GSS179       178800     126906476
GSS18        153079     95724063
GSS180       181098     127179984
GSS181       19114      12799890
GSS182       165902     130533276
GSS183       170977     155597399
GSS184       219919     123799690
GSS185       216581     103401654
GSS186       17290      8049466
GSS187       210015     95106166
GSS188       156579     134385514
GSS189       6807       6749646
GSS19        153777     72780066
GSS190       125540     102753347
GSS191       122235     93469471
GSS192       156847     154495780
GSS193       167720     158232911
GSS194       131396     104305071
GSS195       146409     106045244
GSS196       171951     142160534
GSS197       176113     118230948
GSS198       1822       1024249
GSS199       181316     133971324
GSS2         173589     107819426
GSS20        106476     59071274
GSS200       184911     120117379
GSS201       180126     93029105
GSS202       172829     121726073
GSS203       189216     117024741
GSS204       189414     116726891
GSS205       21729      12651457
GSS206       200615     129990067
GSS207       215712     142629172
GSS208       217635     140382802
GSS209       166429     136402995
GSS21        132536     64638951
GSS210       152471     108703336
GSS211       160065     120654204
GSS212       160039     145460383
GSS213       158365     140331734
GSS214       160859     145750229
GSS215       162431     144534355
GSS216       163049     142910892
GSS217       159417     122903915
GSS218       168345     139695448
GSS219       161743     115993986
GSS22        125191     56725897
GSS220       180530     88689585
GSS221       2575       1768585
GSS222       251369     52150506
GSS223       262481     40466091
GSS224       262523     40408947
GSS225       122800     38229504
GSS226       253355     52912344
GSS227       182565     86129448
GSS228       189053     56109501
GSS229       154111     118306719
GSS23        134196     73094577
GSS230       177033     144334259
GSS231       160568     145787944
GSS232       159531     147010793
GSS233       174549     109955224
GSS234       238210     57319690
GSS235       198151     101373468
GSS236       229425     39759432
GSS237       119092     74589582
GSS238       174037     112053848
GSS239       147876     90054034
GSS24        143035     74371292
GSS240       140667     84084607
GSS241       159799     149653479
GSS242       5867       4995483
GSS243       112668     95722541
GSS244       180351     149222837
GSS245       172952     122406011
GSS246       201906     127716686
GSS247       188212     120277412
GSS248       166175     94403497
GSS249       159875     84508026
GSS25        12092      5172754
GSS250       156434     119873333
GSS251       203514     148104231
GSS252       14295      9396358
GSS253       171523     67875770
GSS254       176683     96454754
GSS255       195475     152072364
GSS256       199776     154504000
GSS257       7495       6183699
GSS258       197814     157230621
GSS259       197524     124135449
GSS26        140902     65659537
GSS260       194877     142594284
GSS261       692        477602
GSS262       214689     131396752
GSS263       189975     57643041
GSS264       218563     111965788
GSS265       170728     153965245
GSS266       163848     150141940
GSS267       234900     132469628
GSS268       220564     118386800
GSS27        159866     79842837
GSS28        156781     92819331
GSS29        165485     85429158
GSS3         138092     115755431
GSS30        9306       4806100
GSS31        171978     102877480
GSS32        182794     109078835
GSS33        182359     87084166
GSS34        172891     102147817
GSS35        191042     104301903
GSS36        162180     112295088
GSS37        160408     98256513
GSS38        173347     108754664
GSS39        3661       2627008
GSS4         140177     112446622
GSS40        183985     122974505
GSS41        181701     117299100
GSS42        52326      27358639
GSS43        177832     102911728
GSS44        164530     141989063
GSS45        179635     148565674
GSS46        139660     92477151
GSS47        182857     132009511
GSS48        181606     114545298
GSS49        204426     116967806
GSS5         11594      8658736
GSS50        185610     99476531
GSS51        211954     108037045
GSS52        211747     108318359
GSS53        197315     132797049
GSS54        158211     124808059
GSS55        185589     139410158
GSS56        196775     63134337
GSS57        171826     96464104
GSS58        157611     106106204
GSS59        23373      13575160
GSS6         152749     116375726
GSS60        166616     156645100
GSS61        177157     98801574
GSS62        161196     115202462
GSS63        172331     112351434
GSS64        173858     117792409
GSS65        184258     127655843
