Release Notes For GenBank Release 236

GBREL.TXT          Genetic Sequence Data Bank
                         February 15 2020

               NCBI-GenBank Flat File Release 236.0

                    Distribution Release Notes

  216214215 sequences,  399376854872 bases, for traditional GenBank records
 1627402930 sequences, 7323655233013 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 236.0
1.2 Cutoff Date
1.3 Important Changes in Release 236.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 236.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 236.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 236.0, incorporates data processed by the INSDC databases
as of Saturday February 15 2020 at approximately 1:33AM EST. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 236.0

1.3.1 Organizational changes

  The total number of sequence data files increased by 48 with this release:
  
  - the BCT division is now composed of 418 files (+17)
  - the CON division is now composed of 216 files (+4)
  - the ENV division is now composed of  59 files (+1)
  - the MAM division is now composed of  49 files (+10)
  - the PAT division is now composed of 204 files (+2)
  - the PLN division is now composed of 204 files (+18)
  - the VRL division is now composed of  36 files (+1)
  - the VRT division is now composed of 161 files (-5)

  The decrease for the VRT division is due to the suppression of 40 chromosomal
records for the Coregonus sp. 'balchen' genome, with 2.1Gbp of sequence data.
This organism is already represented by underlying sequence contigs plus
chromosomal CON-division/scaffold records built from those contigs. The 40
suppressed records are redundant with those scaffolds, and their suppression
resulted in fewer VRT-division files. 

1.4 Upcoming Changes

  No changes to the GenBank flatfile format are planned at this time.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 2601 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct42.seq - Bacterial sequence entries, part 42.
357. gbbct43.seq - Bacterial sequence entries, part 43.
358. gbbct44.seq - Bacterial sequence entries, part 44.
359. gbbct45.seq - Bacterial sequence entries, part 45.
360. gbbct46.seq - Bacterial sequence entries, part 46.
361. gbbct47.seq - Bacterial sequence entries, part 47.
362. gbbct48.seq - Bacterial sequence entries, part 48.
363. gbbct49.seq - Bacterial sequence entries, part 49.
364. gbbct5.seq - Bacterial sequence entries, part 5.
365. gbbct50.seq - Bacterial sequence entries, part 50.
366. gbbct51.seq - Bacterial sequence entries, part 51.
367. gbbct52.seq - Bacterial sequence entries, part 52.
368. gbbct53.seq - Bacterial sequence entries, part 53.
369. gbbct54.seq - Bacterial sequence entries, part 54.
370. gbbct55.seq - Bacterial sequence entries, part 55.
371. gbbct56.seq - Bacterial sequence entries, part 56.
372. gbbct57.seq - Bacterial sequence entries, part 57.
373. gbbct58.seq - Bacterial sequence entries, part 58.
374. gbbct59.seq - Bacterial sequence entries, part 59.
375. gbbct6.seq - Bacterial sequence entries, part 6.
376. gbbct60.seq - Bacterial sequence entries, part 60.
377. gbbct61.seq - Bacterial sequence entries, part 61.
378. gbbct62.seq - Bacterial sequence entries, part 62.
379. gbbct63.seq - Bacterial sequence entries, part 63.
380. gbbct64.seq - Bacterial sequence entries, part 64.
381. gbbct65.seq - Bacterial sequence entries, part 65.
382. gbbct66.seq - Bacterial sequence entries, part 66.
383. gbbct67.seq - Bacterial sequence entries, part 67.
384. gbbct68.seq - Bacterial sequence entries, part 68.
385. gbbct69.seq - Bacterial sequence entries, part 69.
386. gbbct7.seq - Bacterial sequence entries, part 7.
387. gbbct70.seq - Bacterial sequence entries, part 70.
388. gbbct71.seq - Bacterial sequence entries, part 71.
389. gbbct72.seq - Bacterial sequence entries, part 72.
390. gbbct73.seq - Bacterial sequence entries, part 73.
391. gbbct74.seq - Bacterial sequence entries, part 74.
392. gbbct75.seq - Bacterial sequence entries, part 75.
393. gbbct76.seq - Bacterial sequence entries, part 76.
394. gbbct77.seq - Bacterial sequence entries, part 77.
395. gbbct78.seq - Bacterial sequence entries, part 78.
396. gbbct79.seq - Bacterial sequence entries, part 79.
397. gbbct8.seq - Bacterial sequence entries, part 8.
398. gbbct80.seq - Bacterial sequence entries, part 80.
399. gbbct81.seq - Bacterial sequence entries, part 81.
400. gbbct82.seq - Bacterial sequence entries, part 82.
401. gbbct83.seq - Bacterial sequence entries, part 83.
402. gbbct84.seq - Bacterial sequence entries, part 84.
403. gbbct85.seq - Bacterial sequence entries, part 85.
404. gbbct86.seq - Bacterial sequence entries, part 86.
405. gbbct87.seq - Bacterial sequence entries, part 87.
406. gbbct88.seq - Bacterial sequence entries, part 88.
407. gbbct89.seq - Bacterial sequence entries, part 89.
408. gbbct9.seq - Bacterial sequence entries, part 9.
409. gbbct90.seq - Bacterial sequence entries, part 90.
410. gbbct91.seq - Bacterial sequence entries, part 91.
411. gbbct92.seq - Bacterial sequence entries, part 92.
412. gbbct93.seq - Bacterial sequence entries, part 93.
413. gbbct94.seq - Bacterial sequence entries, part 94.
414. gbbct95.seq - Bacterial sequence entries, part 95.
415. gbbct96.seq - Bacterial sequence entries, part 96.
416. gbbct97.seq - Bacterial sequence entries, part 97.
417. gbbct98.seq - Bacterial sequence entries, part 98.
418. gbbct99.seq - Bacterial sequence entries, part 99.
419. gbchg.txt - Accession numbers of entries updated since the previous release.
420. gbcon1.seq - Constructed sequence entries, part 1.
421. gbcon10.seq - Constructed sequence entries, part 10.
422. gbcon100.seq - Constructed sequence entries, part 100.
423. gbcon101.seq - Constructed sequence entries, part 101.
424. gbcon102.seq - Constructed sequence entries, part 102.
425. gbcon103.seq - Constructed sequence entries, part 103.
426. gbcon104.seq - Constructed sequence entries, part 104.
427. gbcon105.seq - Constructed sequence entries, part 105.
428. gbcon106.seq - Constructed sequence entries, part 106.
429. gbcon107.seq - Constructed sequence entries, part 107.
430. gbcon108.seq - Constructed sequence entries, part 108.
431. gbcon109.seq - Constructed sequence entries, part 109.
432. gbcon11.seq - Constructed sequence entries, part 11.
433. gbcon110.seq - Constructed sequence entries, part 110.
434. gbcon111.seq - Constructed sequence entries, part 111.
435. gbcon112.seq - Constructed sequence entries, part 112.
436. gbcon113.seq - Constructed sequence entries, part 113.
437. gbcon114.seq - Constructed sequence entries, part 114.
438. gbcon115.seq - Constructed sequence entries, part 115.
439. gbcon116.seq - Constructed sequence entries, part 116.
440. gbcon117.seq - Constructed sequence entries, part 117.
441. gbcon118.seq - Constructed sequence entries, part 118.
442. gbcon119.seq - Constructed sequence entries, part 119.
443. gbcon12.seq - Constructed sequence entries, part 12.
444. gbcon120.seq - Constructed sequence entries, part 120.
445. gbcon121.seq - Constructed sequence entries, part 121.
446. gbcon122.seq - Constructed sequence entries, part 122.
447. gbcon123.seq - Constructed sequence entries, part 123.
448. gbcon124.seq - Constructed sequence entries, part 124.
449. gbcon125.seq - Constructed sequence entries, part 125.
450. gbcon126.seq - Constructed sequence entries, part 126.
451. gbcon127.seq - Constructed sequence entries, part 127.
452. gbcon128.seq - Constructed sequence entries, part 128.
453. gbcon129.seq - Constructed sequence entries, part 129.
454. gbcon13.seq - Constructed sequence entries, part 13.
455. gbcon130.seq - Constructed sequence entries, part 130.
456. gbcon131.seq - Constructed sequence entries, part 131.
457. gbcon132.seq - Constructed sequence entries, part 132.
458. gbcon133.seq - Constructed sequence entries, part 133.
459. gbcon134.seq - Constructed sequence entries, part 134.
460. gbcon135.seq - Constructed sequence entries, part 135.
461. gbcon136.seq - Constructed sequence entries, part 136.
462. gbcon137.seq - Constructed sequence entries, part 137.
463. gbcon138.seq - Constructed sequence entries, part 138.
464. gbcon139.seq - Constructed sequence entries, part 139.
465. gbcon14.seq - Constructed sequence entries, part 14.
466. gbcon140.seq - Constructed sequence entries, part 140.
467. gbcon141.seq - Constructed sequence entries, part 141.
468. gbcon142.seq - Constructed sequence entries, part 142.
469. gbcon143.seq - Constructed sequence entries, part 143.
470. gbcon144.seq - Constructed sequence entries, part 144.
471. gbcon145.seq - Constructed sequence entries, part 145.
472. gbcon146.seq - Constructed sequence entries, part 146.
473. gbcon147.seq - Constructed sequence entries, part 147.
474. gbcon148.seq - Constructed sequence entries, part 148.
475. gbcon149.seq - Constructed sequence entries, part 149.
476. gbcon15.seq - Constructed sequence entries, part 15.
477. gbcon150.seq - Constructed sequence entries, part 150.
478. gbcon151.seq - Constructed sequence entries, part 151.
479. gbcon152.seq - Constructed sequence entries, part 152.
480. gbcon153.seq - Constructed sequence entries, part 153.
481. gbcon154.seq - Constructed sequence entries, part 154.
482. gbcon155.seq - Constructed sequence entries, part 155.
483. gbcon156.seq - Constructed sequence entries, part 156.
484. gbcon157.seq - Constructed sequence entries, part 157.
485. gbcon158.seq - Constructed sequence entries, part 158.
486. gbcon159.seq - Constructed sequence entries, part 159.
487. gbcon16.seq - Constructed sequence entries, part 16.
488. gbcon160.seq - Constructed sequence entries, part 160.
489. gbcon161.seq - Constructed sequence entries, part 161.
490. gbcon162.seq - Constructed sequence entries, part 162.
491. gbcon163.seq - Constructed sequence entries, part 163.
492. gbcon164.seq - Constructed sequence entries, part 164.
493. gbcon165.seq - Constructed sequence entries, part 165.
494. gbcon166.seq - Constructed sequence entries, part 166.
495. gbcon167.seq - Constructed sequence entries, part 167.
496. gbcon168.seq - Constructed sequence entries, part 168.
497. gbcon169.seq - Constructed sequence entries, part 169.
498. gbcon17.seq - Constructed sequence entries, part 17.
499. gbcon170.seq - Constructed sequence entries, part 170.
500. gbcon171.seq - Constructed sequence entries, part 171.
501. gbcon172.seq - Constructed sequence entries, part 172.
502. gbcon173.seq - Constructed sequence entries, part 173.
503. gbcon174.seq - Constructed sequence entries, part 174.
504. gbcon175.seq - Constructed sequence entries, part 175.
505. gbcon176.seq - Constructed sequence entries, part 176.
506. gbcon177.seq - Constructed sequence entries, part 177.
507. gbcon178.seq - Constructed sequence entries, part 178.
508. gbcon179.seq - Constructed sequence entries, part 179.
509. gbcon18.seq - Constructed sequence entries, part 18.
510. gbcon180.seq - Constructed sequence entries, part 180.
511. gbcon181.seq - Constructed sequence entries, part 181.
512. gbcon182.seq - Constructed sequence entries, part 182.
513. gbcon183.seq - Constructed sequence entries, part 183.
514. gbcon184.seq - Constructed sequence entries, part 184.
515. gbcon185.seq - Constructed sequence entries, part 185.
516. gbcon186.seq - Constructed sequence entries, part 186.
517. gbcon187.seq - Constructed sequence entries, part 187.
518. gbcon188.seq - Constructed sequence entries, part 188.
519. gbcon189.seq - Constructed sequence entries, part 189.
520. gbcon19.seq - Constructed sequence entries, part 19.
521. gbcon190.seq - Constructed sequence entries, part 190.
522. gbcon191.seq - Constructed sequence entries, part 191.
523. gbcon192.seq - Constructed sequence entries, part 192.
524. gbcon193.seq - Constructed sequence entries, part 193.
525. gbcon194.seq - Constructed sequence entries, part 194.
526. gbcon195.seq - Constructed sequence entries, part 195.
527. gbcon196.seq - Constructed sequence entries, part 196.
528. gbcon197.seq - Constructed sequence entries, part 197.
529. gbcon198.seq - Constructed sequence entries, part 198.
530. gbcon199.seq - Constructed sequence entries, part 199.
531. gbcon2.seq - Constructed sequence entries, part 2.
532. gbcon20.seq - Constructed sequence entries, part 20.
533. gbcon200.seq - Constructed sequence entries, part 200.
534. gbcon201.seq - Constructed sequence entries, part 201.
535. gbcon202.seq - Constructed sequence entries, part 202.
536. gbcon203.seq - Constructed sequence entries, part 203.
537. gbcon204.seq - Constructed sequence entries, part 204.
538. gbcon205.seq - Constructed sequence entries, part 205.
539. gbcon206.seq - Constructed sequence entries, part 206.
540. gbcon207.seq - Constructed sequence entries, part 207.
541. gbcon208.seq - Constructed sequence entries, part 208.
542. gbcon209.seq - Constructed sequence entries, part 209.
543. gbcon21.seq - Constructed sequence entries, part 21.
544. gbcon210.seq - Constructed sequence entries, part 210.
545. gbcon211.seq - Constructed sequence entries, part 211.
546. gbcon212.seq - Constructed sequence entries, part 212.
547. gbcon213.seq - Constructed sequence entries, part 213.
548. gbcon214.seq - Constructed sequence entries, part 214.
549. gbcon215.seq - Constructed sequence entries, part 215.
550. gbcon216.seq - Constructed sequence entries, part 216.
551. gbcon22.seq - Constructed sequence entries, part 22.
552. gbcon23.seq - Constructed sequence entries, part 23.
553. gbcon24.seq - Constructed sequence entries, part 24.
554. gbcon25.seq - Constructed sequence entries, part 25.
555. gbcon26.seq - Constructed sequence entries, part 26.
556. gbcon27.seq - Constructed sequence entries, part 27.
557. gbcon28.seq - Constructed sequence entries, part 28.
558. gbcon29.seq - Constructed sequence entries, part 29.
559. gbcon3.seq - Constructed sequence entries, part 3.
560. gbcon30.seq - Constructed sequence entries, part 30.
561. gbcon31.seq - Constructed sequence entries, part 31.
562. gbcon32.seq - Constructed sequence entries, part 32.
563. gbcon33.seq - Constructed sequence entries, part 33.
564. gbcon34.seq - Constructed sequence entries, part 34.
565. gbcon35.seq - Constructed sequence entries, part 35.
566. gbcon36.seq - Constructed sequence entries, part 36.
567. gbcon37.seq - Constructed sequence entries, part 37.
568. gbcon38.seq - Constructed sequence entries, part 38.
569. gbcon39.seq - Constructed sequence entries, part 39.
570. gbcon4.seq - Constructed sequence entries, part 4.
571. gbcon40.seq - Constructed sequence entries, part 40.
572. gbcon41.seq - Constructed sequence entries, part 41.
573. gbcon42.seq - Constructed sequence entries, part 42.
574. gbcon43.seq - Constructed sequence entries, part 43.
575. gbcon44.seq - Constructed sequence entries, part 44.
576. gbcon45.seq - Constructed sequence entries, part 45.
577. gbcon46.seq - Constructed sequence entries, part 46.
578. gbcon47.seq - Constructed sequence entries, part 47.
579. gbcon48.seq - Constructed sequence entries, part 48.
580. gbcon49.seq - Constructed sequence entries, part 49.
581. gbcon5.seq - Constructed sequence entries, part 5.
582. gbcon50.seq - Constructed sequence entries, part 50.
583. gbcon51.seq - Constructed sequence entries, part 51.
584. gbcon52.seq - Constructed sequence entries, part 52.
585. gbcon53.seq - Constructed sequence entries, part 53.
586. gbcon54.seq - Constructed sequence entries, part 54.
587. gbcon55.seq - Constructed sequence entries, part 55.
588. gbcon56.seq - Constructed sequence entries, part 56.
589. gbcon57.seq - Constructed sequence entries, part 57.
590. gbcon58.seq - Constructed sequence entries, part 58.
591. gbcon59.seq - Constructed sequence entries, part 59.
592. gbcon6.seq - Constructed sequence entries, part 6.
593. gbcon60.seq - Constructed sequence entries, part 60.
594. gbcon61.seq - Constructed sequence entries, part 61.
595. gbcon62.seq - Constructed sequence entries, part 62.
596. gbcon63.seq - Constructed sequence entries, part 63.
597. gbcon64.seq - Constructed sequence entries, part 64.
598. gbcon65.seq - Constructed sequence entries, part 65.
599. gbcon66.seq - Constructed sequence entries, part 66.
600. gbcon67.seq - Constructed sequence entries, part 67.
601. gbcon68.seq - Constructed sequence entries, part 68.
602. gbcon69.seq - Constructed sequence entries, part 69.
603. gbcon7.seq - Constructed sequence entries, part 7.
604. gbcon70.seq - Constructed sequence entries, part 70.
605. gbcon71.seq - Constructed sequence entries, part 71.
606. gbcon72.seq - Constructed sequence entries, part 72.
607. gbcon73.seq - Constructed sequence entries, part 73.
608. gbcon74.seq - Constructed sequence entries, part 74.
609. gbcon75.seq - Constructed sequence entries, part 75.
610. gbcon76.seq - Constructed sequence entries, part 76.
611. gbcon77.seq - Constructed sequence entries, part 77.
612. gbcon78.seq - Constructed sequence entries, part 78.
613. gbcon79.seq - Constructed sequence entries, part 79.
614. gbcon8.seq - Constructed sequence entries, part 8.
615. gbcon80.seq - Constructed sequence entries, part 80.
616. gbcon81.seq - Constructed sequence entries, part 81.
617. gbcon82.seq - Constructed sequence entries, part 82.
618. gbcon83.seq - Constructed sequence entries, part 83.
619. gbcon84.seq - Constructed sequence entries, part 84.
620. gbcon85.seq - Constructed sequence entries, part 85.
621. gbcon86.seq - Constructed sequence entries, part 86.
622. gbcon87.seq - Constructed sequence entries, part 87.
623. gbcon88.seq - Constructed sequence entries, part 88.
624. gbcon89.seq - Constructed sequence entries, part 89.
625. gbcon9.seq - Constructed sequence entries, part 9.
626. gbcon90.seq - Constructed sequence entries, part 90.
627. gbcon91.seq - Constructed sequence entries, part 91.
628. gbcon92.seq - Constructed sequence entries, part 92.
629. gbcon93.seq - Constructed sequence entries, part 93.
630. gbcon94.seq - Constructed sequence entries, part 94.
631. gbcon95.seq - Constructed sequence entries, part 95.
632. gbcon96.seq - Constructed sequence entries, part 96.
633. gbcon97.seq - Constructed sequence entries, part 97.
634. gbcon98.seq - Constructed sequence entries, part 98.
635. gbcon99.seq - Constructed sequence entries, part 99.
636. gbdel.txt - Accession numbers of entries deleted since the previous release.
637. gbenv1.seq - Environmental sampling sequence entries, part 1.
638. gbenv10.seq - Environmental sampling sequence entries, part 10.
639. gbenv11.seq - Environmental sampling sequence entries, part 11.
640. gbenv12.seq - Environmental sampling sequence entries, part 12.
641. gbenv13.seq - Environmental sampling sequence entries, part 13.
642. gbenv14.seq - Environmental sampling sequence entries, part 14.
643. gbenv15.seq - Environmental sampling sequence entries, part 15.
644. gbenv16.seq - Environmental sampling sequence entries, part 16.
645. gbenv17.seq - Environmental sampling sequence entries, part 17.
646. gbenv18.seq - Environmental sampling sequence entries, part 18.
647. gbenv19.seq - Environmental sampling sequence entries, part 19.
648. gbenv2.seq - Environmental sampling sequence entries, part 2.
649. gbenv20.seq - Environmental sampling sequence entries, part 20.
650. gbenv21.seq - Environmental sampling sequence entries, part 21.
651. gbenv22.seq - Environmental sampling sequence entries, part 22.
652. gbenv23.seq - Environmental sampling sequence entries, part 23.
653. gbenv24.seq - Environmental sampling sequence entries, part 24.
654. gbenv25.seq - Environmental sampling sequence entries, part 25.
655. gbenv26.seq - Environmental sampling sequence entries, part 26.
656. gbenv27.seq - Environmental sampling sequence entries, part 27.
657. gbenv28.seq - Environmental sampling sequence entries, part 28.
658. gbenv29.seq - Environmental sampling sequence entries, part 29.
659. gbenv3.seq - Environmental sampling sequence entries, part 3.
660. gbenv30.seq - Environmental sampling sequence entries, part 30.
661. gbenv31.seq - Environmental sampling sequence entries, part 31.
662. gbenv32.seq - Environmental sampling sequence entries, part 32.
663. gbenv33.seq - Environmental sampling sequence entries, part 33.
664. gbenv34.seq - Environmental sampling sequence entries, part 34.
665. gbenv35.seq - Environmental sampling sequence entries, part 35.
666. gbenv36.seq - Environmental sampling sequence entries, part 36.
667. gbenv37.seq - Environmental sampling sequence entries, part 37.
668. gbenv38.seq - Environmental sampling sequence entries, part 38.
669. gbenv39.seq - Environmental sampling sequence entries, part 39.
670. gbenv4.seq - Environmental sampling sequence entries, part 4.
671. gbenv40.seq - Environmental sampling sequence entries, part 40.
672. gbenv41.seq - Environmental sampling sequence entries, part 41.
673. gbenv42.seq - Environmental sampling sequence entries, part 42.
674. gbenv43.seq - Environmental sampling sequence entries, part 43.
675. gbenv44.seq - Environmental sampling sequence entries, part 44.
676. gbenv45.seq - Environmental sampling sequence entries, part 45.
677. gbenv46.seq - Environmental sampling sequence entries, part 46.
678. gbenv47.seq - Environmental sampling sequence entries, part 47.
679. gbenv48.seq - Environmental sampling sequence entries, part 48.
680. gbenv49.seq - Environmental sampling sequence entries, part 49.
681. gbenv5.seq - Environmental sampling sequence entries, part 5.
682. gbenv50.seq - Environmental sampling sequence entries, part 50.
683. gbenv51.seq - Environmental sampling sequence entries, part 51.
684. gbenv52.seq - Environmental sampling sequence entries, part 52.
685. gbenv53.seq - Environmental sampling sequence entries, part 53.
686. gbenv54.seq - Environmental sampling sequence entries, part 54.
687. gbenv55.seq - Environmental sampling sequence entries, part 55.
688. gbenv56.seq - Environmental sampling sequence entries, part 56.
689. gbenv57.seq - Environmental sampling sequence entries, part 57.
690. gbenv58.seq - Environmental sampling sequence entries, part 58.
691. gbenv59.seq - Environmental sampling sequence entries, part 59.
692. gbenv6.seq - Environmental sampling sequence entries, part 6.
693. gbenv7.seq - Environmental sampling sequence entries, part 7.
694. gbenv8.seq - Environmental sampling sequence entries, part 8.
695. gbenv9.seq - Environmental sampling sequence entries, part 9.
696. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
697. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
698. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
699. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
700. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
701. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
702. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
703. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
704. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
705. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
706. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
707. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
708. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
709. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
710. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
711. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
712. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
713. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
714. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
715. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
716. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
717. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
718. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
719. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
720. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
721. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
722. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
723. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
724. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
725. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
726. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
727. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
728. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
729. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
730. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
731. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
732. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
733. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
734. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
735. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
736. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
737. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
738. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
739. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
740. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
741. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
742. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
743. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
744. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
745. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
746. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
747. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
748. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
749. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
750. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
751. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
752. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
753. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
754. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
755. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
756. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
757. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
758. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
759. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
760. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
761. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
762. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
763. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
764. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
765. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
766. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
767. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
768. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
769. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
770. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
771. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
772. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
773. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
774. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
775. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
776. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
777. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
778. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
779. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
780. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
781. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
782. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
783. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
784. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
785. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
786. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
787. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
788. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
789. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
790. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
791. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
792. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
793. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
794. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
795. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
796. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
797. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
798. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
799. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
800. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
801. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
802. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
803. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
804. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
805. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
806. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
807. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
808. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
809. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
810. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
811. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
812. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
813. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
814. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
815. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
816. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
817. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
818. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
819. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
820. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
821. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
822. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
823. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
824. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
825. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
826. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
827. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
828. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
829. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
830. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
831. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
832. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
833. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
834. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
835. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
836. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
837. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
838. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
839. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
840. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
841. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
842. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
843. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
844. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
845. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
846. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
847. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
848. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
849. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
850. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
851. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
852. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
853. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
854. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
855. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
856. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
857. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
858. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
859. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
860. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
861. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
862. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
863. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
864. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
865. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
866. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
867. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
868. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
869. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
870. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
871. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
872. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
873. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
874. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
875. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
876. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
877. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
878. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
879. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
880. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
881. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
882. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
883. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
884. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
885. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
886. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
887. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
888. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
889. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
890. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
891. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
892. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
893. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
894. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
895. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
896. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
897. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
898. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
899. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
900. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
901. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
902. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
903. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
904. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
905. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
906. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
907. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
908. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
909. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
910. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
911. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
912. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
913. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
914. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
915. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
916. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
917. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
918. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
919. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
920. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
921. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
922. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
923. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
924. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
925. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
926. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
927. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
928. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
929. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
930. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
931. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
932. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
933. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
934. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
935. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
936. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
937. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
938. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
939. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
940. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
941. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
942. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
943. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
944. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
945. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
946. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
947. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
948. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
949. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
950. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
951. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
952. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
953. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
954. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
955. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
956. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
957. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
958. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
959. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
960. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
961. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
962. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
963. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
964. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
965. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
966. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
967. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
968. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
969. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
970. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
971. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
972. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
973. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
974. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
975. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
976. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
977. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
978. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
979. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
980. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
981. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
982. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
983. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
984. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
985. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
986. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
987. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
988. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
989. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
990. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
991. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
992. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
993. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
994. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
995. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
996. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
997. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
998. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
999. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1000. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1001. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1002. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1003. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1004. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1005. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1006. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1007. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1008. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1009. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1010. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1011. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1012. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1013. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1014. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1015. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1016. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1017. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1018. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1019. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1020. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1021. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1022. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1023. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1024. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1025. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1026. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1027. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1028. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1029. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1030. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1031. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1032. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1033. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1034. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1035. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1036. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1037. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1038. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1039. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1040. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1041. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1042. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1043. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1044. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1045. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1046. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1047. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1048. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1049. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1050. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1051. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1052. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1053. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1054. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1055. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1056. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1057. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1058. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1059. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1060. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1061. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1062. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1063. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1064. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1065. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1066. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1067. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1068. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1069. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1070. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1071. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1072. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1073. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1074. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1075. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1076. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1077. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1078. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1079. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1080. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1081. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1082. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1083. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1084. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1085. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1086. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1087. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1088. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1089. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1090. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1091. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1092. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1093. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1094. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1095. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1096. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1097. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1098. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1099. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1100. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1101. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1102. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1103. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1104. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1105. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1106. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1107. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1108. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1109. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1110. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1111. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1112. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1113. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1114. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1115. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1116. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1117. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1118. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1119. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1120. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1121. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1122. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1123. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1124. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1125. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1126. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1127. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1128. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1129. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1130. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1131. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1132. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1133. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1134. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1135. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1136. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1137. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1138. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1139. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1140. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1141. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1142. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1143. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1144. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1145. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1146. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1147. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1148. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1149. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1150. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1151. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1152. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1153. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1154. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1155. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1156. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1157. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1158. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1159. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1160. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1161. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1162. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1163. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1164. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1165. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1166. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1167. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1168. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1169. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1170. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1171. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1172. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1173. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1174. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1175. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1176. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1177. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1178. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1179. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1180. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1181. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1182. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1183. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1184. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1185. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1186. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1187. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1188. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1189. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1190. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1191. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1192. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1193. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1194. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1195. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1196. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1197. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1198. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1199. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1200. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1201. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1202. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1203. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1204. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1205. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1206. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1207. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1208. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1209. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1210. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1211. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1212. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1213. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1214. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1215. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1216. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1217. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1218. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1219. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1220. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1221. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1222. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1223. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1224. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1225. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1226. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1227. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1228. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1229. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1230. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1231. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1232. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1233. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1234. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1235. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1236. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1237. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1238. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1239. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1240. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1241. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1242. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1243. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1244. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1245. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1246. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1247. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1248. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1249. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1250. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1251. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1252. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1253. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1254. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1255. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1256. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1257. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1258. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1259. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1260. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1261. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1262. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1263. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1264. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1265. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1266. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1267. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1268. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1269. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1270. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1271. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1272. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1273. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1274. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1275. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1276. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1277. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1278. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1279. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1280. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1281. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1282. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1283. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1284. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1285. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1286. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1287. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1288. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1289. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1290. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1291. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1292. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1293. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1294. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1295. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1296. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1297. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1298. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1299. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1300. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1301. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1302. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1303. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1304. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1305. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1306. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1307. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1308. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1309. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1310. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1311. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1312. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1313. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1314. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1315. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1316. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1317. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1318. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1319. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1320. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1321. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1322. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1323. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1324. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1325. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1326. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1327. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1328. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1329. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1330. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1331. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1332. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1333. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1334. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1335. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1336. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1337. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1338. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1339. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1340. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1341. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1342. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1343. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1344. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1345. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1346. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1347. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1348. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1349. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1350. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1351. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1352. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1353. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1354. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1355. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1356. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1357. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1358. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1359. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1360. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1361. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1362. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1363. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1364. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1365. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1366. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1367. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1368. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1369. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1370. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1371. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1372. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1373. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1374. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1375. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1376. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1377. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1378. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1379. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1380. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1381. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1382. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1383. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1384. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1385. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1386. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1387. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1388. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1389. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1390. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1391. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1392. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1393. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1394. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1395. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1396. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1397. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1398. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1399. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1400. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1401. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1402. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1403. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1404. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1405. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1406. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1407. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1408. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1409. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1410. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1411. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1412. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1413. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1414. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1415. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1416. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1417. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1418. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1419. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1420. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1421. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1422. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1423. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1424. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1425. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1426. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1427. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1428. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1429. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1430. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1431. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1432. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1433. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1434. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1435. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1436. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1437. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1438. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1439. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1440. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1441. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1442. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1443. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1444. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1445. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1446. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1447. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1448. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1449. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1450. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1451. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1452. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1453. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1454. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1455. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1456. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1457. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1458. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1459. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1460. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1461. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1462. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1463. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1464. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1465. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1466. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1467. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1468. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1469. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1470. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1471. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1472. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1473. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1474. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1475. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1476. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1477. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1478. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1479. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1480. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1481. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1482. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1483. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1484. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1485. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1486. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1487. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1488. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1489. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1490. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1491. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1492. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1493. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1494. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1495. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1496. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1497. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1498. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1499. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1500. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1501. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1502. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1503. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1504. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1505. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1506. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1507. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1508. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1509. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1510. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1511. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1512. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1513. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1514. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1515. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1516. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1517. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1518. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1519. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1520. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1521. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1522. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1523. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1524. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1525. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1526. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1527. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1528. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1529. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1530. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1531. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1532. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1533. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1534. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1535. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1536. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1537. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1538. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1539. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1540. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1541. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1542. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1543. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1544. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1545. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1546. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1547. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1548. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1549. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1550. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1551. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1552. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1553. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1554. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1555. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1556. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1557. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1558. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1559. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1560. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1561. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1562. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1563. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1564. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1565. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1566. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1567. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1568. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1569. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1570. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1571. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1572. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1573. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1574. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1575. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1576. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1577. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1578. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1579. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1580. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1581. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1582. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1583. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1584. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1585. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1586. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1587. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1588. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1589. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1590. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1591. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1592. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1593. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1594. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1595. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1596. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1597. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1598. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1599. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1600. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1601. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1602. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1603. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1604. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1605. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1606. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1607. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1608. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1609. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1610. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1611. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1612. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1613. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1614. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1615. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1616. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1617. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1618. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1619. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1620. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1621. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1622. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1623. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1624. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1625. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1626. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1627. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1628. gbinv1.seq - Invertebrate sequence entries, part 1.
1629. gbinv10.seq - Invertebrate sequence entries, part 10.
1630. gbinv11.seq - Invertebrate sequence entries, part 11.
1631. gbinv12.seq - Invertebrate sequence entries, part 12.
1632. gbinv13.seq - Invertebrate sequence entries, part 13.
1633. gbinv14.seq - Invertebrate sequence entries, part 14.
1634. gbinv15.seq - Invertebrate sequence entries, part 15.
1635. gbinv16.seq - Invertebrate sequence entries, part 16.
1636. gbinv17.seq - Invertebrate sequence entries, part 17.
1637. gbinv18.seq - Invertebrate sequence entries, part 18.
1638. gbinv19.seq - Invertebrate sequence entries, part 19.
1639. gbinv2.seq - Invertebrate sequence entries, part 2.
1640. gbinv20.seq - Invertebrate sequence entries, part 20.
1641. gbinv21.seq - Invertebrate sequence entries, part 21.
1642. gbinv22.seq - Invertebrate sequence entries, part 22.
1643. gbinv23.seq - Invertebrate sequence entries, part 23.
1644. gbinv24.seq - Invertebrate sequence entries, part 24.
1645. gbinv25.seq - Invertebrate sequence entries, part 25.
1646. gbinv26.seq - Invertebrate sequence entries, part 26.
1647. gbinv27.seq - Invertebrate sequence entries, part 27.
1648. gbinv28.seq - Invertebrate sequence entries, part 28.
1649. gbinv29.seq - Invertebrate sequence entries, part 29.
1650. gbinv3.seq - Invertebrate sequence entries, part 3.
1651. gbinv30.seq - Invertebrate sequence entries, part 30.
1652. gbinv31.seq - Invertebrate sequence entries, part 31.
1653. gbinv32.seq - Invertebrate sequence entries, part 32.
1654. gbinv33.seq - Invertebrate sequence entries, part 33.
1655. gbinv34.seq - Invertebrate sequence entries, part 34.
1656. gbinv35.seq - Invertebrate sequence entries, part 35.
1657. gbinv36.seq - Invertebrate sequence entries, part 36.
1658. gbinv37.seq - Invertebrate sequence entries, part 37.
1659. gbinv38.seq - Invertebrate sequence entries, part 38.
1660. gbinv39.seq - Invertebrate sequence entries, part 39.
1661. gbinv4.seq - Invertebrate sequence entries, part 4.
1662. gbinv40.seq - Invertebrate sequence entries, part 40.
1663. gbinv41.seq - Invertebrate sequence entries, part 41.
1664. gbinv42.seq - Invertebrate sequence entries, part 42.
1665. gbinv43.seq - Invertebrate sequence entries, part 43.
1666. gbinv44.seq - Invertebrate sequence entries, part 44.
1667. gbinv45.seq - Invertebrate sequence entries, part 45.
1668. gbinv46.seq - Invertebrate sequence entries, part 46.
1669. gbinv47.seq - Invertebrate sequence entries, part 47.
1670. gbinv48.seq - Invertebrate sequence entries, part 48.
1671. gbinv49.seq - Invertebrate sequence entries, part 49.
1672. gbinv5.seq - Invertebrate sequence entries, part 5.
1673. gbinv50.seq - Invertebrate sequence entries, part 50.
1674. gbinv51.seq - Invertebrate sequence entries, part 51.
1675. gbinv52.seq - Invertebrate sequence entries, part 52.
1676. gbinv53.seq - Invertebrate sequence entries, part 53.
1677. gbinv54.seq - Invertebrate sequence entries, part 54.
1678. gbinv55.seq - Invertebrate sequence entries, part 55.
1679. gbinv56.seq - Invertebrate sequence entries, part 56.
1680. gbinv57.seq - Invertebrate sequence entries, part 57.
1681. gbinv58.seq - Invertebrate sequence entries, part 58.
1682. gbinv59.seq - Invertebrate sequence entries, part 59.
1683. gbinv6.seq - Invertebrate sequence entries, part 6.
1684. gbinv60.seq - Invertebrate sequence entries, part 60.
1685. gbinv61.seq - Invertebrate sequence entries, part 61.
1686. gbinv62.seq - Invertebrate sequence entries, part 62.
1687. gbinv63.seq - Invertebrate sequence entries, part 63.
1688. gbinv64.seq - Invertebrate sequence entries, part 64.
1689. gbinv65.seq - Invertebrate sequence entries, part 65.
1690. gbinv66.seq - Invertebrate sequence entries, part 66.
1691. gbinv67.seq - Invertebrate sequence entries, part 67.
1692. gbinv68.seq - Invertebrate sequence entries, part 68.
1693. gbinv69.seq - Invertebrate sequence entries, part 69.
1694. gbinv7.seq - Invertebrate sequence entries, part 7.
1695. gbinv70.seq - Invertebrate sequence entries, part 70.
1696. gbinv71.seq - Invertebrate sequence entries, part 71.
1697. gbinv72.seq - Invertebrate sequence entries, part 72.
1698. gbinv73.seq - Invertebrate sequence entries, part 73.
1699. gbinv74.seq - Invertebrate sequence entries, part 74.
1700. gbinv75.seq - Invertebrate sequence entries, part 75.
1701. gbinv76.seq - Invertebrate sequence entries, part 76.
1702. gbinv77.seq - Invertebrate sequence entries, part 77.
1703. gbinv78.seq - Invertebrate sequence entries, part 78.
1704. gbinv79.seq - Invertebrate sequence entries, part 79.
1705. gbinv8.seq - Invertebrate sequence entries, part 8.
1706. gbinv80.seq - Invertebrate sequence entries, part 80.
1707. gbinv9.seq - Invertebrate sequence entries, part 9.
1708. gbmam1.seq - Other mammalian sequence entries, part 1.
1709. gbmam10.seq - Other mammalian sequence entries, part 10.
1710. gbmam11.seq - Other mammalian sequence entries, part 11.
1711. gbmam12.seq - Other mammalian sequence entries, part 12.
1712. gbmam13.seq - Other mammalian sequence entries, part 13.
1713. gbmam14.seq - Other mammalian sequence entries, part 14.
1714. gbmam15.seq - Other mammalian sequence entries, part 15.
1715. gbmam16.seq - Other mammalian sequence entries, part 16.
1716. gbmam17.seq - Other mammalian sequence entries, part 17.
1717. gbmam18.seq - Other mammalian sequence entries, part 18.
1718. gbmam19.seq - Other mammalian sequence entries, part 19.
1719. gbmam2.seq - Other mammalian sequence entries, part 2.
1720. gbmam20.seq - Other mammalian sequence entries, part 20.
1721. gbmam21.seq - Other mammalian sequence entries, part 21.
1722. gbmam22.seq - Other mammalian sequence entries, part 22.
1723. gbmam23.seq - Other mammalian sequence entries, part 23.
1724. gbmam24.seq - Other mammalian sequence entries, part 24.
1725. gbmam25.seq - Other mammalian sequence entries, part 25.
1726. gbmam26.seq - Other mammalian sequence entries, part 26.
1727. gbmam27.seq - Other mammalian sequence entries, part 27.
1728. gbmam28.seq - Other mammalian sequence entries, part 28.
1729. gbmam29.seq - Other mammalian sequence entries, part 29.
1730. gbmam3.seq - Other mammalian sequence entries, part 3.
1731. gbmam30.seq - Other mammalian sequence entries, part 30.
1732. gbmam31.seq - Other mammalian sequence entries, part 31.
1733. gbmam32.seq - Other mammalian sequence entries, part 32.
1734. gbmam33.seq - Other mammalian sequence entries, part 33.
1735. gbmam34.seq - Other mammalian sequence entries, part 34.
1736. gbmam35.seq - Other mammalian sequence entries, part 35.
1737. gbmam36.seq - Other mammalian sequence entries, part 36.
1738. gbmam37.seq - Other mammalian sequence entries, part 37.
1739. gbmam38.seq - Other mammalian sequence entries, part 38.
1740. gbmam39.seq - Other mammalian sequence entries, part 39.
1741. gbmam4.seq - Other mammalian sequence entries, part 4.
1742. gbmam40.seq - Other mammalian sequence entries, part 40.
1743. gbmam41.seq - Other mammalian sequence entries, part 41.
1744. gbmam42.seq - Other mammalian sequence entries, part 42.
1745. gbmam43.seq - Other mammalian sequence entries, part 43.
1746. gbmam44.seq - Other mammalian sequence entries, part 44.
1747. gbmam45.seq - Other mammalian sequence entries, part 45.
1748. gbmam46.seq - Other mammalian sequence entries, part 46.
1749. gbmam47.seq - Other mammalian sequence entries, part 47.
1750. gbmam48.seq - Other mammalian sequence entries, part 48.
1751. gbmam49.seq - Other mammalian sequence entries, part 49.
1752. gbmam5.seq - Other mammalian sequence entries, part 5.
1753. gbmam6.seq - Other mammalian sequence entries, part 6.
1754. gbmam7.seq - Other mammalian sequence entries, part 7.
1755. gbmam8.seq - Other mammalian sequence entries, part 8.
1756. gbmam9.seq - Other mammalian sequence entries, part 9.
1757. gbnew.txt - Accession numbers of entries new since the previous release.
1758. gbpat1.seq - Patent sequence entries, part 1.
1759. gbpat10.seq - Patent sequence entries, part 10.
1760. gbpat100.seq - Patent sequence entries, part 100.
1761. gbpat101.seq - Patent sequence entries, part 101.
1762. gbpat102.seq - Patent sequence entries, part 102.
1763. gbpat103.seq - Patent sequence entries, part 103.
1764. gbpat104.seq - Patent sequence entries, part 104.
1765. gbpat105.seq - Patent sequence entries, part 105.
1766. gbpat106.seq - Patent sequence entries, part 106.
1767. gbpat107.seq - Patent sequence entries, part 107.
1768. gbpat108.seq - Patent sequence entries, part 108.
1769. gbpat109.seq - Patent sequence entries, part 109.
1770. gbpat11.seq - Patent sequence entries, part 11.
1771. gbpat110.seq - Patent sequence entries, part 110.
1772. gbpat111.seq - Patent sequence entries, part 111.
1773. gbpat112.seq - Patent sequence entries, part 112.
1774. gbpat113.seq - Patent sequence entries, part 113.
1775. gbpat114.seq - Patent sequence entries, part 114.
1776. gbpat115.seq - Patent sequence entries, part 115.
1777. gbpat116.seq - Patent sequence entries, part 116.
1778. gbpat117.seq - Patent sequence entries, part 117.
1779. gbpat118.seq - Patent sequence entries, part 118.
1780. gbpat119.seq - Patent sequence entries, part 119.
1781. gbpat12.seq - Patent sequence entries, part 12.
1782. gbpat120.seq - Patent sequence entries, part 120.
1783. gbpat121.seq - Patent sequence entries, part 121.
1784. gbpat122.seq - Patent sequence entries, part 122.
1785. gbpat123.seq - Patent sequence entries, part 123.
1786. gbpat124.seq - Patent sequence entries, part 124.
1787. gbpat125.seq - Patent sequence entries, part 125.
1788. gbpat126.seq - Patent sequence entries, part 126.
1789. gbpat127.seq - Patent sequence entries, part 127.
1790. gbpat128.seq - Patent sequence entries, part 128.
1791. gbpat129.seq - Patent sequence entries, part 129.
1792. gbpat13.seq - Patent sequence entries, part 13.
1793. gbpat130.seq - Patent sequence entries, part 130.
1794. gbpat131.seq - Patent sequence entries, part 131.
1795. gbpat132.seq - Patent sequence entries, part 132.
1796. gbpat133.seq - Patent sequence entries, part 133.
1797. gbpat134.seq - Patent sequence entries, part 134.
1798. gbpat135.seq - Patent sequence entries, part 135.
1799. gbpat136.seq - Patent sequence entries, part 136.
1800. gbpat137.seq - Patent sequence entries, part 137.
1801. gbpat138.seq - Patent sequence entries, part 138.
1802. gbpat139.seq - Patent sequence entries, part 139.
1803. gbpat14.seq - Patent sequence entries, part 14.
1804. gbpat140.seq - Patent sequence entries, part 140.
1805. gbpat141.seq - Patent sequence entries, part 141.
1806. gbpat142.seq - Patent sequence entries, part 142.
1807. gbpat143.seq - Patent sequence entries, part 143.
1808. gbpat144.seq - Patent sequence entries, part 144.
1809. gbpat145.seq - Patent sequence entries, part 145.
1810. gbpat146.seq - Patent sequence entries, part 146.
1811. gbpat147.seq - Patent sequence entries, part 147.
1812. gbpat148.seq - Patent sequence entries, part 148.
1813. gbpat149.seq - Patent sequence entries, part 149.
1814. gbpat15.seq - Patent sequence entries, part 15.
1815. gbpat150.seq - Patent sequence entries, part 150.
1816. gbpat151.seq - Patent sequence entries, part 151.
1817. gbpat152.seq - Patent sequence entries, part 152.
1818. gbpat153.seq - Patent sequence entries, part 153.
1819. gbpat154.seq - Patent sequence entries, part 154.
1820. gbpat155.seq - Patent sequence entries, part 155.
1821. gbpat156.seq - Patent sequence entries, part 156.
1822. gbpat157.seq - Patent sequence entries, part 157.
1823. gbpat158.seq - Patent sequence entries, part 158.
1824. gbpat159.seq - Patent sequence entries, part 159.
1825. gbpat16.seq - Patent sequence entries, part 16.
1826. gbpat160.seq - Patent sequence entries, part 160.
1827. gbpat161.seq - Patent sequence entries, part 161.
1828. gbpat162.seq - Patent sequence entries, part 162.
1829. gbpat163.seq - Patent sequence entries, part 163.
1830. gbpat164.seq - Patent sequence entries, part 164.
1831. gbpat165.seq - Patent sequence entries, part 165.
1832. gbpat166.seq - Patent sequence entries, part 166.
1833. gbpat167.seq - Patent sequence entries, part 167.
1834. gbpat168.seq - Patent sequence entries, part 168.
1835. gbpat169.seq - Patent sequence entries, part 169.
1836. gbpat17.seq - Patent sequence entries, part 17.
1837. gbpat170.seq - Patent sequence entries, part 170.
1838. gbpat171.seq - Patent sequence entries, part 171.
1839. gbpat172.seq - Patent sequence entries, part 172.
1840. gbpat173.seq - Patent sequence entries, part 173.
1841. gbpat174.seq - Patent sequence entries, part 174.
1842. gbpat175.seq - Patent sequence entries, part 175.
1843. gbpat176.seq - Patent sequence entries, part 176.
1844. gbpat177.seq - Patent sequence entries, part 177.
1845. gbpat178.seq - Patent sequence entries, part 178.
1846. gbpat179.seq - Patent sequence entries, part 179.
1847. gbpat18.seq - Patent sequence entries, part 18.