GSS66        205711     128748730
GSS67        189998     113287440
GSS68        200558     134122723
GSS69        215694     158345734
GSS7         170895     120028346
GSS70        189083     138049901
GSS71        173833     107710090
GSS72        198219     111980277
GSS73        140725     76414851
GSS74        163079     95884017
GSS75        10697      6814502
GSS76        159270     97756741
GSS77        159481     96970229
GSS78        172285     114351414
GSS79        170749     109399099
GSS8         177170     108970773
GSS80        174370     122402741
GSS81        188943     105261510
GSS82        174817     125816253
GSS83        164286     106564743
GSS84        1705       1353768
GSS85        189622     108717597
GSS86        182037     114287769
GSS87        167147     118346472
GSS88        193343     106201902
GSS89        7220       4213495
GSS9         141897     118707319
GSS90        213933     107583686
GSS91        227285     89235627
GSS92        213465     139505605
GSS93        182539     91847418
GSS94        94686      37020965
GSS95        193805     75823638
GSS96        201086     123394316
GSS97        191020     122180795
GSS98        156116     139401502
GSS99        16660      10968419
HTC1         41206      63404125
HTC2         32318      72275691
HTC3         32080      77890442
HTC4         84836      50647832
HTC5         129901     161568308
HTC6         124887     122728899
HTC7         137621     130765671
HTC8         60197      51682008
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2973       383248998
HTG6         2          386956
HTG60        884        128257683
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3185       360470245
HTG68        3130       368040867
HTG69        2902       377609797
HTG7         2327       375791086
HTG70        1752       297182063
HTG71        3421       365667463
HTG72        2072       381392462
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3219       384192102
HTG8         1500       384347777
HTG80        2166       384708164
HTG81        3033       373087380
HTG82        1904       199698644
HTG9         1582       384062276
INV1         153864     141456080
INV10        14         359428768
INV100       8703       318931871
INV101       11576      311655545
INV102       22776      79301283
INV103       149403     105053640
INV104       152943     93768477
INV105       75654      43937885
INV106       151582     93372970
INV107       151243     110478242
INV108       149603     118497687
INV109       154720     125935247
INV11        9          363281720
INV110       63869      94904612
INV12        27131      341021653
INV13        125962     101855599
INV14        167405     134537210
INV15        126653     112181345
INV16        37137      273258075
INV17        131287     159896968
INV18        90004      73812558
INV19        28649      324109174
INV2         2280       314518537
INV20        154153     107721061
INV21        84768      60517853
INV22        150216     105315528
INV23        153237     117799349
INV24        107153     72101846
INV25        155208     113633839
INV26        153761     120493540
INV27        52704      35275666
INV28        153117     109603396
INV29        153516     115676171
INV3         105132     182288138
INV30        36723      31695436
INV31        141610     88532770
INV32        147910     93716965
INV33        43507      33242216
INV34        148287     97323227
INV35        139052     81425527
INV36        42904      25435979
INV37        138567     82657693
INV38        138193     82834915
INV39        53246      35208553
INV4         58911      272141010
INV40        139137     83454061
INV41        135597     99123936
INV42        74368      58229186
INV43        142573     107958241
INV44        151985     119778695
INV45        155943     119818650
INV46        76346      206377559
INV47        183035     236941459
INV48        216228     165877386
INV49        66054      339488108
INV5         37212      48804599
INV50        30352      363964065
INV51        24001      372090429
INV52        22188      347402917
INV53        24617      374358762
INV54        98123      315324261
INV55        19757      20413487
INV56        54375      346420570
INV57        40315      355247607
INV58        9775       375554263
INV59        54200      336713863
INV6         129146     165852724
INV60        126332     250445286
INV61        149595     265837981
INV62        51959      327799930
INV63        110432     292880884
INV64        93751      298235756
INV65        7440       6719691
INV66        50004      352106535
INV67        19823      371237450
INV68        52931      337555420
INV69        37774      214361374
INV7         207        346774014
INV70        37835      354517560
INV71        31063      366245400
INV72        58963      338625343
INV73        47922      346766546
INV74        76866      217282116
INV75        133926     283347957
INV76        44092      350497303
INV77        35225      341546118
INV78        54972      150907332
INV79        59265      344979298
INV8         85         322154899
INV80        29057      351644151
INV81        8875       349247071
INV82        2245       353769146
INV83        4313       352871512
INV84        19704      235612271
INV85        103119     302684241
INV86        18600      28779918
INV87        179307     230774152
INV88        30523      331670159
INV89        13619      93305623
INV9         3          136766944
INV90        68041      305365919
INV91        123287     266863020
INV92        64375      76908791
INV93        180571     237306452
INV94        41592      302761184
INV95        300        394014028
INV96        1009       189187131
INV97        103        379133813
INV98        750        301698537
INV99        1690       383306851
MAM1         34490      321314347
MAM10        3          325384739
MAM11        1          90795278
MAM12        4          322903327
MAM13        4          298795355
MAM14        6          353843759
MAM15        5          329700903
MAM16        2          289079565
MAM17        3          348530310
MAM18        4          336581445
MAM19        5          375256260
MAM2         21044      32455026
MAM20        6          373952570
MAM21        8          377813420
MAM22        10         189786622
MAM23        54         7614329
MAM24        215        34073042
MAM25        431        71272130
MAM26        861        68509101
MAM27        1706       2411269
MAM28        6836       6159435
MAM29        110526     193401624
MAM3         26813      24993452
MAM30        146723     135856849
MAM31        118555     168216687
MAM32        73039      264523405
MAM33        15485      22725143
MAM4         13731      20581276
MAM5         3445       7368868
MAM6         107        699953
MAM7         20         277696380
MAM8         1          249270926
MAM9         2          343930246
PAT1         420100     157390049
PAT10        304138     130867531
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185611     168252742
PAT109       194883     145515917
PAT11        235983     217045687
PAT110       97904      55961896
PAT111       244010     110313663
PAT112       143108     226392216
PAT113       78455      27179427
PAT114       88298      271849570
PAT115       224917     124892818
PAT116       225549     104937982
PAT117       1384       4376046
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83498      75717880
PAT120       94887      123404429
PAT121       98575      119757116
PAT122       81936      115813086
PAT123       203243     107718932
PAT124       26007      9048673
PAT125       203754     100553637
PAT126       183515     80730519
PAT127       117380     19495889
PAT128       249677     208804669
PAT129       386270     114660013
PAT13        242995     211972296
PAT130       52282      7525111
PAT131       284011     180150443
PAT132       123568     298398956
PAT133       110160     303174222
PAT134       393191     122433299
PAT135       291032     159029607
PAT136       12278      8263722
PAT137       287143     182661675
PAT138       409358     14024130
PAT139       496818     33315474
PAT14        328680     148259781
PAT140       525210     7878150
PAT141       153452     3896483
PAT142       377433     123822899
PAT143       245689     106280372
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140528     153756176
PAT149       6430       91690961
PAT15        63325      1583125
PAT150       177885     181303248
PAT151       71549      185117590
PAT152       75797      115785873
PAT153       75754      115777597
PAT154       46228      38672101
PAT155       245596     68644699
PAT156       201617     63079802
PAT157       264584     57807733
PAT158       309605     83974607
PAT159       458692     54677161
PAT16        197504     165335263
PAT160       227775     118065838
PAT161       360580     132770300
PAT162       287954     50157868
PAT163       153957     4619388
PAT164       229300     77216284
PAT165       228264     72764380
PAT166       281031     19059514
PAT167       63876      6659969
PAT168       153386     170244271
PAT169       73419      134972964
PAT17        217933     141818991
PAT170       74138      123434478
PAT171       137245     84262620
PAT172       175172     2627580
PAT173       234159     99508566
PAT174       174735     122999658
PAT175       77321      116291599
PAT176       252074     58242382
PAT177       294823     4422345
PAT178       23357      350355