1848. gbpat180.seq - Patent sequence entries, part 180.
1849. gbpat181.seq - Patent sequence entries, part 181.
1850. gbpat182.seq - Patent sequence entries, part 182.
1851. gbpat183.seq - Patent sequence entries, part 183.
1852. gbpat184.seq - Patent sequence entries, part 184.
1853. gbpat185.seq - Patent sequence entries, part 185.
1854. gbpat186.seq - Patent sequence entries, part 186.
1855. gbpat187.seq - Patent sequence entries, part 187.
1856. gbpat188.seq - Patent sequence entries, part 188.
1857. gbpat189.seq - Patent sequence entries, part 189.
1858. gbpat19.seq - Patent sequence entries, part 19.
1859. gbpat190.seq - Patent sequence entries, part 190.
1860. gbpat191.seq - Patent sequence entries, part 191.
1861. gbpat192.seq - Patent sequence entries, part 192.
1862. gbpat193.seq - Patent sequence entries, part 193.
1863. gbpat194.seq - Patent sequence entries, part 194.
1864. gbpat195.seq - Patent sequence entries, part 195.
1865. gbpat196.seq - Patent sequence entries, part 196.
1866. gbpat197.seq - Patent sequence entries, part 197.
1867. gbpat198.seq - Patent sequence entries, part 198.
1868. gbpat199.seq - Patent sequence entries, part 199.
1869. gbpat2.seq - Patent sequence entries, part 2.
1870. gbpat20.seq - Patent sequence entries, part 20.
1871. gbpat200.seq - Patent sequence entries, part 200.
1872. gbpat201.seq - Patent sequence entries, part 201.
1873. gbpat202.seq - Patent sequence entries, part 202.
1874. gbpat203.seq - Patent sequence entries, part 203.
1875. gbpat204.seq - Patent sequence entries, part 204.
1876. gbpat21.seq - Patent sequence entries, part 21.
1877. gbpat22.seq - Patent sequence entries, part 22.
1878. gbpat23.seq - Patent sequence entries, part 23.
1879. gbpat24.seq - Patent sequence entries, part 24.
1880. gbpat25.seq - Patent sequence entries, part 25.
1881. gbpat26.seq - Patent sequence entries, part 26.
1882. gbpat27.seq - Patent sequence entries, part 27.
1883. gbpat28.seq - Patent sequence entries, part 28.
1884. gbpat29.seq - Patent sequence entries, part 29.
1885. gbpat3.seq - Patent sequence entries, part 3.
1886. gbpat30.seq - Patent sequence entries, part 30.
1887. gbpat31.seq - Patent sequence entries, part 31.
1888. gbpat32.seq - Patent sequence entries, part 32.
1889. gbpat33.seq - Patent sequence entries, part 33.
1890. gbpat34.seq - Patent sequence entries, part 34.
1891. gbpat35.seq - Patent sequence entries, part 35.
1892. gbpat36.seq - Patent sequence entries, part 36.
1893. gbpat37.seq - Patent sequence entries, part 37.
1894. gbpat38.seq - Patent sequence entries, part 38.
1895. gbpat39.seq - Patent sequence entries, part 39.
1896. gbpat4.seq - Patent sequence entries, part 4.
1897. gbpat40.seq - Patent sequence entries, part 40.
1898. gbpat41.seq - Patent sequence entries, part 41.
1899. gbpat42.seq - Patent sequence entries, part 42.
1900. gbpat43.seq - Patent sequence entries, part 43.
1901. gbpat44.seq - Patent sequence entries, part 44.
1902. gbpat45.seq - Patent sequence entries, part 45.
1903. gbpat46.seq - Patent sequence entries, part 46.
1904. gbpat47.seq - Patent sequence entries, part 47.
1905. gbpat48.seq - Patent sequence entries, part 48.
1906. gbpat49.seq - Patent sequence entries, part 49.
1907. gbpat5.seq - Patent sequence entries, part 5.
1908. gbpat50.seq - Patent sequence entries, part 50.
1909. gbpat51.seq - Patent sequence entries, part 51.
1910. gbpat52.seq - Patent sequence entries, part 52.
1911. gbpat53.seq - Patent sequence entries, part 53.
1912. gbpat54.seq - Patent sequence entries, part 54.
1913. gbpat55.seq - Patent sequence entries, part 55.
1914. gbpat56.seq - Patent sequence entries, part 56.
1915. gbpat57.seq - Patent sequence entries, part 57.
1916. gbpat58.seq - Patent sequence entries, part 58.
1917. gbpat59.seq - Patent sequence entries, part 59.
1918. gbpat6.seq - Patent sequence entries, part 6.
1919. gbpat60.seq - Patent sequence entries, part 60.
1920. gbpat61.seq - Patent sequence entries, part 61.
1921. gbpat62.seq - Patent sequence entries, part 62.
1922. gbpat63.seq - Patent sequence entries, part 63.
1923. gbpat64.seq - Patent sequence entries, part 64.
1924. gbpat65.seq - Patent sequence entries, part 65.
1925. gbpat66.seq - Patent sequence entries, part 66.
1926. gbpat67.seq - Patent sequence entries, part 67.
1927. gbpat68.seq - Patent sequence entries, part 68.
1928. gbpat69.seq - Patent sequence entries, part 69.
1929. gbpat7.seq - Patent sequence entries, part 7.
1930. gbpat70.seq - Patent sequence entries, part 70.
1931. gbpat71.seq - Patent sequence entries, part 71.
1932. gbpat72.seq - Patent sequence entries, part 72.
1933. gbpat73.seq - Patent sequence entries, part 73.
1934. gbpat74.seq - Patent sequence entries, part 74.
1935. gbpat75.seq - Patent sequence entries, part 75.
1936. gbpat76.seq - Patent sequence entries, part 76.
1937. gbpat77.seq - Patent sequence entries, part 77.
1938. gbpat78.seq - Patent sequence entries, part 78.
1939. gbpat79.seq - Patent sequence entries, part 79.
1940. gbpat8.seq - Patent sequence entries, part 8.
1941. gbpat80.seq - Patent sequence entries, part 80.
1942. gbpat81.seq - Patent sequence entries, part 81.
1943. gbpat82.seq - Patent sequence entries, part 82.
1944. gbpat83.seq - Patent sequence entries, part 83.
1945. gbpat84.seq - Patent sequence entries, part 84.
1946. gbpat85.seq - Patent sequence entries, part 85.
1947. gbpat86.seq - Patent sequence entries, part 86.
1948. gbpat87.seq - Patent sequence entries, part 87.
1949. gbpat88.seq - Patent sequence entries, part 88.
1950. gbpat89.seq - Patent sequence entries, part 89.
1951. gbpat9.seq - Patent sequence entries, part 9.
1952. gbpat90.seq - Patent sequence entries, part 90.
1953. gbpat91.seq - Patent sequence entries, part 91.
1954. gbpat92.seq - Patent sequence entries, part 92.
1955. gbpat93.seq - Patent sequence entries, part 93.
1956. gbpat94.seq - Patent sequence entries, part 94.
1957. gbpat95.seq - Patent sequence entries, part 95.
1958. gbpat96.seq - Patent sequence entries, part 96.
1959. gbpat97.seq - Patent sequence entries, part 97.
1960. gbpat98.seq - Patent sequence entries, part 98.
1961. gbpat99.seq - Patent sequence entries, part 99.
1962. gbphg1.seq - Phage sequence entries, part 1.
1963. gbphg2.seq - Phage sequence entries, part 2.
1964. gbphg3.seq - Phage sequence entries, part 3.
1965. gbphg4.seq - Phage sequence entries, part 4.
1966. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
1967. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
1968. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
1969. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
1970. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
1971. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
1972. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
1973. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
1974. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
1975. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
1976. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
1977. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
1978. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
1979. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
1980. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
1981. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
1982. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
1983. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
1984. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
1985. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
1986. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
1987. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
1988. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
1989. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
1990. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
1991. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
1992. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
1993. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
1994. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
1995. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
1996. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
1997. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
1998. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
1999. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2000. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2001. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2002. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2003. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2004. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2005. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2006. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2007. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2008. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2009. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2010. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2011. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2012. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2013. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2014. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2015. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2016. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2017. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2018. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2019. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2020. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2021. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2022. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2023. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2024. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2025. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2026. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2027. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2028. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2029. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2030. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2031. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2032. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2033. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2034. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2035. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2036. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2037. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2038. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2039. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2040. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2041. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2042. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2043. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2044. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2045. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2046. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2047. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2048. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2049. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2050. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2051. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2052. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2053. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2054. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2055. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2056. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2057. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2058. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2059. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2060. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2061. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2062. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2063. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2064. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2065. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2066. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2067. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2068. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2069. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2070. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2071. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2072. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2073. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2074. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2075. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2076. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2077. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2078. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2079. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2080. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2081. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2082. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2083. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2084. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2085. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2086. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2087. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2088. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2089. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2090. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2091. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2092. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2093. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2094. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2095. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2096. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2097. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2098. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2099. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2100. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2101. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2102. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2103. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2104. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2105. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2106. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2107. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2108. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2109. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2110. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2111. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2112. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2113. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2114. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2115. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2116. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2117. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2118. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2119. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2120. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2121. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2122. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2123. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2124. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2125. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2126. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2127. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2128. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2129. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2130. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2131. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2132. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2133. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2134. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2135. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2136. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2137. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2138. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2139. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2140. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2141. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2142. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2143. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2144. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2145. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2146. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2147. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2148. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2149. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2150. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2151. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2152. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2153. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2154. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2155. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2156. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2157. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2158. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2159. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2160. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2161. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2162. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2163. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2164. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2165. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2166. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2167. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2168. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2169. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2170. gbpri1.seq - Primate sequence entries, part 1.
2171. gbpri10.seq - Primate sequence entries, part 10.
2172. gbpri11.seq - Primate sequence entries, part 11.
2173. gbpri12.seq - Primate sequence entries, part 12.
2174. gbpri13.seq - Primate sequence entries, part 13.
2175. gbpri14.seq - Primate sequence entries, part 14.
2176. gbpri15.seq - Primate sequence entries, part 15.
2177. gbpri16.seq - Primate sequence entries, part 16.
2178. gbpri17.seq - Primate sequence entries, part 17.
2179. gbpri18.seq - Primate sequence entries, part 18.
2180. gbpri19.seq - Primate sequence entries, part 19.
2181. gbpri2.seq - Primate sequence entries, part 2.
2182. gbpri20.seq - Primate sequence entries, part 20.
2183. gbpri21.seq - Primate sequence entries, part 21.
2184. gbpri22.seq - Primate sequence entries, part 22.
2185. gbpri23.seq - Primate sequence entries, part 23.
2186. gbpri24.seq - Primate sequence entries, part 24.
2187. gbpri25.seq - Primate sequence entries, part 25.
2188. gbpri26.seq - Primate sequence entries, part 26.
2189. gbpri27.seq - Primate sequence entries, part 27.
2190. gbpri28.seq - Primate sequence entries, part 28.
2191. gbpri29.seq - Primate sequence entries, part 29.
2192. gbpri3.seq - Primate sequence entries, part 3.
2193. gbpri30.seq - Primate sequence entries, part 30.
2194. gbpri31.seq - Primate sequence entries, part 31.
2195. gbpri32.seq - Primate sequence entries, part 32.
2196. gbpri33.seq - Primate sequence entries, part 33.
2197. gbpri34.seq - Primate sequence entries, part 34.
2198. gbpri4.seq - Primate sequence entries, part 4.
2199. gbpri5.seq - Primate sequence entries, part 5.
2200. gbpri6.seq - Primate sequence entries, part 6.
2201. gbpri7.seq - Primate sequence entries, part 7.
2202. gbpri8.seq - Primate sequence entries, part 8.
2203. gbpri9.seq - Primate sequence entries, part 9.
2204. gbrel.txt - Release notes (this document).
2205. gbrod1.seq - Rodent sequence entries, part 1.
2206. gbrod10.seq - Rodent sequence entries, part 10.
2207. gbrod11.seq - Rodent sequence entries, part 11.
2208. gbrod12.seq - Rodent sequence entries, part 12.
2209. gbrod13.seq - Rodent sequence entries, part 13.
2210. gbrod14.seq - Rodent sequence entries, part 14.
2211. gbrod15.seq - Rodent sequence entries, part 15.
2212. gbrod16.seq - Rodent sequence entries, part 16.
2213. gbrod17.seq - Rodent sequence entries, part 17.
2214. gbrod18.seq - Rodent sequence entries, part 18.
2215. gbrod19.seq - Rodent sequence entries, part 19.
2216. gbrod2.seq - Rodent sequence entries, part 2.
2217. gbrod20.seq - Rodent sequence entries, part 20.
2218. gbrod21.seq - Rodent sequence entries, part 21.
2219. gbrod22.seq - Rodent sequence entries, part 22.
2220. gbrod23.seq - Rodent sequence entries, part 23.
2221. gbrod24.seq - Rodent sequence entries, part 24.
2222. gbrod25.seq - Rodent sequence entries, part 25.
2223. gbrod26.seq - Rodent sequence entries, part 26.
2224. gbrod27.seq - Rodent sequence entries, part 27.
2225. gbrod28.seq - Rodent sequence entries, part 28.
2226. gbrod29.seq - Rodent sequence entries, part 29.
2227. gbrod3.seq - Rodent sequence entries, part 3.
2228. gbrod30.seq - Rodent sequence entries, part 30.
2229. gbrod31.seq - Rodent sequence entries, part 31.
2230. gbrod32.seq - Rodent sequence entries, part 32.
2231. gbrod33.seq - Rodent sequence entries, part 33.
2232. gbrod34.seq - Rodent sequence entries, part 34.
2233. gbrod4.seq - Rodent sequence entries, part 4.
2234. gbrod5.seq - Rodent sequence entries, part 5.
2235. gbrod6.seq - Rodent sequence entries, part 6.
2236. gbrod7.seq - Rodent sequence entries, part 7.
2237. gbrod8.seq - Rodent sequence entries, part 8.
2238. gbrod9.seq - Rodent sequence entries, part 9.
2239. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2240. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2241. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2242. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2243. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2244. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2245. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2246. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2247. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2248. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2249. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2250. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2251. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2252. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
2253. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
2254. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
2255. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
2256. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
2257. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
2258. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
2259. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
2260. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
2261. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2262. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
2263. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
2264. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
2265. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
2266. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
2267. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
2268. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
2269. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
2270. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2271. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2272. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2273. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2274. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2275. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2276. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2277. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2278. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2279. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2280. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2281. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2282. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2283. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2284. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2285. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2286. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2287. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2288. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2289. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2290. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2291. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2292. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2293. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2294. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2295. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2296. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2297. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2298. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2299. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2300. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2301. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2302. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2303. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2304. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2305. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2306. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2307. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2308. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2309. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2310. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2311. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2312. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2313. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2314. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2315. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2316. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2317. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2318. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2319. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2320. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2321. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2322. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2323. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2324. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2325. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2326. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2327. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2328. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2329. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2330. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2331. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2332. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2333. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2334. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2335. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2336. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2337. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2338. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2339. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2340. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2341. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2342. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2343. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2344. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2345. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2346. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2347. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2348. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2349. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2350. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2351. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2352. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2353. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2354. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2355. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2356. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2357. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2358. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2359. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2360. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2361. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2362. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2363. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2364. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2365. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2366. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2367. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2368. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2369. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2370. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2371. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2372. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2373. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2374. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2375. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2376. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2377. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2378. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2379. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2380. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2381. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2382. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2383. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2384. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2385. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2386. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2387. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2388. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2389. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2390. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2391. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2392. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2393. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2394. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2395. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2396. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2397. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2398. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2399. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2400. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2401. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2402. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2403. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2404. gbuna1.seq - Unannotated sequence entries, part 1.
2405. gbvrl1.seq - Viral sequence entries, part 1.
2406. gbvrl10.seq - Viral sequence entries, part 10.
2407. gbvrl11.seq - Viral sequence entries, part 11.
2408. gbvrl12.seq - Viral sequence entries, part 12.
2409. gbvrl13.seq - Viral sequence entries, part 13.
2410. gbvrl14.seq - Viral sequence entries, part 14.
2411. gbvrl15.seq - Viral sequence entries, part 15.
2412. gbvrl16.seq - Viral sequence entries, part 16.
2413. gbvrl17.seq - Viral sequence entries, part 17.
2414. gbvrl18.seq - Viral sequence entries, part 18.
2415. gbvrl19.seq - Viral sequence entries, part 19.
2416. gbvrl2.seq - Viral sequence entries, part 2.
2417. gbvrl20.seq - Viral sequence entries, part 20.
2418. gbvrl21.seq - Viral sequence entries, part 21.
2419. gbvrl22.seq - Viral sequence entries, part 22.
2420. gbvrl23.seq - Viral sequence entries, part 23.
2421. gbvrl24.seq - Viral sequence entries, part 24.
2422. gbvrl25.seq - Viral sequence entries, part 25.
2423. gbvrl26.seq - Viral sequence entries, part 26.
2424. gbvrl27.seq - Viral sequence entries, part 27.
2425. gbvrl28.seq - Viral sequence entries, part 28.
2426. gbvrl29.seq - Viral sequence entries, part 29.
2427. gbvrl3.seq - Viral sequence entries, part 3.
2428. gbvrl30.seq - Viral sequence entries, part 30.
2429. gbvrl31.seq - Viral sequence entries, part 31.
2430. gbvrl32.seq - Viral sequence entries, part 32.
2431. gbvrl33.seq - Viral sequence entries, part 33.
2432. gbvrl34.seq - Viral sequence entries, part 34.
2433. gbvrl35.seq - Viral sequence entries, part 35.
2434. gbvrl36.seq - Viral sequence entries, part 36.
2435. gbvrl4.seq - Viral sequence entries, part 4.
2436. gbvrl5.seq - Viral sequence entries, part 5.
2437. gbvrl6.seq - Viral sequence entries, part 6.
2438. gbvrl7.seq - Viral sequence entries, part 7.
2439. gbvrl8.seq - Viral sequence entries, part 8.
2440. gbvrl9.seq - Viral sequence entries, part 9.
2441. gbvrt1.seq - Other vertebrate sequence entries, part 1.
2442. gbvrt10.seq - Other vertebrate sequence entries, part 10.
2443. gbvrt100.seq - Other vertebrate sequence entries, part 100.
2444. gbvrt101.seq - Other vertebrate sequence entries, part 101.
2445. gbvrt102.seq - Other vertebrate sequence entries, part 102.
2446. gbvrt103.seq - Other vertebrate sequence entries, part 103.
2447. gbvrt104.seq - Other vertebrate sequence entries, part 104.
2448. gbvrt105.seq - Other vertebrate sequence entries, part 105.
2449. gbvrt106.seq - Other vertebrate sequence entries, part 106.
2450. gbvrt107.seq - Other vertebrate sequence entries, part 107.
2451. gbvrt108.seq - Other vertebrate sequence entries, part 108.
2452. gbvrt109.seq - Other vertebrate sequence entries, part 109.
2453. gbvrt11.seq - Other vertebrate sequence entries, part 11.
2454. gbvrt110.seq - Other vertebrate sequence entries, part 110.
2455. gbvrt111.seq - Other vertebrate sequence entries, part 111.
2456. gbvrt112.seq - Other vertebrate sequence entries, part 112.
2457. gbvrt113.seq - Other vertebrate sequence entries, part 113.
2458. gbvrt114.seq - Other vertebrate sequence entries, part 114.
2459. gbvrt115.seq - Other vertebrate sequence entries, part 115.
2460. gbvrt116.seq - Other vertebrate sequence entries, part 116.
2461. gbvrt117.seq - Other vertebrate sequence entries, part 117.
2462. gbvrt118.seq - Other vertebrate sequence entries, part 118.
2463. gbvrt119.seq - Other vertebrate sequence entries, part 119.
2464. gbvrt12.seq - Other vertebrate sequence entries, part 12.
2465. gbvrt120.seq - Other vertebrate sequence entries, part 120.
2466. gbvrt121.seq - Other vertebrate sequence entries, part 121.
2467. gbvrt122.seq - Other vertebrate sequence entries, part 122.
2468. gbvrt123.seq - Other vertebrate sequence entries, part 123.
2469. gbvrt124.seq - Other vertebrate sequence entries, part 124.
2470. gbvrt125.seq - Other vertebrate sequence entries, part 125.
2471. gbvrt126.seq - Other vertebrate sequence entries, part 126.
2472. gbvrt127.seq - Other vertebrate sequence entries, part 127.
2473. gbvrt128.seq - Other vertebrate sequence entries, part 128.
2474. gbvrt129.seq - Other vertebrate sequence entries, part 129.
2475. gbvrt13.seq - Other vertebrate sequence entries, part 13.
2476. gbvrt130.seq - Other vertebrate sequence entries, part 130.
2477. gbvrt131.seq - Other vertebrate sequence entries, part 131.
2478. gbvrt132.seq - Other vertebrate sequence entries, part 132.
2479. gbvrt133.seq - Other vertebrate sequence entries, part 133.
2480. gbvrt134.seq - Other vertebrate sequence entries, part 134.
2481. gbvrt135.seq - Other vertebrate sequence entries, part 135.
2482. gbvrt136.seq - Other vertebrate sequence entries, part 136.
2483. gbvrt137.seq - Other vertebrate sequence entries, part 137.
2484. gbvrt138.seq - Other vertebrate sequence entries, part 138.
2485. gbvrt139.seq - Other vertebrate sequence entries, part 139.
2486. gbvrt14.seq - Other vertebrate sequence entries, part 14.
2487. gbvrt140.seq - Other vertebrate sequence entries, part 140.
2488. gbvrt141.seq - Other vertebrate sequence entries, part 141.
2489. gbvrt142.seq - Other vertebrate sequence entries, part 142.
2490. gbvrt143.seq - Other vertebrate sequence entries, part 143.
2491. gbvrt144.seq - Other vertebrate sequence entries, part 144.
2492. gbvrt145.seq - Other vertebrate sequence entries, part 145.
2493. gbvrt146.seq - Other vertebrate sequence entries, part 146.
2494. gbvrt147.seq - Other vertebrate sequence entries, part 147.
2495. gbvrt148.seq - Other vertebrate sequence entries, part 148.
2496. gbvrt149.seq - Other vertebrate sequence entries, part 149.
2497. gbvrt15.seq - Other vertebrate sequence entries, part 15.
2498. gbvrt150.seq - Other vertebrate sequence entries, part 150.
2499. gbvrt151.seq - Other vertebrate sequence entries, part 151.
2500. gbvrt152.seq - Other vertebrate sequence entries, part 152.
2501. gbvrt153.seq - Other vertebrate sequence entries, part 153.
2502. gbvrt154.seq - Other vertebrate sequence entries, part 154.
2503. gbvrt155.seq - Other vertebrate sequence entries, part 155.
2504. gbvrt156.seq - Other vertebrate sequence entries, part 156.
2505. gbvrt157.seq - Other vertebrate sequence entries, part 157.
2506. gbvrt158.seq - Other vertebrate sequence entries, part 158.
2507. gbvrt159.seq - Other vertebrate sequence entries, part 159.
2508. gbvrt16.seq - Other vertebrate sequence entries, part 16.
2509. gbvrt160.seq - Other vertebrate sequence entries, part 160.
2510. gbvrt161.seq - Other vertebrate sequence entries, part 161.
2511. gbvrt17.seq - Other vertebrate sequence entries, part 17.
2512. gbvrt18.seq - Other vertebrate sequence entries, part 18.
2513. gbvrt19.seq - Other vertebrate sequence entries, part 19.
2514. gbvrt2.seq - Other vertebrate sequence entries, part 2.
2515. gbvrt20.seq - Other vertebrate sequence entries, part 20.
2516. gbvrt21.seq - Other vertebrate sequence entries, part 21.