PAT179       278538     10765362
PAT18        217697     104541351
PAT180       99592      135918967
PAT181       220914     105893965
PAT182       23911      35257067
PAT183       144001     206631238
PAT184       173336     186681447
PAT185       70092      243273682
PAT186       6526       8851302
PAT187       137168     133366031
PAT188       136602     204925855
PAT189       230452     117366118
PAT19        238917     105580979
PAT190       130920     80187578
PAT191       268658     230373189
PAT192       282624     222310160
PAT193       192664     139614235
PAT194       276098     235021090
PAT195       188385     291326630
PAT196       137484     196232251
PAT197       247191     246690030
PAT198       11728      387687504
PAT199       368249     180738792
PAT2         329721     203005132
PAT20        217554     131791854
PAT200       365736     155416895
PAT201       140016     45186949
PAT21        297657     56069780
PAT22        144750     92176141
PAT23        196060     155924286
PAT24        282758     74820945
PAT25        225471     151042311
PAT26        211290     135894183
PAT27        60374      52824381
PAT28        304664     206981310
PAT29        321053     202865066
PAT3         50116      20254906
PAT30        69599      127456494
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255802     169074296
PAT34        232595     137945215
PAT35        62038      29214913
PAT36        159617     193124839
PAT37        187242     152015394
PAT38        213077     134531422
PAT39        96793      9793208
PAT4         329665     180394702
PAT40        350808     21634684
PAT41        267992     107287746
PAT42        168        393677758
PAT43        14062      377884877
PAT44        84773      5054855
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188209     183534698
PAT48        31086      33386746
PAT49        100028     274298882
PAT5         262318     200084234
PAT50        347923     22043500
PAT51        356635     6776065
PAT52        92415      1755885
PAT53        351490     15876307
PAT54        360979     6858601
PAT55        133549     2537431
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217102     164392940
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481513     50384338
PAT63        225625     89296787
PAT64        255084     194810970
PAT65        328513     204100923
PAT66        171057     140486138
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247455     122528556
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224378     103187726
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        488743     57546523
PAT84        319875     49164952
PAT85        461168     84798850
PAT86        153286     113720777
PAT87        167292     186488595
PAT88        316771     151076185
PAT89        223928     179964193
PAT9         153185     77970330
PAT90        160481     39729025
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509422     32511534
PAT94        211221     45759082
PAT95        257695     203243540
PAT96        388347     141459376
PAT97        39406      44066854
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8945       216024186
PHG2         4432       220766838
PHG3         5505       215476270
PHG4         613        6122462
PLN1         135319     172390342
PLN10        18921      157294990
PLN100       147061     135205336
PLN101       121397     151889132
PLN102       167640     121556547
PLN103       113642     118669868
PLN104       133895     150536111
PLN105       101459     119668473
PLN106       136096     150119942
PLN107       126774     163408827
PLN108       120692     166329054
PLN109       18149      16501799
PLN11        29377      278503063
PLN110       124555     164318905
PLN111       113803     171906461
PLN112       79761      143442697
PLN113       119060     172564107
PLN114       84513      198933706
PLN115       4482       367560444
PLN116       18832      67560003
PLN117       17629      361554327
PLN118       11440      345701890
PLN119       389        358504044
PLN12        2638       333550451
PLN120       297        109148237
PLN121       5          324373291
PLN122       2315       362464345
PLN123       1          558535432
PLN124       1          768075024
PLN125       1          699711114
PLN126       1          647060158
PLN127       1          670030160
PLN128       1          583380513
PLN129       1          657224000
PLN13        34         326120762
PLN130       196        368268213
PLN131       16         384720807
PLN132       17151      301172115
PLN133       5636       1862075
PLN134       5217       2473234
PLN135       1          563502314
PLN136       1730       4408124
PLN137       1          594102056
PLN138       1          689851870
PLN139       1          495453186
PLN14        51         343512393
PLN140       1          780798557
PLN141       1          801256715
PLN142       1          651852609
PLN143       1          750843639
PLN144       1          830829764
PLN145       1          615552423
PLN146       1          744588157
PLN147       1          673617499
PLN148       1          509857067
PLN149       1          709773743
PLN15        2329       361712867
PLN150       1          713149757
PLN151       1          566080677
PLN152       1          618079260
PLN153       1          720988478
PLN154       1          473592718
PLN155       1          736706236
PLN156       1          750620385
PLN157       1          638686055
PLN158       1          480980714
PLN159       6626       314516856
PLN16        21214      148223001
PLN160       3760       370633860
PLN161       10097      328242863
PLN162       1716       10541394
PLN163       1          585266722
PLN164       1          681112512
PLN165       1          775448786
PLN166       1          790338525
PLN167       1          746673839
PLN168       1          836514780
PLN169       1          736872137
PLN17        96549      101321038
PLN170       1          676292951
PLN171       1          669155517
PLN172       1          701372996
PLN173       1          615672275
PLN174       1          698614761
PLN175       1          728031845
PLN176       1          722970987
PLN177       12266      8463745
PLN178       93502      138424985
PLN179       108638     175517967
PLN18        113216     117350065
PLN180       83914      209982900
PLN181       59816      141787394
PLN182       103027     185878237
PLN183       106136     183188984
PLN184       108084     184669807
PLN185       111979     180899371
PLN186       4596       9560273
PLN19        57311      72144580
PLN2         39073      283689716
PLN20        28689      28922869
PLN21        2648       194594881
PLN22        344        254550430
PLN23        400        261235914
PLN24        198        168828441
PLN25        298        258873545
PLN26        339        265493888
PLN27        485        350911896
PLN28        112        80604200
PLN29        455        379563194
PLN3         3695       380495613
PLN30        127        379253996
PLN31        91         241350431
PLN32        107        353068716
PLN33        21         391404607
PLN34        229        244592824
PLN35        149        350028887
PLN36        15         388403916
PLN37        22         360710420
PLN38        6          376299569
PLN39        1          65870126
PLN4         3520       387732311
PLN40        93         388494695
PLN41        15         373888800
PLN42        9          363551984
PLN43        60         374148929
PLN44        14         212654302
PLN45        74         124609184
PLN46        8          358353307
PLN47        3          347496433
PLN48        4          370651368
PLN49        2          271593360
PLN5         97691      198340175
PLN50        1          150766190
PLN51        2          288204953
PLN52        2          286787940
PLN53        2          295931502
PLN54        41         379963265
PLN55        7          322635309
PLN56        7          376229618
PLN57        6          342806685
PLN58        6          347730275
PLN59        6          350661716
PLN6         111715     128125956
PLN60        43         144640005
PLN61        137        350970913
PLN62        7          307636488
PLN63        6          336202993
PLN64        46         343091455
PLN65        21         335499399
PLN66        111        136828920
PLN67        37         16871
PLN68        149        79314
PLN69        2469       93786416
PLN7         64096      185002034
PLN70        7181       18795412
PLN71        14346      29953091
PLN72        97915      209491614
PLN73        129220     89911223
PLN74        159247     148600341
PLN75        162880     146897411
PLN76        57216      30703670
PLN77        181645     125942251
PLN78        49809      255467825
PLN79        41702      287594351
PLN8         21745      106564214
PLN80        71192      107438713
PLN81        98509      85384423
PLN82        49500      72635051
PLN83        25061      110565816
PLN84        13561      89764040
PLN85        1          774434471
PLN86        8305       28494037
PLN87        1861       361385154
PLN88        5          372618381
PLN89        6          372447772
PLN9         35233      291274408
PLN90        6          368295254
PLN91        12433      261969826
PLN92        175780     124254838
PLN93        22795      15553815
PLN94        148717     156467809
PLN95        149874     145552105
PLN96        85421      71134691
PLN97        154197     132601433
PLN98        164373     118655663
PLN99        22203      25383328