2517. gbvrt22.seq - Other vertebrate sequence entries, part 22.
2518. gbvrt23.seq - Other vertebrate sequence entries, part 23.
2519. gbvrt24.seq - Other vertebrate sequence entries, part 24.
2520. gbvrt25.seq - Other vertebrate sequence entries, part 25.
2521. gbvrt26.seq - Other vertebrate sequence entries, part 26.
2522. gbvrt27.seq - Other vertebrate sequence entries, part 27.
2523. gbvrt28.seq - Other vertebrate sequence entries, part 28.
2524. gbvrt29.seq - Other vertebrate sequence entries, part 29.
2525. gbvrt3.seq - Other vertebrate sequence entries, part 3.
2526. gbvrt30.seq - Other vertebrate sequence entries, part 30.
2527. gbvrt31.seq - Other vertebrate sequence entries, part 31.
2528. gbvrt32.seq - Other vertebrate sequence entries, part 32.
2529. gbvrt33.seq - Other vertebrate sequence entries, part 33.
2530. gbvrt34.seq - Other vertebrate sequence entries, part 34.
2531. gbvrt35.seq - Other vertebrate sequence entries, part 35.
2532. gbvrt36.seq - Other vertebrate sequence entries, part 36.
2533. gbvrt37.seq - Other vertebrate sequence entries, part 37.
2534. gbvrt38.seq - Other vertebrate sequence entries, part 38.
2535. gbvrt39.seq - Other vertebrate sequence entries, part 39.
2536. gbvrt4.seq - Other vertebrate sequence entries, part 4.
2537. gbvrt40.seq - Other vertebrate sequence entries, part 40.
2538. gbvrt41.seq - Other vertebrate sequence entries, part 41.
2539. gbvrt42.seq - Other vertebrate sequence entries, part 42.
2540. gbvrt43.seq - Other vertebrate sequence entries, part 43.
2541. gbvrt44.seq - Other vertebrate sequence entries, part 44.
2542. gbvrt45.seq - Other vertebrate sequence entries, part 45.
2543. gbvrt46.seq - Other vertebrate sequence entries, part 46.
2544. gbvrt47.seq - Other vertebrate sequence entries, part 47.
2545. gbvrt48.seq - Other vertebrate sequence entries, part 48.
2546. gbvrt49.seq - Other vertebrate sequence entries, part 49.
2547. gbvrt5.seq - Other vertebrate sequence entries, part 5.
2548. gbvrt50.seq - Other vertebrate sequence entries, part 50.
2549. gbvrt51.seq - Other vertebrate sequence entries, part 51.
2550. gbvrt52.seq - Other vertebrate sequence entries, part 52.
2551. gbvrt53.seq - Other vertebrate sequence entries, part 53.
2552. gbvrt54.seq - Other vertebrate sequence entries, part 54.
2553. gbvrt55.seq - Other vertebrate sequence entries, part 55.
2554. gbvrt56.seq - Other vertebrate sequence entries, part 56.
2555. gbvrt57.seq - Other vertebrate sequence entries, part 57.
2556. gbvrt58.seq - Other vertebrate sequence entries, part 58.
2557. gbvrt59.seq - Other vertebrate sequence entries, part 59.
2558. gbvrt6.seq - Other vertebrate sequence entries, part 6.
2559. gbvrt60.seq - Other vertebrate sequence entries, part 60.
2560. gbvrt61.seq - Other vertebrate sequence entries, part 61.
2561. gbvrt62.seq - Other vertebrate sequence entries, part 62.
2562. gbvrt63.seq - Other vertebrate sequence entries, part 63.
2563. gbvrt64.seq - Other vertebrate sequence entries, part 64.
2564. gbvrt65.seq - Other vertebrate sequence entries, part 65.
2565. gbvrt66.seq - Other vertebrate sequence entries, part 66.
2566. gbvrt67.seq - Other vertebrate sequence entries, part 67.
2567. gbvrt68.seq - Other vertebrate sequence entries, part 68.
2568. gbvrt69.seq - Other vertebrate sequence entries, part 69.
2569. gbvrt7.seq - Other vertebrate sequence entries, part 7.
2570. gbvrt70.seq - Other vertebrate sequence entries, part 70.
2571. gbvrt71.seq - Other vertebrate sequence entries, part 71.
2572. gbvrt72.seq - Other vertebrate sequence entries, part 72.
2573. gbvrt73.seq - Other vertebrate sequence entries, part 73.
2574. gbvrt74.seq - Other vertebrate sequence entries, part 74.
2575. gbvrt75.seq - Other vertebrate sequence entries, part 75.
2576. gbvrt76.seq - Other vertebrate sequence entries, part 76.
2577. gbvrt77.seq - Other vertebrate sequence entries, part 77.
2578. gbvrt78.seq - Other vertebrate sequence entries, part 78.
2579. gbvrt79.seq - Other vertebrate sequence entries, part 79.
2580. gbvrt8.seq - Other vertebrate sequence entries, part 8.
2581. gbvrt80.seq - Other vertebrate sequence entries, part 80.
2582. gbvrt81.seq - Other vertebrate sequence entries, part 81.
2583. gbvrt82.seq - Other vertebrate sequence entries, part 82.
2584. gbvrt83.seq - Other vertebrate sequence entries, part 83.
2585. gbvrt84.seq - Other vertebrate sequence entries, part 84.
2586. gbvrt85.seq - Other vertebrate sequence entries, part 85.
2587. gbvrt86.seq - Other vertebrate sequence entries, part 86.
2588. gbvrt87.seq - Other vertebrate sequence entries, part 87.
2589. gbvrt88.seq - Other vertebrate sequence entries, part 88.
2590. gbvrt89.seq - Other vertebrate sequence entries, part 89.
2591. gbvrt9.seq - Other vertebrate sequence entries, part 9.
2592. gbvrt90.seq - Other vertebrate sequence entries, part 90.
2593. gbvrt91.seq - Other vertebrate sequence entries, part 91.
2594. gbvrt92.seq - Other vertebrate sequence entries, part 92.
2595. gbvrt93.seq - Other vertebrate sequence entries, part 93.
2596. gbvrt94.seq - Other vertebrate sequence entries, part 94.
2597. gbvrt95.seq - Other vertebrate sequence entries, part 95.
2598. gbvrt96.seq - Other vertebrate sequence entries, part 96.
2599. gbvrt97.seq - Other vertebrate sequence entries, part 97.
2600. gbvrt98.seq - Other vertebrate sequence entries, part 98.
2601. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 236.0 flatfiles require roughly 1117 GB, including
the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 497694929     gbbct1.seq
 497248100     gbbct10.seq
 493221786     gbbct100.seq
 496768241     gbbct101.seq
  99480276     gbbct102.seq
 499009965     gbbct103.seq
 494100520     gbbct104.seq
 493995328     gbbct105.seq
 330551071     gbbct106.seq
 499808474     gbbct107.seq
 493011399     gbbct108.seq
 496289356     gbbct109.seq
 499941281     gbbct11.seq
 426871432     gbbct110.seq
 499127538     gbbct111.seq
 496815994     gbbct112.seq
 491164593     gbbct113.seq
 499967572     gbbct114.seq
 494097398     gbbct115.seq
 498973428     gbbct116.seq
 340555918     gbbct117.seq
 498287206     gbbct118.seq
 489447997     gbbct119.seq
 450910061     gbbct12.seq
 499733988     gbbct120.seq
 461297185     gbbct121.seq
 497409553     gbbct122.seq
 494975657     gbbct123.seq
 491934673     gbbct124.seq
 495712273     gbbct125.seq
 491727782     gbbct126.seq
 147978654     gbbct127.seq
 496895924     gbbct128.seq
 497684367     gbbct129.seq
 499887127     gbbct13.seq
 499142466     gbbct130.seq
 497972016     gbbct131.seq
 352908124     gbbct132.seq
 496996630     gbbct133.seq
 491129522     gbbct134.seq
 499826718     gbbct135.seq
 487897811     gbbct136.seq
 488248698     gbbct137.seq
 319203664     gbbct138.seq
 497654975     gbbct139.seq
 499212505     gbbct14.seq
 497792257     gbbct140.seq
 497162125     gbbct141.seq
 492586153     gbbct142.seq
 492717084     gbbct143.seq
 497402086     gbbct144.seq
  98410354     gbbct145.seq
 494733565     gbbct146.seq
 491542084     gbbct147.seq
 495159023     gbbct148.seq
 463875931     gbbct149.seq
 496478899     gbbct15.seq
 497456114     gbbct150.seq
 496989515     gbbct151.seq
 499809002     gbbct152.seq
 469341124     gbbct153.seq
 490319066     gbbct154.seq
 497884110     gbbct155.seq
 498282134     gbbct156.seq
 492406351     gbbct157.seq
 148663336     gbbct158.seq
 494475784     gbbct159.seq
 376883556     gbbct16.seq
 492902070     gbbct160.seq
 499251741     gbbct161.seq
 260566716     gbbct162.seq
 495003538     gbbct163.seq
 495930726     gbbct164.seq
 489789224     gbbct165.seq
 303707273     gbbct166.seq
 499224644     gbbct167.seq
 489057928     gbbct168.seq
 490004710     gbbct169.seq
 497001094     gbbct17.seq
 496107126     gbbct170.seq
  22289657     gbbct171.seq
 497959339     gbbct172.seq
 499409844     gbbct173.seq
 489348074     gbbct174.seq
 489046965     gbbct175.seq
 498720831     gbbct176.seq
 180648099     gbbct177.seq
 497820665     gbbct178.seq
 496360795     gbbct179.seq
 497219212     gbbct18.seq
 494749363     gbbct180.seq
 499578120     gbbct181.seq
 265632471     gbbct182.seq
 499905804     gbbct183.seq
 492390539     gbbct184.seq
 494865598     gbbct185.seq
 496253243     gbbct186.seq
 176738759     gbbct187.seq
 489278103     gbbct188.seq
 489461339     gbbct189.seq
 487367622     gbbct19.seq
 499104833     gbbct190.seq
 493004928     gbbct191.seq
 374611001     gbbct192.seq
 499899454     gbbct193.seq
 496011176     gbbct194.seq
 492245360     gbbct195.seq
 494356189     gbbct196.seq
 486636728     gbbct197.seq
 491836466     gbbct198.seq
 279102544     gbbct199.seq
 496416257     gbbct2.seq
 432490331     gbbct20.seq
 496984804     gbbct200.seq
 497245372     gbbct201.seq
 489436339     gbbct202.seq
 372443501     gbbct203.seq
 484832251     gbbct204.seq
 495623949     gbbct205.seq
 499614783     gbbct206.seq
 498653455     gbbct207.seq
 213706266     gbbct208.seq
 493985626     gbbct209.seq
  21406464     gbbct21.seq
 488857651     gbbct210.seq
 489146308     gbbct211.seq
 160110174     gbbct212.seq
 493892096     gbbct213.seq
 487708565     gbbct214.seq
 498455366     gbbct215.seq
 496216347     gbbct216.seq
 103775238     gbbct217.seq
 494063240     gbbct218.seq
 488280349     gbbct219.seq
  38647261     gbbct22.seq
 499476642     gbbct220.seq
 495038861     gbbct221.seq
  86123706     gbbct222.seq
 495740279     gbbct223.seq
 488540563     gbbct224.seq
 493358953     gbbct225.seq
 432920341     gbbct226.seq
 492193654     gbbct227.seq
 487559300     gbbct228.seq
 492442578     gbbct229.seq
 499379455     gbbct23.seq
 446264646     gbbct230.seq
 499744106     gbbct231.seq
 495907353     gbbct232.seq
 499389515     gbbct233.seq
 487062552     gbbct234.seq
 496278981     gbbct235.seq
   4135805     gbbct236.seq
 491982516     gbbct237.seq
 486611110     gbbct238.seq
 485342602     gbbct239.seq
 498625838     gbbct24.seq
 489199337     gbbct240.seq
 494637539     gbbct241.seq
 495765174     gbbct242.seq
 493991451     gbbct243.seq
 348078813     gbbct244.seq
 495808325     gbbct245.seq
 498958389     gbbct246.seq
 489241352     gbbct247.seq
 493387357     gbbct248.seq
 490720058     gbbct249.seq
 493046949     gbbct25.seq
 474152548     gbbct250.seq
 493492255     gbbct251.seq
 498755204     gbbct252.seq
 494675536     gbbct253.seq
 499599056     gbbct254.seq
 499428464     gbbct255.seq
 497744926     gbbct256.seq
 390336802     gbbct257.seq
 497354454     gbbct258.seq
 498059757     gbbct259.seq
 498804260     gbbct26.seq
 493852418     gbbct260.seq
 488745829     gbbct261.seq
 495055381     gbbct262.seq
 499313034     gbbct263.seq
 490358026     gbbct264.seq
  66580889     gbbct265.seq
 498794238     gbbct266.seq
 489589591     gbbct267.seq
 499610805     gbbct268.seq
 497086332     gbbct269.seq
 140148095     gbbct27.seq
 491221105     gbbct270.seq
 495573229     gbbct271.seq
  18878099     gbbct272.seq
 496902442     gbbct273.seq
 496475162     gbbct274.seq
 498011881     gbbct275.seq
 486877306     gbbct276.seq
 244489668     gbbct277.seq
 498731800     gbbct278.seq
 494548526     gbbct279.seq
 495707167     gbbct28.seq
 495023734     gbbct280.seq
 496974812     gbbct281.seq
 264597373     gbbct282.seq
 496342244     gbbct283.seq
 498375728     gbbct284.seq
 497541023     gbbct285.seq
 490849779     gbbct286.seq
 371569692     gbbct287.seq
 494879987     gbbct288.seq
 498534139     gbbct289.seq
 495625627     gbbct29.seq
 487237999     gbbct290.seq
 496782541     gbbct291.seq
 276825797     gbbct292.seq
 491214895     gbbct293.seq
 498475589     gbbct294.seq
 494808359     gbbct295.seq
 492878893     gbbct296.seq
 380739758     gbbct297.seq
 492963349     gbbct298.seq
 490743482     gbbct299.seq
 301354698     gbbct3.seq
 493145433     gbbct30.seq
 495191635     gbbct300.seq
 489786247     gbbct301.seq
 488473173     gbbct302.seq
 495735086     gbbct303.seq
 393039505     gbbct304.seq
 491793247     gbbct305.seq
 494615002     gbbct306.seq
 499880520     gbbct307.seq
 499481343     gbbct308.seq
 493061421     gbbct309.seq
 488228504     gbbct31.seq
 166424564     gbbct310.seq
 495625572     gbbct311.seq
 495665310     gbbct312.seq
 499733342     gbbct313.seq
 494200889     gbbct314.seq
 454460627     gbbct315.seq
 491323541     gbbct316.seq
 498035454     gbbct317.seq
 493186840     gbbct318.seq
 498662938     gbbct319.seq
 498591589     gbbct32.seq
  74368643     gbbct320.seq
 494266373     gbbct321.seq
 499695657     gbbct322.seq
 499270117     gbbct323.seq
 494104381     gbbct324.seq
 340463899     gbbct325.seq
 493834916     gbbct326.seq
 496242961     gbbct327.seq
 492929505     gbbct328.seq
 499997777     gbbct329.seq
 498269876     gbbct33.seq
 496856951     gbbct330.seq
 497681989     gbbct331.seq
 499889462     gbbct332.seq
    170206     gbbct333.seq
 494310084     gbbct334.seq
 489483147     gbbct335.seq
 493172360     gbbct336.seq
 495468213     gbbct337.seq
 319884891     gbbct338.seq
 495552795     gbbct339.seq
 102625719     gbbct34.seq
 492141941     gbbct340.seq
 487367084     gbbct341.seq
 497289223     gbbct342.seq
 331315993     gbbct343.seq
 498764062     gbbct344.seq
 496795080     gbbct345.seq
 499438907     gbbct346.seq
 496143421     gbbct347.seq
  62640034     gbbct348.seq
 493335978     gbbct349.seq
 498942355     gbbct35.seq
 499349156     gbbct350.seq
 499196786     gbbct351.seq
 448825532     gbbct352.seq
 494364363     gbbct353.seq
 493922915     gbbct354.seq
 493724025     gbbct355.seq
 489855153     gbbct356.seq
 329275938     gbbct357.seq
 305674132     gbbct358.seq
   6886295     gbbct359.seq
 483799826     gbbct36.seq
  14158267     gbbct360.seq
  22775313     gbbct361.seq
  44460158     gbbct362.seq
  86545108     gbbct363.seq
 168390436     gbbct364.seq
 499998709     gbbct365.seq
 492712309     gbbct366.seq
 499468365     gbbct367.seq
 499999777     gbbct368.seq
 498741068     gbbct369.seq
 492232233     gbbct37.seq
 499998093     gbbct370.seq
 492472299     gbbct371.seq
 499999729     gbbct372.seq
 475777738     gbbct373.seq
 499999829     gbbct374.seq
 289671350     gbbct375.seq
 500000127     gbbct376.seq
  84755368     gbbct377.seq
 500000131     gbbct378.seq
 121977971     gbbct379.seq
 498367716     gbbct38.seq
 499631152     gbbct380.seq
  42167715     gbbct381.seq
 144309015     gbbct382.seq
 499765852     gbbct383.seq
 416781434     gbbct384.seq
 494824246     gbbct385.seq
 489907151     gbbct386.seq
 493630013     gbbct387.seq
 495884649     gbbct388.seq
 492496029     gbbct389.seq
 495960763     gbbct39.seq
 486783136     gbbct390.seq
 290368121     gbbct391.seq
 494895218     gbbct392.seq
 496980492     gbbct393.seq
 495645587     gbbct394.seq
 163415039     gbbct395.seq
 482328991     gbbct396.seq
 493775130     gbbct397.seq
 494263864     gbbct398.seq
 496945779     gbbct399.seq
 394488268     gbbct4.seq
 487878136     gbbct40.seq
 396472884     gbbct400.seq
 499863488     gbbct401.seq
 496189313     gbbct402.seq
 493867002     gbbct403.seq
 243600310     gbbct404.seq
 490662494     gbbct405.seq
 496189805     gbbct406.seq
 497991262     gbbct407.seq
 497827843     gbbct408.seq
 104532282     gbbct409.seq
 497649418     gbbct41.seq
 495008611     gbbct410.seq
 489822962     gbbct411.seq
 498830703     gbbct412.seq
 438982093     gbbct413.seq
  51149414     gbbct414.seq
 107547788     gbbct415.seq
 499897144     gbbct416.seq
 499998561     gbbct417.seq
 277397304     gbbct418.seq
 497404564     gbbct42.seq
 493182229     gbbct43.seq
 497804505     gbbct44.seq
 494730115     gbbct45.seq
 496133974     gbbct46.seq
 232820696     gbbct47.seq
 498095953     gbbct48.seq
 499070983     gbbct49.seq
 459374674     gbbct5.seq
 496563646     gbbct50.seq
 496181309     gbbct51.seq
 499752271     gbbct52.seq
 490382193     gbbct53.seq
 257412756     gbbct54.seq
 499969240     gbbct55.seq
 495918623     gbbct56.seq
 486285362     gbbct57.seq
 493006700     gbbct58.seq
 475857375     gbbct59.seq
 102226062     gbbct6.seq
 490137947     gbbct60.seq
 485837799     gbbct61.seq
 498334986     gbbct62.seq
 496793887     gbbct63.seq
 285020162     gbbct64.seq
 491474028     gbbct65.seq
 494313903     gbbct66.seq
 495819854     gbbct67.seq
 498720135     gbbct68.seq
 499103370     gbbct69.seq
 282429542     gbbct7.seq
 261686730     gbbct70.seq
 498130877     gbbct71.seq
 499517858     gbbct72.seq
 498962056     gbbct73.seq
 488107655     gbbct74.seq
 397950576     gbbct75.seq
 494946851     gbbct76.seq
 498005046     gbbct77.seq
 496847170     gbbct78.seq
 279765912     gbbct79.seq
 499570911     gbbct8.seq
 499907115     gbbct80.seq
 495464406     gbbct81.seq
 496856433     gbbct82.seq
  74830140     gbbct83.seq
 489628390     gbbct84.seq
 498992614     gbbct85.seq
 499931721     gbbct86.seq
 389027426     gbbct87.seq
 499874268     gbbct88.seq
 498124187     gbbct89.seq
 496091777     gbbct9.seq
 499291582     gbbct90.seq
 491407782     gbbct91.seq
  13752575     gbbct92.seq
 493588275     gbbct93.seq
 494745394     gbbct94.seq
 495415807     gbbct95.seq
 491067740     gbbct96.seq
 195549943     gbbct97.seq
 494137425     gbbct98.seq
 492528795     gbbct99.seq
    980196     gbchg.txt
 499832076     gbcon1.seq
 498554289     gbcon10.seq
 499971872     gbcon100.seq
 499740663     gbcon101.seq
 499864554     gbcon102.seq
 499997197     gbcon103.seq
 260691384     gbcon104.seq
 499972783     gbcon105.seq
 499999136     gbcon106.seq
 451665812     gbcon107.seq
 499998941     gbcon108.seq
 499999369     gbcon109.seq
 496554615     gbcon11.seq
 165579592     gbcon110.seq
 499826934     gbcon111.seq
 499997991     gbcon112.seq
 499873117     gbcon113.seq
 294025604     gbcon114.seq
 499999876     gbcon115.seq
 499999395     gbcon116.seq
 222253215     gbcon117.seq
  45836617     gbcon118.seq
 499942435     gbcon119.seq
 498783972     gbcon12.seq
 499998047     gbcon120.seq
 447234824     gbcon121.seq
 499999748     gbcon122.seq
 499998377     gbcon123.seq
 499998762     gbcon124.seq
 196133977     gbcon125.seq
 499995599     gbcon126.seq
 499999259     gbcon127.seq
 238748401     gbcon128.seq
 499999467     gbcon129.seq
 498934914     gbcon13.seq
 466686969     gbcon130.seq
 499998370     gbcon131.seq
 499999385     gbcon132.seq
 267110358     gbcon133.seq
 499998162     gbcon134.seq
 499925284     gbcon135.seq
 499999753     gbcon136.seq
  17660978     gbcon137.seq
 499998880     gbcon138.seq
 499999381     gbcon139.seq
 496033427     gbcon14.seq
 179138423     gbcon140.seq
 499998502     gbcon141.seq
 499999166     gbcon142.seq
  22645865     gbcon143.seq
 499889958     gbcon144.seq
 500000058     gbcon145.seq
 410613820     gbcon146.seq
 499941939     gbcon147.seq
 499998956     gbcon148.seq
 376844480     gbcon149.seq
 494743159     gbcon15.seq
 499993470     gbcon150.seq
 499947973     gbcon151.seq
 367317241     gbcon152.seq
 499998515     gbcon153.seq
 499968061     gbcon154.seq
 135774400     gbcon155.seq
 499999960     gbcon156.seq
 499952504     gbcon157.seq
 499999989     gbcon158.seq
 144765078     gbcon159.seq
 245900545     gbcon16.seq
 499830763     gbcon160.seq
 499983832     gbcon161.seq
 499967502     gbcon162.seq
 336211019     gbcon163.seq
 500000036     gbcon164.seq
 499999888     gbcon165.seq
 407940284     gbcon166.seq
 499999531     gbcon167.seq
 499999263     gbcon168.seq
 500000209     gbcon169.seq
 499998137     gbcon17.seq
 271447930     gbcon170.seq
 499999711     gbcon171.seq
 500000152     gbcon172.seq
 499494918     gbcon173.seq
 499999031     gbcon174.seq
 162053205     gbcon175.seq
 499998428     gbcon176.seq
 499996005     gbcon177.seq
 130453890     gbcon178.seq
 499993701     gbcon179.seq
 499998852     gbcon18.seq
 499997282     gbcon180.seq
 499999536     gbcon181.seq
 288339936     gbcon182.seq
 499966436     gbcon183.seq
 499999572     gbcon184.seq
 454547491     gbcon185.seq
 499998108     gbcon186.seq
 499986557     gbcon187.seq
 372072815     gbcon188.seq
 499933329     gbcon189.seq
 499999439     gbcon19.seq
 499997668     gbcon190.seq
 499997845     gbcon191.seq
 168056267     gbcon192.seq
 499998392     gbcon193.seq
 499998932     gbcon194.seq
  37638463     gbcon195.seq
 499997011     gbcon196.seq
 499999104     gbcon197.seq
 499999231     gbcon198.seq
 500000076     gbcon199.seq
 499997845     gbcon2.seq
  81389816     gbcon20.seq
 499999427     gbcon200.seq
 119194110     gbcon201.seq
 499999559     gbcon202.seq
 459353155     gbcon203.seq
 499969472     gbcon204.seq
 499999048     gbcon205.seq
 478401565     gbcon206.seq
 499999012     gbcon207.seq
 499997814     gbcon208.seq
 499998779     gbcon209.seq
 499998430     gbcon21.seq
  16784515     gbcon210.seq
 499951654     gbcon211.seq
 499976499     gbcon212.seq
 499998286     gbcon213.seq
 499889669     gbcon214.seq
 499760613     gbcon215.seq
 164601503     gbcon216.seq
 499999456     gbcon22.seq
 499574989     gbcon23.seq
 285557284     gbcon24.seq
 499480316     gbcon25.seq
 125744383     gbcon26.seq
 126416238     gbcon27.seq
 499928931     gbcon28.seq
 499992465     gbcon29.seq
 499997799     gbcon3.seq
  26152220     gbcon30.seq
 499999414     gbcon31.seq
 499998297     gbcon32.seq
 443984851     gbcon33.seq
 499999057     gbcon34.seq
 499998568     gbcon35.seq
 499999100     gbcon36.seq
  41918782     gbcon37.seq
 500000081     gbcon38.seq
 499998540     gbcon39.seq
 106483843     gbcon4.seq
 277009775     gbcon40.seq
 499996336     gbcon41.seq
 499998469     gbcon42.seq
 270612827     gbcon43.seq
 499996532     gbcon44.seq
 499996905     gbcon45.seq
 385374935     gbcon46.seq
 499997390     gbcon47.seq
 499999185     gbcon48.seq
 176580283     gbcon49.seq
 499901495     gbcon5.seq
 499999848     gbcon50.seq
 499997718     gbcon51.seq
 238773972     gbcon52.seq
 499997628     gbcon53.seq
 499995125     gbcon54.seq
 335698760     gbcon55.seq
 499996299     gbcon56.seq
 499999132     gbcon57.seq
 298461041     gbcon58.seq
 499995314     gbcon59.seq
 494317502     gbcon6.seq
 499999014     gbcon60.seq
 259899669     gbcon61.seq
 499996880     gbcon62.seq