PRI1         23034      59762327
PRI10        2265       387936439
PRI11        4375       381729455
PRI12        2069       191983096
PRI13        2459       391020768
PRI14        16114      79472516
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23835      319333697
PRI20        59152      259982661
PRI21        3806       7249854
PRI22        53142      193855733
PRI23        87999      233146434
PRI24        90506      166078696
PRI25        74324      199940085
PRI26        54429      215566213
PRI27        34622      144332518
PRI28        69686      214228122
PRI29        89326      151591136
PRI3         2613       370370379
PRI30        1          229594237
PRI31        1          190673448
PRI32        9649       358440423
PRI33        50355      209611440
PRI34        70846      106182705
PRI4         2409       360399901
PRI5         2593       353874487
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38423      309721413
ROD10        15424      351655971
ROD11        948        1187909
ROD12        22214      347968493
ROD13        1002       157743814
ROD14        53466      238707384
ROD15        21658      310382782
ROD16        228375     97441721
ROD17        155357     121611805
ROD18        35445      36986840
ROD2         1810       346957759
ROD3         1885       352024250
ROD4         1943       360884621
ROD5         1990       363733749
ROD6         306        57843793
ROD7         1975       368354297
ROD8         1990       369693686
ROD9         1959       368016559
STS1         170595     86876605
STS10        202217     61356397
STS11        167008     59456917
STS2         143470     63350935
STS3         8190       4809522
STS4         108725     63673512
STS5         110379     70040590
STS6         106166     81423611
STS7         122521     86625645
STS8         198745     60874554
STS9         8950       2430284
SYN1         54438      100569347
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        550        392407673
SYN23        65800      184887948
SYN24        9183       352928592
SYN25        17246      334467878
SYN26        109132     160433300
SYN27        24351      74562953
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233380     79653983
TSA10        155900     159219814
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       156762     150055175
TSA109       183850     102660564
TSA11        161235     134468030
TSA110       46133      105547678
TSA111       136931     166476864
TSA112       166663     125028887
TSA113       97439      238063556
TSA114       99621      234258577
TSA115       12096      5797980
TSA116       134299     172499287
TSA117       127822     180391048
TSA118       129653     177320123
TSA119       120977     167690794
TSA12        65188      48720110
TSA120       161752     123773928
TSA121       122463     187577773
TSA122       148092     145309800
TSA123       94145      61033986
TSA124       136345     168539405
TSA125       159333     125157880
TSA126       156667     125822948
TSA127       123052     121148961
TSA13        144445     166877725
TSA14        183430     128404479
TSA15        63704      19333264
TSA16        207559     109270376
TSA17        186915     104023410
TSA18        49380      65170400
TSA19        154786     149639718
TSA2         222501     88764704
TSA20        217000     100217335
TSA21        205868     104176652
TSA22        22636      12494410
TSA23        159463     127641062
TSA24        173240     148979716
TSA25        215107     83751466
TSA26        105264     74950797
TSA27        172910     71716168
TSA28        221930     89798997
TSA29        26888      19147632
TSA3         74593      22546411
TSA30        206110     106021139
TSA31        179811     146674399
TSA32        67801      29056436
TSA33        188743     126584843
TSA34        147134     171674811
TSA35        163216     142606986
TSA36        149293     161200389
TSA37        167355     152088001
TSA38        141407     134166635
TSA39        170803     157995856
TSA4         200107     117397278
TSA40        68091      94849454
TSA41        171892     122248327
TSA42        190161     129023053
TSA43        179527     129657126
TSA44        74666      42475669
TSA45        179837     148961559
TSA46        157618     110427650
TSA47        134614     95382384
TSA48        185173     132793697
TSA49        208467     104145310
TSA5         215390     134315100
TSA50        79060      109863998
TSA51        193451     109714322
TSA52        179795     119290087
TSA53        111831     116819755
TSA54        155188     135994981
TSA55        161488     91817715
TSA56        130888     143857547
TSA57        137093     81293196
TSA58        155281     162331143
TSA59        162871     156980202