 499997062     gbcon63.seq
 187377116     gbcon64.seq
 499996720     gbcon65.seq
 499999826     gbcon66.seq
 364586197     gbcon67.seq
 499993696     gbcon68.seq
 499999904     gbcon69.seq
 494412876     gbcon7.seq
 386119955     gbcon70.seq
 499993762     gbcon71.seq
 472787618     gbcon72.seq
 173591654     gbcon73.seq
 500000181     gbcon74.seq
  44558730     gbcon75.seq
 499984854     gbcon76.seq
 203591372     gbcon77.seq
 199578872     gbcon78.seq
 499311564     gbcon79.seq
 499931008     gbcon8.seq
 499997237     gbcon80.seq
 387425533     gbcon81.seq
 499527910     gbcon82.seq
 495870137     gbcon83.seq
 499840683     gbcon84.seq
 337814172     gbcon85.seq
 499924585     gbcon86.seq
 499991688     gbcon87.seq
 499998899     gbcon88.seq
 229249315     gbcon89.seq
  69828693     gbcon9.seq
 499999253     gbcon90.seq
 500000194     gbcon91.seq
 132406181     gbcon92.seq
 499992704     gbcon93.seq
 499999412     gbcon94.seq
 499997441     gbcon95.seq
 264998754     gbcon96.seq
 499997061     gbcon97.seq
 499998947     gbcon98.seq
 181389182     gbcon99.seq
    326659     gbdel.txt
 499998731     gbenv1.seq
 500000183     gbenv10.seq
 499999179     gbenv11.seq
 495400621     gbenv12.seq
 499999620     gbenv13.seq
 499999685     gbenv14.seq
 173621412     gbenv15.seq
 499944950     gbenv16.seq
 499999595     gbenv17.seq
 499999022     gbenv18.seq
  70765201     gbenv19.seq
 499997477     gbenv2.seq
 499999397     gbenv20.seq
 499998807     gbenv21.seq
 177802006     gbenv22.seq
 499998650     gbenv23.seq
 499999769     gbenv24.seq
 499999361     gbenv25.seq
  46283713     gbenv26.seq
 499998471     gbenv27.seq
 500000072     gbenv28.seq
 192146906     gbenv29.seq
 499999631     gbenv3.seq
 499994242     gbenv30.seq
 499999157     gbenv31.seq
 333517839     gbenv32.seq
 499999730     gbenv33.seq
 499998061     gbenv34.seq
 463460292     gbenv35.seq
 499999707     gbenv36.seq
 499998971     gbenv37.seq
 334800011     gbenv38.seq
 499997627     gbenv39.seq
 499999351     gbenv4.seq
 499998999     gbenv40.seq
 393753856     gbenv41.seq
 499998450     gbenv42.seq
 499998336     gbenv43.seq
 340570051     gbenv44.seq
 499999946     gbenv45.seq
 499997544     gbenv46.seq
 237876007     gbenv47.seq
 499998968     gbenv48.seq
 499999098     gbenv49.seq
  76522112     gbenv5.seq
 381000343     gbenv50.seq
 499999510     gbenv51.seq
 499999586     gbenv52.seq
 494570198     gbenv53.seq
 499999058     gbenv54.seq
 499999582     gbenv55.seq
 224990779     gbenv56.seq
 499999455     gbenv57.seq
 499992739     gbenv58.seq
 471315369     gbenv59.seq
 500000203     gbenv6.seq
 499997837     gbenv7.seq
  53731110     gbenv8.seq
 499999758     gbenv9.seq
 499997544     gbest1.seq
 499997880     gbest10.seq
 499999304     gbest100.seq
 499999070     gbest101.seq
 499997497     gbest102.seq
 499998786     gbest103.seq
  24991691     gbest104.seq
 499997691     gbest105.seq
 499999900     gbest106.seq
 499997850     gbest107.seq
 499999093     gbest108.seq
   9359782     gbest109.seq
 499998301     gbest11.seq
 499998587     gbest110.seq
 499997153     gbest111.seq
 499998009     gbest112.seq
 499999725     gbest113.seq
  23587749     gbest114.seq
 499998597     gbest115.seq
 499998248     gbest116.seq
 499998513     gbest117.seq
  11662882     gbest118.seq
 499997809     gbest119.seq
 474178816     gbest12.seq
 499997466     gbest120.seq
 499997861     gbest121.seq
  68177058     gbest122.seq
 499994263     gbest123.seq
 499997786     gbest124.seq
 223701769     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499999935     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 499998259     gbest135.seq
 499997142     gbest136.seq
 499998046     gbest137.seq
  98110136     gbest138.seq
 499998442     gbest139.seq
 249649695     gbest14.seq
 499997223     gbest140.seq
 499998444     gbest141.seq
 499997743     gbest142.seq
  24910309     gbest143.seq
 499997669     gbest144.seq
 499999437     gbest145.seq
 499998859     gbest146.seq
 499998474     gbest147.seq
  30215981     gbest148.seq
 499999670     gbest149.seq
 499998856     gbest15.seq
 500000231     gbest150.seq
 499997992     gbest151.seq
 322143508     gbest152.seq
 499997320     gbest153.seq
 499999385     gbest154.seq
 500000038     gbest155.seq
 499998234     gbest156.seq
  21491766     gbest157.seq
 499999702     gbest158.seq
 499999521     gbest159.seq
 499999798     gbest16.seq
 499996841     gbest160.seq
 499998882     gbest161.seq
   9723108     gbest162.seq
 499999412     gbest163.seq
 500000006     gbest164.seq
 499997360     gbest165.seq
 499996336     gbest166.seq
  81988721     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 420834751     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499999958     gbest174.seq
 499997684     gbest175.seq
 499999843     gbest176.seq
  66106728     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499998530     gbest18.seq
 500000063     gbest180.seq
 499999576     gbest181.seq
 499996415     gbest182.seq
 499999507     gbest183.seq
  42372888     gbest184.seq
 499997635     gbest185.seq
 499998365     gbest186.seq
 499996618     gbest187.seq
 499997352     gbest188.seq
  40876780     gbest189.seq
 499997415     gbest19.seq
 499998666     gbest190.seq
 499999919     gbest191.seq
 499998357     gbest192.seq
 499999708     gbest193.seq
  12146790     gbest194.seq
 499999587     gbest195.seq
 499999121     gbest196.seq
 499998985     gbest197.seq
 499996194     gbest198.seq
  25113925     gbest199.seq
 499998652     gbest2.seq
 260119709     gbest20.seq
 499998542     gbest200.seq
 499996677     gbest201.seq
 500000042     gbest202.seq
 499997977     gbest203.seq
  30654152     gbest204.seq
  13610371     gbest205.seq
 499999221     gbest206.seq
 499998120     gbest207.seq
 328280744     gbest208.seq
 499997323     gbest209.seq
 499995671     gbest21.seq
 499995929     gbest210.seq
 316764106     gbest211.seq
 499998724     gbest212.seq
 499997386     gbest213.seq
 265240100     gbest214.seq
 499999161     gbest215.seq
 499998973     gbest216.seq
 268025739     gbest217.seq
 499996246     gbest218.seq
 499999806     gbest219.seq
 499999500     gbest22.seq
 499997963     gbest220.seq
 500000123     gbest221.seq
  48985942     gbest222.seq
 499999312     gbest223.seq
 499999407     gbest224.seq
 499999479     gbest225.seq
 499995116     gbest226.seq
  46446852     gbest227.seq
 499999053     gbest228.seq
 499996806     gbest229.seq
 242267336     gbest23.seq
 174825403     gbest230.seq
 499997907     gbest231.seq
 499999624     gbest232.seq
 499999509     gbest233.seq
 478341574     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499998838     gbest24.seq
 499999466     gbest240.seq
 499997560     gbest241.seq
 495413728     gbest242.seq
 499998531     gbest243.seq
 499998185     gbest244.seq
 499999561     gbest245.seq
 499998790     gbest246.seq
  24180385     gbest247.seq
 499998136     gbest248.seq
 499998098     gbest249.seq
 499997816     gbest25.seq
 490852740     gbest250.seq
 499995571     gbest251.seq
 499998200     gbest252.seq
 499999520     gbest253.seq
 499997474     gbest254.seq
  15354105     gbest255.seq
 499996076     gbest256.seq
 499997043     gbest257.seq
 499999129     gbest258.seq
 499998673     gbest259.seq
 499999429     gbest26.seq
  72804897     gbest260.seq
 499997472     gbest261.seq
 499997390     gbest262.seq
 499998343     gbest263.seq
 499999664     gbest264.seq
  10778405     gbest265.seq
 499997806     gbest266.seq
 499999532     gbest267.seq
 499999492     gbest268.seq
 499999837     gbest269.seq
 499998571     gbest27.seq
  50717151     gbest270.seq
 499999016     gbest271.seq
 499998969     gbest272.seq
 499998846     gbest273.seq
 119014210     gbest274.seq
 499997034     gbest275.seq
 499998984     gbest276.seq
 499999114     gbest277.seq
 499997896     gbest278.seq
  50688776     gbest279.seq
  48265826     gbest28.seq
 499999317     gbest280.seq
 499997412     gbest281.seq
 499998676     gbest282.seq
 499999719     gbest283.seq
  55628580     gbest284.seq
 499998624     gbest285.seq
 499999705     gbest286.seq
 499995920     gbest287.seq
 499996612     gbest288.seq
  11304703     gbest289.seq
 499999995     gbest29.seq
 499997952     gbest290.seq
 499999795     gbest291.seq
 499999462     gbest292.seq
 499999004     gbest293.seq
  25192615     gbest294.seq
 499998596     gbest295.seq
 499999758     gbest296.seq
 485611090     gbest297.seq
 499997447     gbest298.seq
 499998368     gbest299.seq
 499999348     gbest3.seq
 499998086     gbest30.seq
 499999080     gbest300.seq
 499998825     gbest301.seq
   5318213     gbest302.seq
 499999538     gbest303.seq
 499999813     gbest304.seq
 499998715     gbest305.seq
 499997626     gbest306.seq
   7751764     gbest307.seq
 499998952     gbest308.seq
 499998801     gbest309.seq
 499998784     gbest31.seq
 499997247     gbest310.seq
 421290158     gbest311.seq
 499999810     gbest312.seq
 499999610     gbest313.seq
 499997603     gbest314.seq
 495919364     gbest315.seq
 499998773     gbest316.seq
 499997415     gbest317.seq
 467912070     gbest318.seq
 499999035     gbest319.seq
 486435073     gbest32.seq
 499999258     gbest320.seq
 499999978     gbest321.seq
 499999435     gbest322.seq
  39514259     gbest323.seq
 500000256     gbest324.seq
 499998824     gbest325.seq
 499998088     gbest326.seq
 493104551     gbest327.seq
 499998749     gbest328.seq
 499997759     gbest329.seq
 499998178     gbest33.seq
 499999540     gbest330.seq
 499997875     gbest331.seq
  54900833     gbest332.seq
 499999943     gbest333.seq
 499999960     gbest334.seq
 499998379     gbest335.seq
 469183035     gbest336.seq
 499998299     gbest337.seq
 500000013     gbest338.seq
 499999184     gbest339.seq
 499997642     gbest34.seq
 499996505     gbest340.seq
  18186152     gbest341.seq
 499999196     gbest342.seq
 491105999     gbest343.seq
 499998133     gbest344.seq
 499999973     gbest345.seq
 499997585     gbest346.seq
 499998101     gbest347.seq
   5414791     gbest348.seq
 499996833     gbest349.seq
 500000178     gbest35.seq
 499998120     gbest350.seq
 499998274     gbest351.seq
 445223218     gbest352.seq
 499998629     gbest353.seq
 500000207     gbest354.seq
 499999612     gbest355.seq
 387609675     gbest356.seq
 499998924     gbest357.seq
 499998310     gbest358.seq
 499997427     gbest359.seq
 464658398     gbest36.seq
 499998071     gbest360.seq
  20572711     gbest361.seq
 499998188     gbest362.seq
 500000152     gbest363.seq
 499997517     gbest364.seq
 499999296     gbest365.seq
  55347028     gbest366.seq
 166258344     gbest367.seq
 499998124     gbest368.seq
 499999211     gbest369.seq
 499998459     gbest37.seq
 499998612     gbest370.seq
 499999327     gbest371.seq
  86045134     gbest372.seq
 499997252     gbest373.seq
 499999842     gbest374.seq
 499997446     gbest375.seq
 499996815     gbest376.seq
 164840295     gbest377.seq
 499999594     gbest378.seq
 499999390     gbest379.seq
 499998008     gbest38.seq
 499998915     gbest380.seq
 499997796     gbest381.seq
 152097432     gbest382.seq
 499997221     gbest383.seq
 499999329     gbest384.seq
 499997189     gbest385.seq
 497166354     gbest386.seq
 499997498     gbest387.seq
 499998709     gbest388.seq
 499998596     gbest389.seq
 499997178     gbest39.seq
  64052070     gbest390.seq
 499998385     gbest391.seq
 499998728     gbest392.seq
 499996496     gbest393.seq
 499997691     gbest394.seq
  83414510     gbest395.seq
 499996944     gbest396.seq
 499997015     gbest397.seq
 499998636     gbest398.seq
 499997858     gbest399.seq
 434600055     gbest4.seq
 499997938     gbest40.seq
  85809127     gbest400.seq
 499997855     gbest401.seq
 499998092     gbest402.seq
 499999582     gbest403.seq
 499998843     gbest404.seq
  50565406     gbest405.seq
 499998820     gbest406.seq
 499997816     gbest407.seq
 499999702     gbest408.seq
 499997206     gbest409.seq
 191357351     gbest41.seq
  90214994     gbest410.seq
 499998673     gbest411.seq
 499998288     gbest412.seq
 499996967     gbest413.seq
 499996677     gbest414.seq
 124589880     gbest415.seq
 499998079     gbest416.seq
 328943837     gbest417.seq
 500000254     gbest418.seq
 499998835     gbest419.seq
 499997364     gbest42.seq
 499999607     gbest420.seq
 500000112     gbest421.seq
  54509541     gbest422.seq
 499999330     gbest423.seq
 499999774     gbest424.seq
 499996219     gbest425.seq
 409977293     gbest426.seq
 499997260     gbest427.seq
 499999283     gbest428.seq
 335979604     gbest429.seq
 499997237     gbest43.seq
 499999961     gbest430.seq
 500000227     gbest431.seq
 261230544     gbest432.seq
 499999296     gbest433.seq
 499998341     gbest434.seq
 458264768     gbest435.seq
 499998830     gbest436.seq
 500000090     gbest437.seq
 307334807     gbest438.seq
 499997288     gbest439.seq
 499997245     gbest44.seq
 499999169     gbest440.seq
 329772669     gbest441.seq
 499997075     gbest442.seq
 499998558     gbest443.seq
 187654716     gbest444.seq
 499999916     gbest445.seq
 499997943     gbest446.seq
 118594788     gbest447.seq
 499998627     gbest448.seq
 500000126     gbest449.seq
 499996431     gbest45.seq
 140963965     gbest450.seq
 500000200     gbest451.seq
 499999541     gbest452.seq
 146594251     gbest453.seq
 499998942     gbest454.seq
 500000199     gbest455.seq
 499997329     gbest456.seq
 487788892     gbest457.seq
 499999035     gbest458.seq
 499997432     gbest459.seq
 189558363     gbest46.seq
 499999676     gbest460.seq
 499999224     gbest461.seq
  19780988     gbest462.seq
 170019681     gbest463.seq
 499998234     gbest464.seq
 499997948     gbest465.seq
 499996964     gbest466.seq
 499998273     gbest467.seq
  23774165     gbest468.seq
 499999458     gbest469.seq
 499999613     gbest47.seq
 499998882     gbest470.seq
 499999591     gbest471.seq
 500000249     gbest472.seq
  60660807     gbest473.seq
 499997118     gbest474.seq
 499996532     gbest475.seq
 499997210     gbest476.seq
 499999967     gbest477.seq
  57553133     gbest478.seq
 499999428     gbest479.seq
 499997256     gbest48.seq
 499998005     gbest480.seq
 499997648     gbest481.seq
 499999115     gbest482.seq
  37372779     gbest483.seq
 499997371     gbest484.seq
 499998672     gbest485.seq
 499999479     gbest486.seq
 499999088     gbest487.seq
  64962339     gbest488.seq
 499997662     gbest489.seq
 499999418     gbest49.seq
 499999130     gbest490.seq
 499999934     gbest491.seq
 206715962     gbest492.seq
 499996334     gbest493.seq
 499998589     gbest494.seq
 499998630     gbest495.seq
 499999095     gbest496.seq
  89176355     gbest497.seq
 499998125     gbest498.seq
 499998609     gbest499.seq
 499998155     gbest5.seq
 474488499     gbest50.seq
 499998196     gbest500.seq
 499995264     gbest501.seq
  52969313     gbest502.seq
 499998717     gbest503.seq
 499997860     gbest504.seq
 499999996     gbest505.seq
 499999277     gbest506.seq
 141956910     gbest507.seq
 499999254     gbest508.seq
 499996708     gbest509.seq
 499998341     gbest51.seq
 499998452     gbest510.seq
 499998301     gbest511.seq
 139192325     gbest512.seq
 499997763     gbest513.seq
 499997891     gbest514.seq
 499999016     gbest515.seq
 500000145     gbest516.seq
  16904523     gbest517.seq
 174254470     gbest518.seq
 499998928     gbest519.seq
 355703064     gbest52.seq
 499998021     gbest520.seq
  83063372     gbest521.seq
 499997944     gbest522.seq
 499998345     gbest523.seq
  75363186     gbest524.seq
 499999291     gbest525.seq
 499999095     gbest526.seq
 499998072     gbest527.seq
 499996371     gbest528.seq
  94416764     gbest529.seq
 499997477     gbest53.seq
 499999382     gbest530.seq
 499998748     gbest531.seq
 499998249     gbest532.seq
 499999707     gbest533.seq
   9311695     gbest534.seq
 499999430     gbest535.seq
 499998660     gbest536.seq
 499998262     gbest537.seq
 477035449     gbest538.seq
 499998584     gbest539.seq
 499999368     gbest54.seq
 499998950     gbest540.seq
 499998443     gbest541.seq
 408620007     gbest542.seq
 499998900     gbest543.seq
 499999161     gbest544.seq
 499998712     gbest545.seq
 467601983     gbest546.seq
 499998997     gbest547.seq
 499998220     gbest548.seq
 499998640     gbest549.seq
 499996905     gbest55.seq
 499997208     gbest550.seq
  33772444     gbest551.seq
 499997037     gbest552.seq
 499997866     gbest553.seq
 499996671     gbest554.seq
 499999094     gbest555.seq
  44005971     gbest556.seq
 499996534     gbest557.seq
 499998978     gbest558.seq
 499997270     gbest559.seq
 483256451     gbest56.seq
 499998286     gbest560.seq
   9393571     gbest561.seq
 499998309     gbest562.seq
 499998494     gbest563.seq
 392782285     gbest564.seq
 499998337     gbest565.seq
 499997592     gbest566.seq
  93977201     gbest567.seq
 499998740     gbest568.seq
 499998391     gbest569.seq
 499998261     gbest57.seq
  50311057     gbest570.seq
 499999914     gbest571.seq
 499998798     gbest572.seq
 499999072     gbest573.seq
 254441988     gbest574.seq
 500000177     gbest58.seq
 499998973     gbest59.seq
 499998099     gbest6.seq
 463542876     gbest60.seq
 499998917     gbest61.seq
 500000255     gbest62.seq
 499997023     gbest63.seq
 499998522     gbest64.seq
   6679648     gbest65.seq
 499999738     gbest66.seq
 499998528     gbest67.seq
 499998605     gbest68.seq
 482591269     gbest69.seq
 499997250     gbest7.seq
 499998691     gbest70.seq
 499997329     gbest71.seq
 499997260     gbest72.seq
 499997535     gbest73.seq
   7336376     gbest74.seq
 123216203     gbest75.seq
 499999005     gbest76.seq
 499999378     gbest77.seq
 499999069     gbest78.seq
 499999812     gbest79.seq
 469256502     gbest8.seq
   5450770     gbest80.seq
 499998041     gbest81.seq
 499998813     gbest82.seq
 500000097     gbest83.seq
 499998347     gbest84.seq
  45764394     gbest85.seq
 499999280     gbest86.seq
 499998745     gbest87.seq
 499999478     gbest88.seq
 499998865     gbest89.seq
 499997802     gbest9.seq
  52673689     gbest90.seq
 499998745     gbest91.seq
 499999084     gbest92.seq
 499998525     gbest93.seq
 470693125     gbest94.seq
 499999715     gbest95.seq
 499996811     gbest96.seq
 499996652     gbest97.seq
 498437646     gbest98.seq
  35234983     gbest99.seq
 499998781     gbgss1.seq
  55179126     gbgss10.seq
 499997313     gbgss100.seq
 499996830     gbgss101.seq
 499999909     gbgss102.seq
 468181084     gbgss103.seq
 499997049     gbgss104.seq
 499999629     gbgss105.seq
 500000188     gbgss106.seq
 499999848     gbgss107.seq
  40292488     gbgss108.seq
 499997736     gbgss109.seq
 499998584     gbgss11.seq
 500000122     gbgss110.seq
 500000164     gbgss111.seq
 316319608     gbgss112.seq
 499998282     gbgss113.seq
 499998924     gbgss114.seq
 499998333     gbgss115.seq
 499997840     gbgss116.seq
 103720750     gbgss117.seq
 499998525     gbgss118.seq
 499998144     gbgss119.seq
 499999334     gbgss12.seq
 499998256     gbgss120.seq
 499999634     gbgss121.seq
   5770896     gbgss122.seq
 499999867     gbgss123.seq
 499999676     gbgss124.seq
 499999794     gbgss125.seq
 449066275     gbgss126.seq
 499997882     gbgss127.seq
 499997140     gbgss128.seq
 499999220     gbgss129.seq
 500000040     gbgss13.seq
 499996616     gbgss130.seq
  29590310     gbgss131.seq
 499997877     gbgss132.seq
 209679641     gbgss133.seq
 500000110     gbgss134.seq
 499999602     gbgss135.seq
 499997969     gbgss136.seq
 500000125     gbgss137.seq
  14831686     gbgss138.seq
 499996726     gbgss139.seq
 498574456     gbgss14.seq
 499997951     gbgss140.seq
 499999528     gbgss141.seq
 499997001     gbgss142.seq
  16786266     gbgss143.seq
 499997786     gbgss144.seq
 499996974     gbgss145.seq
 499999546     gbgss146.seq
 499996547     gbgss147.seq
   2045398     gbgss148.seq
 499997382     gbgss149.seq
 499997425     gbgss15.seq
 499998165     gbgss150.seq
 499998480     gbgss151.seq
 499997367     gbgss152.seq
   6835799     gbgss153.seq
 373479550     gbgss154.seq
 499999264     gbgss155.seq
 499999385     gbgss156.seq
 499997177     gbgss157.seq
 450187084     gbgss158.seq
 499999895     gbgss159.seq
 499997738     gbgss16.seq
 499997663     gbgss160.seq
 499997684     gbgss161.seq
 454199198     gbgss162.seq
 499997998     gbgss163.seq
 499999955     gbgss164.seq
 499997965     gbgss165.seq
 456856217     gbgss166.seq
 499997324     gbgss167.seq
 499998331     gbgss168.seq
 499998722     gbgss169.seq
 499999295     gbgss17.seq
 362069154     gbgss170.seq
 499999614     gbgss171.seq
 499999108     gbgss172.seq
 215505768     gbgss173.seq
 499998125     gbgss174.seq
 499998134     gbgss175.seq
  67002892     gbgss176.seq
 499999079     gbgss177.seq
 499999336     gbgss178.seq
 499998518     gbgss179.seq
 480471944     gbgss18.seq
 499999975     gbgss180.seq
  49671428     gbgss181.seq
 500000156     gbgss182.seq
 499999211     gbgss183.seq
 500000209     gbgss184.seq
 499999501     gbgss185.seq
  39656212     gbgss186.seq
 499999015     gbgss187.seq
 500000221     gbgss188.seq
  23203602     gbgss189.seq
 499998653     gbgss19.seq
 499998791     gbgss190.seq
 499996639     gbgss191.seq
 499998774     gbgss192.seq
 495024971     gbgss193.seq
 499999000     gbgss194.seq
 499999251     gbgss195.seq
 499999609     gbgss196.seq
 499999185     gbgss197.seq
   4843731     gbgss198.seq
 499998820     gbgss199.seq
 500000240     gbgss2.seq
 324867797     gbgss20.seq
 499998733     gbgss200.seq
 499997041     gbgss201.seq
 479851147     gbgss202.seq
 499997737     gbgss203.seq
 499997752     gbgss204.seq
  56421213     gbgss205.seq
 499997703     gbgss206.seq
 500000150     gbgss207.seq
 499999163     gbgss208.seq
 481445530     gbgss209.seq
 499999364     gbgss21.seq
 499999908     gbgss210.seq
 499997933     gbgss211.seq
 499998148     gbgss212.seq
 488124681     gbgss213.seq
 499999175     gbgss214.seq
 499999239     gbgss215.seq
 499999176     gbgss216.seq
 467990953     gbgss217.seq
 499999749     gbgss218.seq
 499999749     gbgss219.seq
 499997480     gbgss22.seq
 499997938     gbgss220.seq
   6989681     gbgss221.seq
 499999723     gbgss222.seq
 499999684     gbgss223.seq
 499998774     gbgss224.seq
 264582471     gbgss225.seq
 499998308     gbgss226.seq
 499997919     gbgss227.seq
 499999010     gbgss228.seq
 429127642     gbgss229.seq
 499997001     gbgss23.seq
 499998680     gbgss230.seq
 499997412     gbgss231.seq
 499999464     gbgss232.seq
 468539336     gbgss233.seq
 499999119     gbgss234.seq
 499999511     gbgss235.seq
 499996654     gbgss236.seq
 418138488     gbgss237.seq
 499999568     gbgss238.seq
 499996782     gbgss239.seq
 499998002     gbgss24.seq
 499999250     gbgss240.seq
 499998270     gbgss241.seq
  16446436     gbgss242.seq
 315572447     gbgss243.seq
 499997744     gbgss244.seq
 499999895     gbgss245.seq
 499998432     gbgss246.seq
 467293763     gbgss247.seq
 499998755     gbgss248.seq
 499999852     gbgss249.seq
  47915040     gbgss25.seq
 499999457     gbgss250.seq
 499998339     gbgss251.seq
  36094621     gbgss252.seq
 499998608     gbgss253.seq
 499997686     gbgss254.seq
 499998198     gbgss255.seq
 499999134     gbgss256.seq
  19020583     gbgss257.seq
 499999905     gbgss258.seq
 499998046     gbgss259.seq
 499998203     gbgss26.seq
 499999794     gbgss260.seq
   1598075     gbgss261.seq
 499999437     gbgss262.seq
 499999239     gbgss263.seq
 499999430     gbgss264.seq
 480892291     gbgss265.seq
 499999638     gbgss266.seq
 499998584     gbgss267.seq
 449883145     gbgss268.seq
 499997734     gbgss27.seq
 499998847     gbgss28.seq
 499999547     gbgss29.seq
 499996704     gbgss3.seq
  28355345     gbgss30.seq
 499999620     gbgss31.seq
 499999369     gbgss32.seq
 499999471     gbgss33.seq
 474344661     gbgss34.seq
 499997672     gbgss35.seq
 499999711     gbgss36.seq
 499997996     gbgss37.seq
 499998897     gbgss38.seq
  10238353     gbgss39.seq
 499997022     gbgss4.seq
 499998043     gbgss40.seq
 500000104     gbgss41.seq
 168816398     gbgss42.seq
 499998215     gbgss43.seq
 499997776     gbgss44.seq
 499997935     gbgss45.seq
 487170352     gbgss46.seq
 500000097     gbgss47.seq
 499997981     gbgss48.seq
 499999384     gbgss49.seq
  37746558     gbgss5.seq
 444017100     gbgss50.seq
 499998446     gbgss51.seq
 500000163     gbgss52.seq
 499998853     gbgss53.seq
 420972611     gbgss54.seq
 499999264     gbgss55.seq
 499999392     gbgss56.seq
 499998883     gbgss57.seq
 427742687     gbgss58.seq
  67685650     gbgss59.seq
 499999011     gbgss6.seq
 500000215     gbgss60.seq
 499997984     gbgss61.seq
 500000021     gbgss62.seq
 493791092     gbgss63.seq
 499998150     gbgss64.seq
 500000146     gbgss65.seq
 500000101     gbgss66.seq
 499520338     gbgss67.seq
 499998492     gbgss68.seq
 499999132     gbgss69.seq
 499998902     gbgss7.seq
 499999264     gbgss70.seq
 419358340     gbgss71.seq
 499999747     gbgss72.seq
 499998402     gbgss73.seq
 499998080     gbgss74.seq
  33896316     gbgss75.seq
 499997046     gbgss76.seq
 499999706     gbgss77.seq
 499999836     gbgss78.seq
 490829495     gbgss79.seq
 499997661     gbgss8.seq
 499997550     gbgss80.seq
 499999765     gbgss81.seq
 499999304     gbgss82.seq
 499999239     gbgss83.seq
   6078731     gbgss84.seq
 499999962     gbgss85.seq
 500000077     gbgss86.seq
 499997276     gbgss87.seq
 499999314     gbgss88.seq
  23821801     gbgss89.seq
 499999203     gbgss9.seq
 500000224     gbgss90.seq
 499999829     gbgss91.seq
 499999704     gbgss92.seq
 462802247     gbgss93.seq
 244248654     gbgss94.seq
 499999492     gbgss95.seq
 499998457     gbgss96.seq
 500000176     gbgss97.seq
 499997669     gbgss98.seq
  45206073     gbgss99.seq
 499991077     gbhtc1.seq
 499994049     gbhtc2.seq
 499986002     gbhtc3.seq
 330777725     gbhtc4.seq
 499999497     gbhtc5.seq
 437685656     gbhtc6.seq
 499998276     gbhtc7.seq
 189463284     gbhtc8.seq
 499943248     gbhtg1.seq
 499980365     gbhtg10.seq
 485099546     gbhtg11.seq
 499977093     gbhtg12.seq
 499847932     gbhtg13.seq
 499963690     gbhtg14.seq
 499701413     gbhtg15.seq
 474637756     gbhtg16.seq
 499709315     gbhtg17.seq
 499810411     gbhtg18.seq
 499965524     gbhtg19.seq
 499844091     gbhtg2.seq
 499990220     gbhtg20.seq
 473197896     gbhtg21.seq
 499917621     gbhtg22.seq
 499967580     gbhtg23.seq
 499096681     gbhtg24.seq
 499958752     gbhtg25.seq
 484455994     gbhtg26.seq
 499961369     gbhtg27.seq
 499870274     gbhtg28.seq
 268060905     gbhtg29.seq
 499869147     gbhtg3.seq
 499926223     gbhtg30.seq
 499802500     gbhtg31.seq
 224936220     gbhtg32.seq
 499948635     gbhtg33.seq
 499915502     gbhtg34.seq
 265459787     gbhtg35.seq
 499837354     gbhtg36.seq
 499950524     gbhtg37.seq
 223150728     gbhtg38.seq
 499802417     gbhtg39.seq
 499846457     gbhtg4.seq
 499973211     gbhtg40.seq
 234952769     gbhtg41.seq
 499824978     gbhtg42.seq
 499885923     gbhtg43.seq
 202125536     gbhtg44.seq
 499784538     gbhtg45.seq
 499925762     gbhtg46.seq
 205797151     gbhtg47.seq
 499975842     gbhtg48.seq
 499928510     gbhtg49.seq
 499934497     gbhtg5.seq
 193864742     gbhtg50.seq
 499926539     gbhtg51.seq
 499937036     gbhtg52.seq
 161358152     gbhtg53.seq
 499996909     gbhtg54.seq
 499996869     gbhtg55.seq
 252726149     gbhtg56.seq
 499940485     gbhtg57.seq
 499966376     gbhtg58.seq
 499997341     gbhtg59.seq
    507366     gbhtg6.seq
 167065947     gbhtg60.seq
 499929457     gbhtg61.seq
 499926029     gbhtg62.seq
 499877216     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499983596     gbhtg67.seq
 499743038     gbhtg68.seq
 499812923     gbhtg69.seq
 499821211     gbhtg7.seq
 399848968     gbhtg70.seq
 499999889     gbhtg71.seq
 499890742     gbhtg72.seq
 385409481     gbhtg73.seq
 499951671     gbhtg74.seq
 499970875     gbhtg75.seq
 383567862     gbhtg76.seq
 499964642     gbhtg77.seq
 499988465     gbhtg78.seq
 499994475     gbhtg79.seq
 499933798     gbhtg8.seq
 499991153     gbhtg80.seq
 499923769     gbhtg81.seq
 266509540     gbhtg82.seq
 499899409     gbhtg9.seq
 499920792     gbinv1.seq
 490451253     gbinv10.seq
 491062219     gbinv11.seq
 495976109     gbinv12.seq
 497930277     gbinv13.seq
 499967847     gbinv14.seq
  12449103     gbinv15.seq
 499999499     gbinv16.seq
 404294029     gbinv17.seq
 497205039     gbinv18.seq
 499998550     gbinv19.seq
 453523239     gbinv2.seq
 316871823     gbinv20.seq
 424343228     gbinv21.seq
 499998026     gbinv22.seq
 389751281     gbinv23.seq
 499997843     gbinv24.seq
 499999721     gbinv25.seq
 389142138     gbinv26.seq
 499999137     gbinv27.seq
 499998207     gbinv28.seq
 174408318     gbinv29.seq
 499999265     gbinv3.seq
 499999697     gbinv30.seq
 499999303     gbinv31.seq
 114469825     gbinv32.seq
 499996920     gbinv33.seq
 499997066     gbinv34.seq
 147534078     gbinv35.seq
 499997426     gbinv36.seq
 499998506     gbinv37.seq
 156013998     gbinv38.seq
 499997223     gbinv39.seq
 498961952     gbinv4.seq
 499999857     gbinv40.seq
 190759596     gbinv41.seq
 499998682     gbinv42.seq
 499998788     gbinv43.seq
 244315307     gbinv44.seq
 499998396     gbinv45.seq
 499998543     gbinv46.seq
 499999865     gbinv47.seq
 416440162     gbinv48.seq
 499998874     gbinv49.seq
 150887107     gbinv5.seq
 445991558     gbinv50.seq
 288064994     gbinv51.seq
  54947886     gbinv52.seq
  52917686     gbinv53.seq
 156789431     gbinv54.seq
 499989559     gbinv55.seq
 266436255     gbinv56.seq
 499998556     gbinv57.seq
 499997693     gbinv58.seq
 172341791     gbinv59.seq
 496404412     gbinv6.seq
 499362201     gbinv60.seq
 498123991     gbinv61.seq
 499646680     gbinv62.seq
 241509040     gbinv63.seq
 487222486     gbinv64.seq
 355008934     gbinv65.seq
 466371493     gbinv66.seq
 479577317     gbinv67.seq
 441688120     gbinv68.seq
 497275454     gbinv69.seq
 476450800     gbinv7.seq
 499732317     gbinv70.seq
 353601221     gbinv71.seq
 499998723     gbinv72.seq
 499998750     gbinv73.seq
 251727291     gbinv74.seq
 500000099     gbinv75.seq
 500000052     gbinv76.seq
 177051280     gbinv77.seq
 499998841     gbinv78.seq
 499999890     gbinv79.seq
 422530809     gbinv8.seq
 483328865     gbinv80.seq
 173964300     gbinv9.seq
 499999558     gbmam1.seq
 445458574     gbmam10.seq
 122412955     gbmam11.seq
 451114203     gbmam12.seq
 418062948     gbmam13.seq
 499818197     gbmam14.seq
 462376363     gbmam15.seq
 370510653     gbmam16.seq
 446296425     gbmam17.seq
 431104447     gbmam18.seq
 480602957     gbmam19.seq
  87442212     gbmam2.seq
 479109873     gbmam20.seq
 483903297     gbmam21.seq
 242483322     gbmam22.seq
   9943517     gbmam23.seq
  43989127     gbmam24.seq
  91322474     gbmam25.seq
  88811460     gbmam26.seq
   6364900     gbmam27.seq
  20917751     gbmam28.seq
 449538074     gbmam29.seq
  82809617     gbmam3.seq
 499997986     gbmam30.seq
 499979218     gbmam31.seq
  75521438     gbmam32.seq
 907465328     gbmam33.seq
 839494897     gbmam34.seq
 774395849     gbmam35.seq
 588873740     gbmam36.seq
 364960392     gbmam37.seq
 428298067     gbmam38.seq
 283039575     gbmam39.seq
  71296597     gbmam4.seq
 266821800     gbmam40.seq
 255006728     gbmam41.seq
 250434933     gbmam42.seq
 405636500     gbmam43.seq
 372090862     gbmam44.seq
 465554640     gbmam45.seq
 444922498     gbmam46.seq
 352269573     gbmam47.seq
 499983056     gbmam48.seq
  17632407     gbmam49.seq
  22570875     gbmam5.seq
   1268605     gbmam6.seq
 378312072     gbmam7.seq
 338653930     gbmam8.seq
 477859989     gbmam9.seq
  17582412     gbnew.txt
 500000032     gbpat1.seq
 499999421     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335316010     gbpat107.seq
 499999713     gbpat108.seq
 499999747     gbpat109.seq
 499998409     gbpat11.seq
 207975539     gbpat110.seq
 499862582     gbpat111.seq
 499997548     gbpat112.seq
 174003370     gbpat113.seq
 499998877     gbpat114.seq
 499999895     gbpat115.seq
 499993943     gbpat116.seq
   8428430     gbpat117.seq
 499658361     gbpat118.seq
 382768910     gbpat119.seq
 179043955     gbpat12.seq
 499997196     gbpat120.seq
 499995787     gbpat121.seq
 499993364     gbpat122.seq
 499999032     gbpat123.seq
  56239870     gbpat124.seq
 499988626     gbpat125.seq
 499998185     gbpat126.seq
 208379880     gbpat127.seq
 499999496     gbpat128.seq
 499999909     gbpat129.seq
 499785740     gbpat13.seq
  57204733     gbpat130.seq
 500000167     gbpat131.seq
 499997480     gbpat132.seq
 487280533     gbpat133.seq
 499999023     gbpat134.seq
 499998603     gbpat135.seq
  25583940     gbpat136.seq
 499989245     gbpat137.seq
 385111497     gbpat138.seq
 500000184     gbpat139.seq
 500000028     gbpat14.seq
 500000185     gbpat140.seq
 148477280     gbpat141.seq
 499998442     gbpat142.seq
 314419755     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499984443     gbpat148.seq
 125941966     gbpat149.seq
  62525518     gbpat15.seq
 499989559     gbpat150.seq
 499997874     gbpat151.seq
 499998591     gbpat152.seq
 500000091     gbpat153.seq
 169796613     gbpat154.seq
 499998358     gbpat155.seq
 425268019     gbpat156.seq
 499999472     gbpat157.seq
 499999792     gbpat158.seq
 499831999     gbpat159.seq
 499999281     gbpat16.seq
 353447696     gbpat160.seq
 499998774     gbpat161.seq
 499998755     gbpat162.seq
 289434443     gbpat163.seq
 500000021     gbpat164.seq
 499998822     gbpat165.seq
 499998297     gbpat166.seq
 100293511     gbpat167.seq
 499996557     gbpat168.seq
 499997006     gbpat169.seq
 500000163     gbpat17.seq
 499998122     gbpat170.seq
 499999325     gbpat171.seq
 301646449     gbpat172.seq
 499977416     gbpat173.seq
 499997932     gbpat174.seq
 499995986     gbpat175.seq
 499996864     gbpat176.seq
 499999510     gbpat177.seq
 229462281     gbpat178.seq
 497266182     gbpat179.seq
 421720373     gbpat18.seq
 499997998     gbpat180.seq
 499996941     gbpat181.seq
  86795378     gbpat182.seq
 499993098     gbpat183.seq
 500000008     gbpat184.seq
 499999434     gbpat185.seq
  39653349     gbpat186.seq
 499255592     gbpat187.seq
 499999719     gbpat188.seq
 499999510     gbpat189.seq
 499751430     gbpat19.seq
 500000120     gbpat190.seq
 378460732     gbpat191.seq
 500000054     gbpat192.seq
 499999577     gbpat193.seq
 321705067     gbpat194.seq
 499991396     gbpat195.seq
 499963719     gbpat196.seq
 350635988     gbpat197.seq
 497506292     gbpat198.seq
 499869540     gbpat199.seq
 500000147     gbpat2.seq
 499998227     gbpat20.seq
 421452571     gbpat200.seq
 499425936     gbpat201.seq
 499999361     gbpat202.seq
 499995615     gbpat203.seq
 266073222     gbpat204.seq
 499993927     gbpat21.seq
 347349502     gbpat22.seq
 499945939     gbpat23.seq
 499998647     gbpat24.seq
 499989561     gbpat25.seq
 499999402     gbpat26.seq
 164477890     gbpat27.seq
 499999588     gbpat28.seq
 499999886     gbpat29.seq
  61149214     gbpat3.seq
 213205625     gbpat30.seq
 499999775     gbpat31.seq
 405862863     gbpat32.seq
 499998149     gbpat33.seq
 500000109     gbpat34.seq
 125201457     gbpat35.seq
 500000105     gbpat36.seq
 499997510     gbpat37.seq
 499999310     gbpat38.seq
 140123796     gbpat39.seq
 500000063     gbpat4.seq
 499999990     gbpat40.seq
 493959510     gbpat41.seq
 494766586     gbpat42.seq
 499999996     gbpat43.seq
 149189631     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499999859     gbpat47.seq
  87731065     gbpat48.seq
 499999445     gbpat49.seq
 499999742     gbpat5.seq
 499999629     gbpat50.seq
 499999938     gbpat51.seq
 130915371     gbpat52.seq
 499999590     gbpat53.seq
 499999084     gbpat54.seq
 184976946     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 418155913     gbpat6.seq
 499638184     gbpat60.seq
 429847081     gbpat61.seq
 499999757     gbpat62.seq
 320381103     gbpat63.seq
 499999675     gbpat64.seq
 499999853     gbpat65.seq
 305472459     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999402     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499998369     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474414032     gbpat82.seq
 499999784     gbpat83.seq
 331552497     gbpat84.seq
 499999646     gbpat85.seq
 311158712     gbpat86.seq
 499998849     gbpat87.seq
 499999919     gbpat88.seq
 499996891     gbpat89.seq
 316906806     gbpat9.seq
 203089373     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499962428     gbpat93.seq
 252084933     gbpat94.seq
 499995026     gbpat95.seq
 499997898     gbpat96.seq
  81942977     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499945260     gbphg1.seq
 499736230     gbphg2.seq
 499900680     gbphg3.seq
 138766814     gbphg4.seq
 499999690     gbpln1.seq
 268695070     gbpln10.seq
 247589806     gbpln100.seq
 185623005     gbpln101.seq
 997331398     gbpln102.seq
  56500301     gbpln103.seq
 487347148     gbpln104.seq
 473525516     gbpln105.seq
 473209377     gbpln106.seq
 467870557     gbpln107.seq
 357045194     gbpln108.seq
 499999065     gbpln109.seq
 499917394     gbpln11.seq
  62434513     gbpln110.seq
 499997878     gbpln111.seq
 500000024     gbpln112.seq
 266785976     gbpln113.seq
 498645961     gbpln114.seq
 499997662     gbpln115.seq
  85055611     gbpln116.seq
 499998504     gbpln117.seq
 465892069     gbpln118.seq
 499998089     gbpln119.seq
 499023727     gbpln12.seq
 416954686     gbpln120.seq
 499988760     gbpln121.seq
 384072683     gbpln122.seq
 499999486     gbpln123.seq
 499996237     gbpln124.seq
 499997653     gbpln125.seq
  63478965     gbpln126.seq
 499999333     gbpln127.seq
 499997379     gbpln128.seq
 390568533     gbpln129.seq
 466708882     gbpln13.seq
 500000078     gbpln130.seq
 499999368     gbpln131.seq
 499555976     gbpln132.seq
 127566090     gbpln133.seq
 499792813     gbpln134.seq
 490321712     gbpln135.seq
 402785639     gbpln136.seq
 445924319     gbpln137.seq
 486544603     gbpln138.seq
 489382001     gbpln139.seq
 467751929     gbpln14.seq
 226945063     gbpln140.seq
 314212218     gbpln141.seq
 665291577     gbpln142.seq
 860028189     gbpln143.seq
 800605872     gbpln144.seq
 794469115     gbpln145.seq
 762933697     gbpln146.seq
 729969959     gbpln147.seq
 808217924     gbpln148.seq
 249223550     gbpln149.seq
 479852014     gbpln15.seq
   9838016     gbpln150.seq
  10182293     gbpln151.seq
 766528189     gbpln152.seq
  10567629     gbpln153.seq
 756143249     gbpln154.seq
 878426054     gbpln155.seq
 631056251     gbpln156.seq
 993852367     gbpln157.seq
1020132695     gbpln158.seq
 830166807     gbpln159.seq
 286807918     gbpln16.seq
 955723315     gbpln160.seq
1057964328     gbpln161.seq
 784007552     gbpln162.seq
 947940191     gbpln163.seq
 857511193     gbpln164.seq
 649137171     gbpln165.seq
 903393879     gbpln166.seq
 908180396     gbpln167.seq
 721135945     gbpln168.seq
 786739709     gbpln169.seq
 345686436     gbpln17.seq
 918070756     gbpln170.seq
 603192844     gbpln171.seq
 938102555     gbpln172.seq
 955978436     gbpln173.seq
 813787878     gbpln174.seq
 639701128     gbpln175.seq
 468392695     gbpln176.seq
 499431662     gbpln177.seq
 499114654     gbpln178.seq
  17850866     gbpln179.seq
 383677476     gbpln18.seq
 768129678     gbpln180.seq
 891209633     gbpln181.seq
1017177961     gbpln182.seq
1036708108     gbpln183.seq
 980496603     gbpln184.seq
1096870510     gbpln185.seq
 964601805     gbpln186.seq
 883690282     gbpln187.seq
 879367269     gbpln188.seq
 922136688     gbpln189.seq
 203983960     gbpln19.seq
 805432021     gbpln190.seq
 912345991     gbpln191.seq
 954500353     gbpln192.seq
 944560088     gbpln193.seq
  29467767     gbpln194.seq
 394031070     gbpln195.seq
 499998945     gbpln196.seq
 499983969     gbpln197.seq
 393536113     gbpln198.seq
 499997876     gbpln199.seq
 499972839     gbpln2.seq
  84497167     gbpln20.seq
 499999432     gbpln200.seq
 499853986     gbpln201.seq
 499998543     gbpln202.seq
 499997375     gbpln203.seq
 296876885     gbpln204.seq
 477735094     gbpln21.seq
 499901688     gbpln22.seq
 498817745     gbpln23.seq
 323729344     gbpln24.seq
 499081327     gbpln25.seq
 497392106     gbpln26.seq
 499424594     gbpln27.seq
 103293547     gbpln28.seq
 496565850     gbpln29.seq
 499895327     gbpln3.seq
 498203430     gbpln30.seq
 349197988     gbpln31.seq
 488666730     gbpln32.seq
 497060599     gbpln33.seq
 332336790     gbpln34.seq
 496457212     gbpln35.seq
 487441358     gbpln36.seq
 477280628     gbpln37.seq
 433198965     gbpln38.seq
 317392296     gbpln39.seq
 499931053     gbpln4.seq
 494333229     gbpln40.seq
 475206592     gbpln41.seq
 468207974     gbpln42.seq
 477377284     gbpln43.seq
 272302955     gbpln44.seq
 172902191     gbpln45.seq
 471233536     gbpln46.seq
 455042321     gbpln47.seq
 488809223     gbpln48.seq
 355272263     gbpln49.seq
 461907591     gbpln5.seq
 200538454     gbpln50.seq
 377219536     gbpln51.seq
 375192640     gbpln52.seq
 386441749     gbpln53.seq
 496901336     gbpln54.seq
 408713394     gbpln55.seq
 476593700     gbpln56.seq
 434249982     gbpln57.seq
 440487400     gbpln58.seq
 444203819     gbpln59.seq
 499992141     gbpln6.seq
 189178941     gbpln60.seq
 460466914     gbpln61.seq
 440542307     gbpln62.seq
 452992006     gbpln63.seq
 497917458     gbpln64.seq
 480376128     gbpln65.seq
  71745252     gbpln66.seq
 470938414     gbpln67.seq
 490964263     gbpln68.seq
 449178016     gbpln69.seq
 499950604     gbpln7.seq
 472881526     gbpln70.seq
 424121784     gbpln71.seq
 434231712     gbpln72.seq
 447914384     gbpln73.seq
 475710365     gbpln74.seq
 449964742     gbpln75.seq
 422837725     gbpln76.seq
 383453843     gbpln77.seq
 376172115     gbpln78.seq
 326317072     gbpln79.seq
 225235571     gbpln8.seq
 320571252     gbpln80.seq
 286199716     gbpln81.seq
 277716231     gbpln82.seq
 499757786     gbpln83.seq
     84604     gbpln84.seq
    354449     gbpln85.seq
 164936593     gbpln86.seq
  40081560     gbpln87.seq
  74904959     gbpln88.seq
 499998370     gbpln89.seq
 499990067     gbpln9.seq
 356663170     gbpln90.seq
 500000174     gbpln91.seq
 500000031     gbpln92.seq
 139746322     gbpln93.seq
 499859937     gbpln94.seq
 499774131     gbpln95.seq
 499991643     gbpln96.seq
 284885651     gbpln97.seq
 298253263     gbpln98.seq
 211231433     gbpln99.seq
 147977675     gbpri1.seq
 499825450     gbpri10.seq
 499978638     gbpri11.seq
 248926180     gbpri12.seq
 499853606     gbpri13.seq
 157015384     gbpri14.seq
 162642326     gbpri15.seq
 494708645     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962101     gbpri19.seq
 499816518     gbpri2.seq
 499977621     gbpri20.seq
  18245026     gbpri21.seq
 499987105     gbpri22.seq
 499992615     gbpri23.seq
 430418983     gbpri24.seq
 499993743     gbpri25.seq
 499997096     gbpri26.seq
 316320168     gbpri27.seq
 499987872     gbpri28.seq
 441950085     gbpri29.seq
 499891257     gbpri3.seq
 314294173     gbpri30.seq
 258775295     gbpri31.seq
 499999544     gbpri32.seq
 499966069     gbpri33.seq
 370038581     gbpri34.seq
 499855390     gbpri4.seq
 499729136     gbpri5.seq
 393528728     gbpri6.seq
 499802910     gbpri7.seq
 499984764     gbpri8.seq
 499967010     gbpri9.seq
    420487     gbrel.txt
 499864363     gbrod1.seq
 499998660     gbrod10.seq
   4074615     gbrod11.seq
 499812087     gbrod12.seq
 203924668     gbrod13.seq
 499994692     gbrod14.seq
 499997569     gbrod15.seq
 499998806     gbrod16.seq
 293968424     gbrod17.seq
 394321756     gbrod18.seq
 485621789     gbrod19.seq
 499802341     gbrod2.seq
 447176964     gbrod20.seq
 401873462     gbrod21.seq
 366905979     gbrod22.seq
 178573278     gbrod23.seq
 488459733     gbrod24.seq
 424417578     gbrod25.seq
 451725454     gbrod26.seq
 499111394     gbrod27.seq
 467945906     gbrod28.seq
 425428157     gbrod29.seq
 499880319     gbrod3.seq
 380508482     gbrod30.seq
 359290504     gbrod31.seq
 441030578     gbrod32.seq
 489660157     gbrod33.seq
 274287931     gbrod34.seq
 499702715     gbrod4.seq
 499960342     gbrod5.seq
  80291490     gbrod6.seq
 499846851     gbrod7.seq
 499742719     gbrod8.seq
 499945822     gbrod9.seq
 499999055     gbsts1.seq