TSA6         15756      19456676
TSA60        194209     122378904
TSA61        57557      94587557
TSA62        173905     118336916
TSA63        151865     162169607
TSA64        60980      124236262
TSA65        201109     152115772
TSA66        185638     143700395
TSA67        163479     121752466
TSA68        182133     137371012
TSA69        170697     97722816
TSA7         194553     54897033
TSA70        40596      38103163
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        152989     102336522
TSA76        156503     143538644
TSA77        40595      33645981
TSA78        177556     139010934
TSA79        162022     159228390
TSA8         158334     121004747
TSA80        10510      8595284
TSA81        185669     115791752
TSA82        143419     147913350
TSA83        177759     145455461
TSA84        159235     177039745
TSA85        17013      11869134
TSA86        168307     128893220
TSA87        156344     150391937
TSA88        195418     125564755
TSA89        31945      22564229
TSA9         98089      68621619
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141044     144633048
TSA97        106079     76616395
TSA98        74427      65411867
TSA99        33717      32835466
UNA1         543        548041
VRL1         133598     139612409
VRL10        121768     139949199
VRL11        49034      61695894
VRL12        114833     145923174
VRL13        113548     148422448
VRL14        24611      42781916
VRL15        91386      159471802
VRL16        98027      150777754
VRL17        59013      97773245
VRL18        93192      166877769
VRL19        91511      165037102
VRL2         128505     151457430
VRL20        52704      118863831
VRL21        83655      173675395
VRL22        87138      167871704
VRL23        67449      116975049
VRL24        83355      168592023
VRL25        83749      168359984
VRL26        47739      106342115
VRL27        91499      184162372
VRL28        77995      187743605
VRL29        44716      114493908
VRL3         96473      101457894
VRL30        67681      184026633
VRL31        74959      190839147
VRL32        79652      185227192
VRL33        80987      178790606
VRL34        70332      108772370
VRL4         95794      150913808
VRL5         88097      145947713
VRL6         96117      145822443
VRL7         132187     142082297
VRL8         63487      83263291
VRL9         122028     145469968
VRT1         69911      272780605
VRT10        1171       26255719
VRT100       1          46063367
VRT101       7          344525641
VRT102       6          384186008
VRT103       8          388949147
VRT104       10         334173277
VRT105       1          221441380
VRT106       3          375404155
VRT107       10         379167312
VRT108       34         391313315
VRT109       5          50284038
VRT11        293        13983146
VRT110       1          772932187
VRT111       1          662004353
VRT112       1          535506559
VRT113       1          376147139
VRT114       1          364230008
VRT115       1          346409914
VRT116       1          311292523
VRT117       1          247732340
VRT118       1          228143320
VRT119       1          221182781
VRT12        37         392789976
VRT120       2          321892640
VRT121       7          332091804
VRT122       12         378048109
VRT123       9          378909870
VRT124       6          345737823
VRT125       2          137693511
VRT126       7          385107928
VRT127       8          360581972
VRT128       10         364952837
VRT129       4          133261911
VRT13        13         392458500
VRT130       8          359905961
VRT131       5          370674748
VRT132       9          378247816
VRT133       6          166907986
VRT134       14         379842153
VRT135       15         375595384
VRT136       6          361061951
VRT137       6          386251232
VRT138       4          214663249
VRT139       7          382238010
VRT14        12         379958897
VRT140       8          393739201
VRT141       11         393242895
VRT142       4          225988804
VRT143       11         366984719
VRT144       1          550518975
VRT145       1          529596002
VRT146       1          413748038
VRT147       1          326378286
VRT148       1          272612222
VRT149       1          260396842
VRT15        11         316368323
VRT150       1          197956435
VRT151       2          384149701
VRT152       2          288058306
VRT153       4          353983664
VRT154       314        371742678
VRT155       2          310725315
VRT156       2          280326572
VRT157       3          371471404
VRT158       3          354148189
VRT159       3          303679844
VRT16        13         385338369
VRT160       4          341249946
VRT161       4308       367214105