 499998618     gbsts10.seq
 433284460     gbsts11.seq
 499996473     gbsts2.seq
  38061494     gbsts3.seq
 499998792     gbsts4.seq
 499996883     gbsts5.seq
 456729482     gbsts6.seq
 499998288     gbsts7.seq
 499999825     gbsts8.seq
  21523678     gbsts9.seq
 300805926     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 500000171     gbsyn22.seq
 455594489     gbsyn23.seq
 499993129     gbsyn24.seq
 500000052     gbsyn25.seq
 499997814     gbsyn26.seq
 200999075     gbsyn27.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999287     gbtsa1.seq
 500000000     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 473627173     gbtsa107.seq
 499999949     gbtsa108.seq
 499997426     gbtsa109.seq
 499997424     gbtsa11.seq
 236376146     gbtsa110.seq
 499999916     gbtsa111.seq
 499999178     gbtsa112.seq
 499998485     gbtsa113.seq
 499999039     gbtsa114.seq
  32605644     gbtsa115.seq
 500000071     gbtsa116.seq
 499996732     gbtsa117.seq
 499998477     gbtsa118.seq
 469116011     gbtsa119.seq
 280130073     gbtsa12.seq
 499999748     gbtsa120.seq
 499999037     gbtsa121.seq
 499998875     gbtsa122.seq
 278733702     gbtsa123.seq
 499999266     gbtsa124.seq
 499999256     gbtsa125.seq
 499998286     gbtsa126.seq
 421530147     gbtsa127.seq
 499996235     gbtsa13.seq
 499999964     gbtsa14.seq
 151618535     gbtsa15.seq
 499999603     gbtsa16.seq
 499996688     gbtsa17.seq
 258373800     gbtsa18.seq
 499997252     gbtsa19.seq
 499998984     gbtsa2.seq
 499998175     gbtsa20.seq
 499998875     gbtsa21.seq
  66356608     gbtsa22.seq
 499999604     gbtsa23.seq
 499997273     gbtsa24.seq
 499999492     gbtsa25.seq
 275956906     gbtsa26.seq
 499999635     gbtsa27.seq
 499999791     gbtsa28.seq
  71311344     gbtsa29.seq
 146878920     gbtsa3.seq
 499998196     gbtsa30.seq
 499999529     gbtsa31.seq
 153218059     gbtsa32.seq
 499998095     gbtsa33.seq
 499996730     gbtsa34.seq
 499999647     gbtsa35.seq
 488666701     gbtsa36.seq
 499999485     gbtsa37.seq
 499997575     gbtsa38.seq
 499998617     gbtsa39.seq
 499998567     gbtsa4.seq
 225919334     gbtsa40.seq
 499999675     gbtsa41.seq
 499991892     gbtsa42.seq
 499998349     gbtsa43.seq
 175177660     gbtsa44.seq
 499998997     gbtsa45.seq
 499999560     gbtsa46.seq
 354820490     gbtsa47.seq
 499999373     gbtsa48.seq
 499997080     gbtsa49.seq
 499999940     gbtsa5.seq
 289649000     gbtsa50.seq
 499999724     gbtsa51.seq
 499999766     gbtsa52.seq
 394617331     gbtsa53.seq
 499998483     gbtsa54.seq
 499998629     gbtsa55.seq
 499998068     gbtsa56.seq
 350275966     gbtsa57.seq
 499999428     gbtsa58.seq
 499999306     gbtsa59.seq
  50314135     gbtsa6.seq
 499998097     gbtsa60.seq
 221419020     gbtsa61.seq
 499999964     gbtsa62.seq
 499999918     gbtsa63.seq
 259941502     gbtsa64.seq
 499999212     gbtsa65.seq
 465402653     gbtsa66.seq
 499999280     gbtsa67.seq
 499997713     gbtsa68.seq
 499997088     gbtsa69.seq
 499998877     gbtsa7.seq
 164931383     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499997981     gbtsa75.seq
 499998780     gbtsa76.seq
 131354879     gbtsa77.seq
 499998723     gbtsa78.seq
 499997516     gbtsa79.seq
 499999768     gbtsa8.seq
  30973467     gbtsa80.seq
 499999375     gbtsa81.seq
 499998969     gbtsa82.seq
 499999731     gbtsa83.seq
 499998462     gbtsa84.seq
  45716037     gbtsa85.seq
 499997106     gbtsa86.seq
 499998546     gbtsa87.seq
 499998812     gbtsa88.seq
  81423881     gbtsa89.seq
 266838890     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499995192     gbtsa96.seq
 499998487     gbtsa97.seq
 499999226     gbtsa98.seq
 230571289     gbtsa99.seq
   1842113     gbuna1.seq
 500000138     gbvrl1.seq
 499998292     gbvrl10.seq
 208574253     gbvrl11.seq
 500000141     gbvrl12.seq
 499999121     gbvrl13.seq
 126014150     gbvrl14.seq
 499995120     gbvrl15.seq
 499998999     gbvrl16.seq
 306231161     gbvrl17.seq
 499997637     gbvrl18.seq
 499998214     gbvrl19.seq
 499981141     gbvrl2.seq
 336798734     gbvrl20.seq
 499998061     gbvrl21.seq
 499999296     gbvrl22.seq
 359511352     gbvrl23.seq
 499355814     gbvrl24.seq
 499999523     gbvrl25.seq
 300737718     gbvrl26.seq
 499998764     gbvrl27.seq
 499990308     gbvrl28.seq
 340956399     gbvrl29.seq
 355751010     gbvrl3.seq
 499999834     gbvrl30.seq
 499782892     gbvrl31.seq
 367197659     gbvrl32.seq
 499995074     gbvrl33.seq
 499997629     gbvrl34.seq
 499999266     gbvrl35.seq
  52654173     gbvrl36.seq
 499995675     gbvrl4.seq
 500000071     gbvrl5.seq
 499998750     gbvrl6.seq
 499999077     gbvrl7.seq
 290987798     gbvrl8.seq
 499997478     gbvrl9.seq
 499912584     gbvrt1.seq
  36032850     gbvrt10.seq
  58362214     gbvrt100.seq
 436487263     gbvrt101.seq
 486733599     gbvrt102.seq
 492783918     gbvrt103.seq
 423399209     gbvrt104.seq
 280513212     gbvrt105.seq
 475547766     gbvrt106.seq
 480350778     gbvrt107.seq
 495756533     gbvrt108.seq
  63702925     gbvrt109.seq
  18507952     gbvrt11.seq
 979124861     gbvrt110.seq
 838606404     gbvrt111.seq
 678361887     gbvrt112.seq
 476489691     gbvrt113.seq
 461392781     gbvrt114.seq
 438813789     gbvrt115.seq
 394333916     gbvrt116.seq
 313817861     gbvrt117.seq
 288999337     gbvrt118.seq
 280185755     gbvrt119.seq
 497676663     gbvrt12.seq
 407764323     gbvrt120.seq
 421766003     gbvrt121.seq
 478932645     gbvrt122.seq
 480028007     gbvrt123.seq
 438022009     gbvrt124.seq
 174441466     gbvrt125.seq
 487902327     gbvrt126.seq
 456814552     gbvrt127.seq
 462308829     gbvrt128.seq
 168813991     gbvrt129.seq
 497173924     gbvrt13.seq
 455912107     gbvrt130.seq
 469532514     gbvrt131.seq
 479131053     gbvrt132.seq
 211426449     gbvrt133.seq
 481245352     gbvrt134.seq
 475910668     gbvrt135.seq
 366784880     gbvrt136.seq
 464881586     gbvrt137.seq
 697335097     gbvrt138.seq
 670835450     gbvrt139.seq
 481350583     gbvrt14.seq
 524090200     gbvrt140.seq
 413419773     gbvrt141.seq
 345316791     gbvrt142.seq
 329840736     gbvrt143.seq
 250750064     gbvrt144.seq
 486599684     gbvrt145.seq
 364885005     gbvrt146.seq
 448394467     gbvrt147.seq
 471481455     gbvrt148.seq
 393642536     gbvrt149.seq
 400795564     gbvrt15.seq
 355134416     gbvrt150.seq
 470602746     gbvrt151.seq
 448657488     gbvrt152.seq
 384724558     gbvrt153.seq
 432320923     gbvrt154.seq
 470227786     gbvrt155.seq
 497676594     gbvrt156.seq
 485017954     gbvrt157.seq
 437534233     gbvrt158.seq
 499988763     gbvrt159.seq
 488197715     gbvrt16.seq
 499999906     gbvrt160.seq
  83268897     gbvrt161.seq
 479291185     gbvrt17.seq
 480798341     gbvrt18.seq
 499274554     gbvrt19.seq
 499816966     gbvrt2.seq
 483255170     gbvrt20.seq
 484153821     gbvrt21.seq
  65325604     gbvrt22.seq
   4698304     gbvrt23.seq
  14151693     gbvrt24.seq
  21383246     gbvrt25.seq
  90967413     gbvrt26.seq
 499908979     gbvrt27.seq
 499999011     gbvrt28.seq
 499997224     gbvrt29.seq
 237782129     gbvrt3.seq
  55557899     gbvrt30.seq
 499999652     gbvrt31.seq
 499999814     gbvrt32.seq
 364240802     gbvrt33.seq
 499999508     gbvrt34.seq
 442896997     gbvrt35.seq
 499999451     gbvrt36.seq
  27891465     gbvrt37.seq
 443733359     gbvrt38.seq
 499999967     gbvrt39.seq
 263645321     gbvrt4.seq
 378523928     gbvrt40.seq
 499998853     gbvrt41.seq
 278229114     gbvrt42.seq
 499999116     gbvrt43.seq
 491363749     gbvrt44.seq
 488886836     gbvrt45.seq
 487434008     gbvrt46.seq
 497527342     gbvrt47.seq
 396367123     gbvrt48.seq
 202128841     gbvrt49.seq
 289935611     gbvrt5.seq
 123737443     gbvrt50.seq
 483323044     gbvrt51.seq
 481925504     gbvrt52.seq
 499999199     gbvrt53.seq
 499926681     gbvrt54.seq
 296494910     gbvrt55.seq
 491037858     gbvrt56.seq
 492369611     gbvrt57.seq
 479652387     gbvrt58.seq
 480795619     gbvrt59.seq
  87348322     gbvrt6.seq
 362157432     gbvrt60.seq
 490931275     gbvrt61.seq
 475376599     gbvrt62.seq
 489403698     gbvrt63.seq
 352278596     gbvrt64.seq
 465343303     gbvrt65.seq
 488761954     gbvrt66.seq
 189335727     gbvrt67.seq
 443535502     gbvrt68.seq
 421190409     gbvrt69.seq
 499776412     gbvrt7.seq
 391875588     gbvrt70.seq
 372304558     gbvrt71.seq
 293994257     gbvrt72.seq
 265964554     gbvrt73.seq
 252405654     gbvrt74.seq
 496924908     gbvrt75.seq
 428777944     gbvrt76.seq
 385782563     gbvrt77.seq
 401943336     gbvrt78.seq
 480032615     gbvrt79.seq
 284656235     gbvrt8.seq
 474823439     gbvrt80.seq
 480706138     gbvrt81.seq
  89575236     gbvrt82.seq
 435875138     gbvrt83.seq
 487966705     gbvrt84.seq
 497561523     gbvrt85.seq
 468903694     gbvrt86.seq
1063697024     gbvrt87.seq
1045817107     gbvrt88.seq
 754876349     gbvrt89.seq
  15637436     gbvrt9.seq
 616753639     gbvrt90.seq
 490283567     gbvrt91.seq
 470650802     gbvrt92.seq
 397152541     gbvrt93.seq
 351566465     gbvrt94.seq
 339881205     gbvrt95.seq
 404715121     gbvrt96.seq
 489464188     gbvrt97.seq
 499106074     gbvrt98.seq
 486716912     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         101420     185321416
BCT10        104        247294913
BCT100       87         223588406
BCT101       80         226287962
BCT102       20         45564131
BCT103       124        217933644
BCT104       53         217706139
BCT105       89         225179091
BCT106       56         148271596
BCT107       94         227859083
BCT108       73         219469130
BCT109       112        221134503
BCT11        158        243728409
BCT110       78         197436829
BCT111       151        221211798
BCT112       87         224943829
BCT113       77         217244229
BCT114       134        226822806
BCT115       97         220860781
BCT116       89         227801861
BCT117       75         156794674
BCT118       115        225967887
BCT119       92         220409897
BCT12        146        239228381
BCT120       158        214217907
BCT121       88         207032597
BCT122       140        221673291
BCT123       63         218436112
BCT124       90         215069748
BCT125       125        215786686
BCT126       87         220066146
BCT127       21         65066945
BCT128       174        220602790
BCT129       125        222941413
BCT13        170        237845538
BCT130       123        219745957
BCT131       166        221868080
BCT132       48         154061987
BCT133       103        221970115
BCT134       112        217634974
BCT135       142        222969051
BCT136       107        216561771
BCT137       124        222163867
BCT138       90         146588770
BCT139       95         229134325
BCT14        161        246345908
BCT140       107        223244277
BCT141       100        225740402
BCT142       110        221794950
BCT143       93         220088855
BCT144       140        219818715
BCT145       21         43827403
BCT146       169        220902023
BCT147       100        223728003
BCT148       94         222167747
BCT149       93         209436870
BCT15        189        252783233
BCT150       71         223304376
BCT151       122        230432633
BCT152       151        231857503
BCT153       78         203290351
BCT154       100        225798024
BCT155       96         228319555
BCT156       139        223679571
BCT157       77         220323988
BCT158       20         67790727
BCT159       119        222290855
BCT16        78         171407593
BCT160       153        228109372
BCT161       69         216057546
BCT162       80         115502557
BCT163       111        216184725
BCT164       156        227708035
BCT165       111        220250972
BCT166       89         136614524
BCT167       133        229717687
BCT168       111        208992481
BCT169       99         217922433
BCT17        138        235574901
BCT170       81         223178114
BCT171       10         9680111
BCT172       98         220150284
BCT173       132        227699493
BCT174       124        223386758
BCT175       117        242580388
BCT176       116        233244770
BCT177       29         81157459
BCT178       138        219191771
BCT179       86         222769161
BCT18        99         230639561
BCT180       108        224413134
BCT181       118        222428501
BCT182       67         117928221
BCT183       127        226982633
BCT184       135        255022614
BCT185       114        226333191
BCT186       158        220019044
BCT187       42         78130485
BCT188       119        217568478
BCT189       118        214677583
BCT19        84         217062476
BCT190       89         220134021
BCT191       102        229896253
BCT192       96         177710765
BCT193       97         234475408
BCT194       102        220656832
BCT195       91         222992603
BCT196       96         223718717
BCT197       100        222627184
BCT198       107        228115024
BCT199       62         130236204
BCT2         106        226909535
BCT20        454        192738183
BCT200       104        221661048
BCT201       111        222476358
BCT202       99         224960460
BCT203       71         266229652
BCT204       75         254647899
BCT205       106        225367374
BCT206       176        219971681
BCT207       137        226750080
BCT208       52         97375579
BCT209       324        275336670
BCT21        5200       7533877
BCT210       116        218483965
BCT211       118        218157941
BCT212       41         68635463
BCT213       89         220099828
BCT214       85         224231671
BCT215       85         236035678
BCT216       102        223628599
BCT217       20         45849980
BCT218       60         216868170
BCT219       120        221119124
BCT22        10402      13141863
BCT220       87         227479657
BCT221       89         223478018
BCT222       18         38638072
BCT223       160        280339359
BCT224       84         230435371
BCT225       97         220252015
BCT226       133        186348112
BCT227       109        262921422
BCT228       72         217635148
BCT229       100        214909619
BCT23        53918      202021542
BCT230       73         196848060
BCT231       140        302426918
BCT232       68         237086992
BCT233       94         221296472
BCT234       149        218508513
BCT235       138        294592126
BCT236       2          1834681
BCT237       146        273570514
BCT238       99         253123186
BCT239       35         229277923
BCT24        189        216139113
BCT240       68         227137462
BCT241       115        218817429
BCT242       130        221898630
BCT243       82         247156788
BCT244       66         156141181
BCT245       125        215030391
BCT246       113        223212915
BCT247       132        226914790
BCT248       121        228718965
BCT249       103        227161228
BCT25        103        228704622
BCT250       117        221642861
BCT251       107        219875030
BCT252       82         221004380
BCT253       102        229005718
BCT254       117        227492932
BCT255       80         239811818
BCT256       100        230054773
BCT257       95         177852408
BCT258       130        229051582
BCT259       161        213902132
BCT26        118        231551515
BCT260       165        210279410
BCT261       119        241684563
BCT262       114        225725849
BCT263       144        249576616
BCT264       133        239033470
BCT265       6          29270038
BCT266       138        226476297
BCT267       110        214348503
BCT268       100        231589820
BCT269       105        223564735
BCT27        25         63062813
BCT270       167        215614868
BCT271       149        224639906
BCT272       5          10601295
BCT273       118        232028376
BCT274       107        221060760
BCT275       69         222375717
BCT276       89         211773759
BCT277       82         119482108
BCT278       88         244048892
BCT279       104        228435128
BCT28        103        220877412
BCT280       83         220913226
BCT281       62         219469959
BCT282       63         114057886
BCT283       123        221075337
BCT284       94         219714243
BCT285       126        215751449
BCT286       102        221141305
BCT287       120        163875773
BCT288       121        249554866
BCT289       105        223359328
BCT29        131        225261716
BCT290       69         221784611
BCT291       90         223731124
BCT292       51         128798431
BCT293       128        238885544
BCT294       202        236078502
BCT295       151        217102020
BCT296       113        215646127
BCT297       110        167829286
BCT298       149        248068948
BCT299       130        233332591
BCT3         37537      123328135
BCT30        119        219809790
BCT300       54         231762411
BCT301       85         227016040
BCT302       107        225759474
BCT303       1237       219663033
BCT304       77         186119416
BCT305       97         222404361
BCT306       130        218917761
BCT307       187        230827585
BCT308       224        223340680
BCT309       117        220548798
BCT31        125        219253793
BCT310       36         71090868
BCT311       121        219409928
BCT312       156        220836681
BCT313       131        232194658
BCT314       125        233400233
BCT315       89         216534316
BCT316       123        235311629
BCT317       136        231686324
BCT318       141        216602729
BCT319       91         228640305
BCT32        128        223087901
BCT320       16         32424372
BCT321       107        234455139
BCT322       132        223923261
BCT323       60         225790121
BCT324       72         219590965
BCT325       154        157872730
BCT326       196        229726398
BCT327       117        225778437
BCT328       192        222307727
BCT329       96         259068328
BCT33        195        224497881
BCT330       97         231131453
BCT331       47         216825174
BCT332       55         219307817
BCT333       1          64997
BCT334       98         222073716
BCT335       93         222681162
BCT336       117        227153088
BCT337       105        220294822
BCT338       78         155127421
BCT339       150        272697483
BCT34        26         45760778
BCT340       485        230619573
BCT341       143        239816528
BCT342       154        237410848
BCT343       68         158480052
BCT344       102        232488776
BCT345       87         220138491
BCT346       109        222699939
BCT347       117        225792646
BCT348       16         27364983
BCT349       94         225841685
BCT35        255        228290103
BCT350       162        317806402
BCT351       109        291991399
BCT352       88         227080138
BCT353       117        228119053
BCT354       95         232334938
BCT355       122        219601771
BCT356       151        219105852
BCT357       103        149520898
BCT358       528        115589384
BCT359       1589       2511957
BCT36        96         216108910
BCT360       3172       5268484
BCT361       6338       7796395
BCT362       12613      14997690
BCT363       25523      27672494
BCT364       50567      54073229
BCT365       148991     156780826
BCT366       14092      193452411
BCT367       3297       203942569
BCT368       2226       213238336
BCT369       47414      187676269
BCT37        102        220149568
BCT370       75150      183096660
BCT371       11009      200050855
BCT372       24971      203211548
BCT373       142206     152926166
BCT374       149338     156951830
BCT375       84336      88044171
BCT376       144683     151204157
BCT377       25762      25402255
BCT378       132683     167799730
BCT379       30805      42489942
BCT38        139        223015436
BCT380       116398     178665009
BCT381       7151       16532032
BCT382       32443      52750570
BCT383       20876      279658497
BCT384       5748       229640416
BCT385       5035       225442726
BCT386       3847       224092509
BCT387       1445       272626586
BCT388       105        221757820
BCT389       55         216742189
BCT39        106        222031667
BCT390       70         215321341
BCT391       33         131631016
BCT392       69         224394912
BCT393       174        238189889
BCT394       698        288930533
BCT395       274        83685207
BCT396       1239       200896867
BCT397       522        258952598
BCT398       130        381930922
BCT399       747        288081065
BCT4         41293      139254430
BCT40        161        220965710
BCT400       1731       177311929
BCT401       87         224654833
BCT402       86         227602753
BCT403       2730       243536265
BCT404       1231       124306264
BCT405       1412       261424764
BCT406       47         241352896
BCT407       45         243003094
BCT408       2180       269716913
BCT409       945        54278114
BCT41        133        221316823
BCT410       2274       268989543
BCT411       83         274582043
BCT412       417        283029526
BCT413       3013       242244257
BCT414       11931      19896634
BCT415       25173      41974899
BCT416       118480     188827745
BCT417       122754     191010759
BCT418       62426      107186131
BCT42        111        220464912
BCT43        123        223234818
BCT44        131        218260172
BCT45        105        232532281
BCT46        130        224240038
BCT47        69         107124734
BCT48        95         230912422
BCT49        117        227983621
BCT5         20648      169648440
BCT50        160        232898310
BCT51        154        221704284
BCT52        128        238275556
BCT53        114        230664549
BCT54        54         123393656
BCT55        300        239582260
BCT56        142        231562727
BCT57        354        225466658
BCT58        111        222896198
BCT59        121        213352666
BCT6         2600       37759883
BCT60        120        227473574
BCT61        98         224926366
BCT62        90         224039666
BCT63        103        223607010
BCT64        52         129132706
BCT65        53         211054879
BCT66        45         210584326