VRT162       18         375189213
VRT163       15965      44589808
VRT164       139822     131103524
VRT165       119025     103931143
VRT17        14         372163844
VRT18        14         352781625
VRT19        19         384683297
VRT2         72836      271705911
VRT20        16         379729070
VRT21        16         381718727
VRT22        2          51507477
VRT23        27         3633251
VRT24        147        10842596
VRT25        586        15797052
VRT26        2343       67436863
VRT27        19198      357652178
VRT28        54165      304746470
VRT29        158711     137275747
VRT3         39409      105465132
VRT30        17784      13202577
VRT31        117701     200752218
VRT32        158145     126715606
VRT33        119463     84060521
VRT34        185772     123658022
VRT35        146927     104401185
VRT36        168367     113580744
VRT37        8106       6860184
VRT38        132916     105546634
VRT39        157597     117919603
VRT4         74944      70627326
VRT40        137872     84789561
VRT41        188429     120021770
VRT42        102677     60912729
VRT43        158028     118963919
VRT44        136904     162957650
VRT45        140        387089355
VRT46        406        389052229
VRT47        2402       382926609
VRT48        92816      193398013
VRT49        145106     21008965
VRT5         37396      74041240
VRT50        75789      25336814
VRT51        13375      365641119
VRT52        20         379347618
VRT53        270        393447049
VRT54        3067       391133617
VRT55        3471       230588304
VRT56        6442       378554759
VRT57        16         388667304
VRT58        16         378559418
VRT59        12         379509384
VRT6         18698      27611025
VRT60        7          285874095
VRT61        12         387522266
VRT62        18         375242791
VRT63        16         386329687
VRT64        180        277847814
VRT65        17         367327734
VRT66        15         385834222
VRT67        7          149460915
VRT68        1          350098611
VRT69        1          332461053
VRT7         5986       380511905
VRT70        1          309313702
VRT71        1          293870033
VRT72        1          232056431
VRT73        1          209933285
VRT74        1          199226436
VRT75        2          392231039
VRT76        2          338442208
VRT77        2          304508243
VRT78        3          317261932
VRT79        7          378896727
VRT8         3363       217068541
VRT80        11         374771935
VRT81        13         379441801
VRT82        3          70710155
VRT83        16         344076996
VRT84        10         385210617
VRT85        15         392781064
VRT86        22         370094349
VRT87        1          839681426
VRT88        1          825560060
VRT89        1          595904407
VRT9         4685       4674270
VRT90        1          486875112
VRT91        1          387033265
VRT92        1          371528181
VRT93        1          313513962
VRT94        1          277530821
VRT95        1          268302114
VRT96        3          319484498
VRT97        5          386368861
VRT98        7          393936069
VRT99        7          384166854

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 234.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, and
uncultured sequences:

Entries        Bases   Species

27059600 20457397736   Homo sapiens
1939260  17188953032   Triticum aestivum
10019352 10444313769   Mus musculus
22985     9981136426   Triticum turgidum subsp. durum
1347041   8071292412   Hordeum vulgare subsp. vulgare
2200576   6536261865   Rattus norvegicus
2234529   5436477159   Bos taurus
4211898   5250752953   Zea mays
53        5178609725   Rhinatrema bivittatum
132861    5176312766   Escherichia coli
3302915   5077677344   Sus scrofa
15        4548060207   Microcaecilia unicolor
39        3773645297   Geotrypetes seraphini
67        3468702984   Erpetoichthys calabaricus
1729802   3191630433   Danio rerio
2030      2952658050   Bordetella pertussis
1239342   2836990469   Oryzias latipes
311672    2682505913   Arachis hypogaea
72        2590574434   Ovis canadensis canadensis
747665    2573429749   Solanum lycopersicum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (net decrease; Section 1.3.1 of GB 227.0 release notes)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2019

                NCBI-GenBank Flat File Release 234.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Jim Ostell, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Slava Khotomliansky, Igor Lozitskiy, Craig Oakley, Eugene Semenov,
	Ben Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell : Director, NCBI
	Kim Pruitt : Acting Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center