BCT67        45         210864282
BCT68        45         212727898
BCT69        76         222861078
BCT7         1310       133308362
BCT70        40         115080869
BCT71        112        227959956
BCT72        129        231316827
BCT73        99         245428056
BCT74        87         223381451
BCT75        59         181990919
BCT76        95         236396547
BCT77        104        227684880
BCT78        60         225896168
BCT79        62         130720693
BCT8         189        237087597
BCT80        97         233622726
BCT81        82         229505918
BCT82        100        238937572
BCT83        24         34605195
BCT84        94         226656782
BCT85        118        229172918
BCT86        127        232212861
BCT87        90         178403076
BCT88        114        212138354
BCT89        75         222053892
BCT9         134        238319576
BCT90        112        225347102
BCT91        124        217786851
BCT92        3          5977905
BCT93        246        222256023
BCT94        104        221252195
BCT95        100        224644129
BCT96        83         222703364
BCT97        21         86233168
BCT98        68         221578114
BCT99        87         219795379
ENV1         190058     141893347
ENV10        186270     146048183
ENV11        209763     130996620
ENV12        177022     144849961
ENV13        155460     156526877
ENV14        250295     68810926
ENV15        87155      20070905
ENV16        220965     118700470
ENV17        255796     108837965
ENV18        202934     127152944
ENV19        22313      22032787
ENV2         165531     152006087
ENV20        152295     158747207
ENV21        201148     103385078
ENV22        68251      51338470
ENV23        213350     108930872
ENV24        170942     153805632
ENV25        135008     163681931
ENV26        11514      15687256
ENV27        179957     128306357
ENV28        218092     118351391
ENV29        78214      41657342
ENV3         67340      222184321
ENV30        143993     98017210
ENV31        100659     112292261
ENV32        130020     79921199
ENV33        173945     138872013
ENV34        165404     138570134
ENV35        177091     112197197
ENV36        200940     107249278
ENV37        196359     109588081
ENV38        110147     97118441
ENV39        158079     134833872
ENV4         181705     162360276
ENV40        145129     136781063
ENV41        168846     47691177
ENV42        172123     133192838
ENV43        211361     99908860
ENV44        140192     61643754
ENV45        216485     84261611
ENV46        212772     92662835
ENV47        108037     43404663
ENV48        224648     98837461
ENV49        224492     91955037
ENV5         39295      10761703
ENV50        140948     90863623
ENV51        198788     110729335
ENV52        179665     90471800
ENV53        201685     107295222
ENV54        204959     156356343
ENV55        238497     93168204
ENV56        96568      43699622
ENV57        195099     111992569
ENV58        126720     172723617
ENV59        42064      234557471
ENV6         218990     102587726
ENV7         176400     159900774
ENV8         19527      17045560
ENV9         204718     124205617
EST1         152690     59075604
EST10        155848     67145433
EST100       152900     76533879
EST101       145310     99404929
EST102       145325     85607865
EST103       149132     92919202
EST104       6681       3970697
EST105       149700     109472275
EST106       135201     99323583
EST107       136256     97451505
EST108       136283     94853558
EST109       2281       1508086
EST11        163604     69204453
EST110       137039     77376129
EST111       176769     106148584
EST112       193813     119045227
EST113       235878     141017018
EST114       7153       4398563
EST115       228229     127103651
EST116       183114     103694875
EST117       191632     94586043
EST118       3390       2617463
EST119       148776     100418839
EST12        150663     64729921
EST120       154737     119075941
EST121       166401     98014596
EST122       21716      15235645
EST123       130041     82536108
EST124       83544      30919585
EST125       36755      12481213
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186795     83522118
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173726     87636772
EST136       170476     77687375
EST137       146473     92462403
EST138       28353      17914828
EST139       141414     87650732
EST14        104646     47789359
EST140       149167     98040854
EST141       157785     78490306
EST142       180945     92631162
EST143       7797       4561553
EST144       141653     76089811
EST145       151608     73215366
EST146       148403     87052362
EST147       155950     83674655
EST148       11460      6757580
EST149       166189     102138931
EST15        197356     111644310
EST150       202212     107328947
EST151       158904     93313615
EST152       102193     51051713
EST153       156480     79482516
EST154       135477     80322193
EST155       141407     87991502
EST156       166678     86186626
EST157       7486       4323274
EST158       179043     104198048
EST159       218733     94430895
EST16        147207     104729580
EST160       145774     85841747
EST161       161649     87789494
EST162       2683       1273073
EST163       141208     82864856
EST164       133361     84329255
EST165       147190     88156848
EST166       146175     80277952
EST167       19595      9942032
EST168       117769     61073260
EST169       115690     61941713
EST17        156552     83419127
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125704     48478849
EST175       165762     83297359
EST176       172200     75566895
EST177       24700      15540223
EST178       147743     104364925
EST179       163429     99358064
EST18        191244     116974070
EST180       205284     116217156
EST181       167196     93392797
EST182       154088     103355718
EST183       134248     92949098
EST184       10655      5947216
EST185       146779     94226149
EST186       155082     81021983
EST187       132003     71138046
EST188       160938     90624179
EST189       12956      8185513
EST19        177593     113222957
EST190       148391     87401995
EST191       153611     95444734
EST192       175584     99196287
EST193       140633     77175244
EST194       5357       4372616
EST195       124150     64387264
EST196       163256     91154836
EST197       172881     99349223
EST198       149929     93111504
EST199       5475       3456868
EST2         157296     60515696
EST20        70514      55347428
EST200       165696     79441379
EST201       122431     84562161
EST202       163946     96609849
EST203       163919     95915492
EST204       12854      6191292
EST205       5847       2580354
EST206       111215     63112536
EST207       151296     87159961
EST208       107003     63421010
EST209       164716     101071760
EST21        194718     109379150
EST210       168459     124870746
EST211       82054      66695266
EST212       186353     95082816
EST213       145812     90577718
EST214       86904      65310717
EST215       142217     85392520
EST216       138361     75187981
EST217       94838      30474438
EST218       146971     86308548
EST219       149277     82730422
EST22        180131     92525151
EST220       141166     94336724
EST221       156070     90317772
EST222       8489       6085268
EST223       162144     99678311
EST224       153932     93687490
EST225       123359     88333195
EST226       145975     90180727
EST227       6782       4105919
EST228       129115     82217406
EST229       127997     89777106
EST23        106728     50178019
EST230       44037      31646845
EST231       156432     83333109
EST232       167399     92029695
EST233       166930     92691537
EST234       158122     88081303
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        191052     61413874
EST240       187909     98489047
EST241       191640     107206156
EST242       168052     100159582
EST243       180324     103395206
EST244       190067     112774100
EST245       186313     113300888
EST246       177976     115378463
EST247       6774       5366330
EST248       140570     86049857
EST249       212281     139240940
EST25        136493     39205181
EST250       224238     109510335
EST251       164077     113921229
EST252       183152     95755613
EST253       198082     98538516
EST254       122211     89202303
EST255       5592       3806885
EST256       140307     82414303
EST257       206502     112921863
EST258       162387     106242667
EST259       94150      93177594
EST26        102352     27613958
EST260       14565      18982548
EST261       147779     99296372
EST262       151103     89976672
EST263       139488     102018322
EST264       217412     99726072
EST265       2684       1846713
EST266       134233     96889460
EST267       131016     91584673
EST268       135741     98214097
EST269       113668     81492229
EST27        201622     85286892
EST270       14850      9378331
EST271       136074     84237789
EST272       126197     86196946
EST273       128323     97050498
EST274       35670      25454263
EST275       126754     89472101
EST276       116718     79174411
EST277       139559     84221793
EST278       145829     114775573
EST279       14746      10386053
EST28        19493      8764926
EST280       125388     117381359
EST281       132659     98909184
EST282       162568     97733706
EST283       165650     104454839
EST284       18821      11787955
EST285       142295     92460345
EST286       169036     115171128
EST287       151612     103866108
EST288       136563     103388843
EST289       3122       2012582
EST29        204108     100212775
EST290       159550     97230714
EST291       222471     90724791
EST292       152859     111337310
EST293       160411     71793266
EST294       10529      1190647
EST295       208923     37984366
EST296       212167     83253891
EST297       150191     115332672
EST298       168091     97752036
EST299       154879     103184574
EST3         156029     54736569
EST30        216063     108845959
EST300       169072     109986615
EST301       149587     109938627
EST302       1951       1320641
EST303       180875     102305456
EST304       178791     93163079
EST305       168899     109550180
EST306       158882     104101268
EST307       2135       1704887
EST308       226903     106725089
EST309       267202     116187840
EST31        153984     67133271
EST310       184609     111769181
EST311       149924     28237311
EST312       230065     100576835
EST313       174888     100151227
EST314       156386     99990555
EST315       158540     94407905
EST316       166394     114093378
EST317       179942     95197248
EST318       143687     97189386
EST319       188156     110324042
EST32        149544     63745823
EST320       187345     49208208
EST321       201870     33894008
EST322       174443     95509500
EST323       14472      9105625
EST324       158346     113326097
EST325       184784     110470367
EST326       167586     97771795
EST327       165650     109621452
EST328       165922     71417216
EST329       127843     80161184
EST33        165218     65709042
EST330       121728     80853125
EST331       146606     101299104
EST332       21746      7720907
EST333       250640     26635193
EST334       254708     23392102
EST335       151991     94206454
EST336       152235     98594976
EST337       151209     99840551
EST338       145954     92203211
EST339       237889     43423093
EST34        147096     64546103
EST340       185433     81237254
EST341       3685       4554017
EST342       169321     100001066
EST343       163485     100908119
EST344       145649     92756666
EST345       189916     103387744
EST346       155962     109693704
EST347       153571     101545456
EST348       1864       707553
EST349       184471     108452053
EST35        162710     70909747
EST350       169894     94651816
EST351       169250     105165467
EST352       178308     59602870
EST353       195038     71941256
EST354       194528     75305704
EST355       197065     74426894
EST356       135405     70508640
EST357       174836     127386098
EST358       148407     85117807
EST359       150566     86648213
EST36        160506     65845683
EST360       122052     95387840
EST361       5228       4156832
EST362       143577     94945899
EST363       155634     94558686
EST364       162062     90080072
EST365       157801     100316004
EST366       21621      9602251
EST367       45656      24624838
EST368       155318     104549016
EST369       137850     97037511
EST37        107955     33687683
EST370       158528     102036132
EST371       153057     110091631
EST372       29680      25288248
EST373       173564     146756127
EST374       163572     85433279
EST375       128159     81338294
EST376       137894     94126530
EST377       50614      35398778
EST378       131494     88185695
EST379       137434     89857472
EST38        99514      30487965
EST380       139740     97251188
EST381       147676     97316524
EST382       50112      40449160
EST383       164182     86552371
EST384       143622     81415127
EST385       144915     86073821
EST386       144157     103713157
EST387       155646     93181756
EST388       138127     87591810
EST389       133463     84875714
EST39        99152      31401585
EST390       19252      11819086
EST391       196902     107235645
EST392       137014     75086496
EST393       92962      54579752
EST394       120675     80303449
EST395       23099      14175362
EST396       131518     83245448
EST397       119611     76575368
EST398       147508     80760259
EST399       210532     82594640
EST4         142933     56343102
EST40        98817      29785816
EST400       29791      12543861
EST401       163649     84380495
EST402       163929     99177970
EST403       159177     95841266
EST404       125633     81071284
EST405       12450      8163608
EST406       129141     86476992
EST407       137033     89905278
EST408       178976     112236854
EST409       154128     93135231
EST41        39222      11595646
EST410       28333      12277799
EST411       166745     92047209
EST412       168862     124889078
EST413       87364      56108523
EST414       69679      41103486
EST415       34092      16783013
EST416       137530     79965946
EST417       82413      49409226
EST418       139766     56852944
EST419       148868     30145933
EST42        101326     31351096
EST420       148732     30447498
EST421       163273     80663592
EST422       26173      14136342
EST423       201222     115845880
EST424       237755     108748183
EST425       220202     107509766
EST426       127047     74475061
EST427       128057     85803248
EST428       131704     80409324
EST429       93228      56881081
EST43        102633     36243427
EST430       173975     110008863
EST431       213501     84775693
EST432       106339     28485828
EST433       184755     112765867
EST434       204073     111451866
EST435       178855     105573289
EST436       197595     116862339
EST437       134477     63096462
EST438       110830     60475088
EST439       163287     109043698
EST44        95475      48218258
EST440       182140     116752022
EST441       106403     84554937
EST442       177181     139826371
EST443       150386     90557227
EST444       53982      34345685
EST445       166520     107182981
EST446       178543     101235231
EST447       42175      24141500
EST448       195798     106768392
EST449       185317     95089728
EST45        121121     52335541
EST450       50433      37888207
EST451       189934     115836172
EST452       180026     118008074
EST453       54535      33956141
EST454       196677     133946397
EST455       218252     122876729
EST456       191464     127720063
EST457       184004     144689626
EST458       204243     156003038
EST459       192710     115536227
EST46        55810      33167886
EST460       161445     96690107
EST461       181214     94252913
EST462       6221       516980
EST463       53496      4381716
EST464       158232     12239421
EST465       144975     12987161
EST466       148608     30079541
EST467       149063     29643665
EST468       7062       1471579
EST469       148744     30417064
EST47        177065     89170482
EST470       141747     81732604
EST471       172605     100989345
EST472       161454     110702014
EST473       17171      12297887
EST474       160968     92911974
EST475       150622     104098642
EST476       133699     93222175
EST477       141789     98123728
EST478       16074      8261534
EST479       157380     103682725
EST48        158217     65104402
EST480       146153     105108584
EST481       162018     97570478
EST482       165903     51037876
EST483       12066      1897051
EST484       160517     40369185
EST485       151959     102983430
EST486       149516     98088273
EST487       170713     111736796
EST488       17955      10002926
EST489       132815     75920561
EST49        162352     92229006
EST490       189716     107933724
EST491       149564     109198403
EST492       53155      36073998
EST493       126855     87064282
EST494       145709     90286473
EST495       148633     89486839
EST496       163483     89070769
EST497       35259      17962765
EST498       151814     92135788
EST499       156231     92108182
EST5         162094     62614875
EST50        154203     80120373
EST500       168657     102137390
EST501       136391     85619277
EST502       15234      8455267
EST503       100274     71184924
EST504       78633      60626261
EST505       97623      64860807
EST506       143664     80553208
EST507       36770      20999127
EST508       120992     73607850
EST509       133540     87501363
EST51        156506     74874317
EST510       135574     79506177
EST511       152825     93053797
EST512       44831      24810594
EST513       155676     85797389
EST514       184807     110595728
EST515       121358     79430510
EST516       178199     94655647
EST517       4663       1735339
EST518       52576      18674859
EST519       183577     101191900
EST52        108103     61120240
EST520       152041     81311362
EST521       22152      13410986
EST522       162316     94446797
EST523       211757     123975299
EST524       29664      19024876
EST525       147952     99622109
EST526       158950     98067836
EST527       134310     87388255
EST528       129803     88585688
EST529       24481      15268552
EST53        153908     88947693
EST530       179560     74468277
EST531       179108     79600547
EST532       198743     83525940
EST533       194777     80469363
EST534       3399       1184710
EST535       178841     95307232
EST536       174444     102485197
EST537       180225     107869574
EST538       171856     103650134
EST539       197056     126802532
EST54        154293     84993684
EST540       185622     103031573
EST541       178835     82756859
EST542       144984     92892057
EST543       206771     125126638
EST544       205624     126733200
EST545       193601     113613032
EST546       193784     111741497
EST547       154091     96436815
EST548       187948     117407713
EST549       166670     98999925
EST55        152223     92300142
EST550       133843     98243253
EST551       8876       7222302
EST552       157285     92184364
EST553       170556     85010427
EST554       149108     85057667
EST555       151186     81955201
EST556       11761      7024059
EST557       156517     79983850
EST558       181361     106397624
EST559       162545     103085348
EST56        149911     69862704
EST560       175369     108186389
EST561       3227       2163095
EST562       170744     117107232
EST563       183920     113640835
EST564       129040     83662465
EST565       169422     97775191
EST566       184328     110396251
EST567       33805      22063652
EST568       204465     119127975
EST569       269542     91763948
EST57        142238     76745964
EST570       25664      9425377
EST571       262943     83717893
EST572       157489     57559627
EST573       162302     59144545
EST574       80395      30734692
EST58        151729     83212808
EST59        161295     65822492
EST6         166275     65040988
EST60        144394     70073562
EST61        160487     90001957
EST62        150491     92643807
EST63        150082     99330151
EST64        157768     94520372
EST65        2311       971717
EST66        154957     103559420
EST67        163155     82983914
EST68        166584     84965551
EST69        141947     77582568
EST7         163878     67751506
EST70        148485     82582115
EST71        149150     86200860
EST72        148767     92333215
EST73        150780     87650388
EST74        2428       1418600
EST75        29919      18235506
EST76        186810     102879363
EST77        170381     90703955
EST78        212600     115719905
EST79        179405     103336400
EST8         160911     67789464
EST80        2149       1460388
EST81        196745     121640362
EST82        167598     93368851
EST83        136170     63353526
EST84        128101     62642854
EST85        10941      5602960
EST86        150434     92651323
EST87        154703     97020497
EST88        130185     66307353
EST89        140318     89371875
EST9         169422     69381975
EST90        14221      7368767
EST91        183875     92118813
EST92        204513     119858415
EST93        201907     107931576
EST94        191732     90226571
EST95        204075     87104446
EST96        145905     86978261
EST97        137870     84930613
EST98        158565     76398614
EST99        9280       6073374
GSS1         172835     126577261
GSS10        14910      14401612
GSS100       169261     144380017
GSS101       157745     108933470
GSS102       155986     106345499
GSS103       152475     105542661
GSS104       168005     122783070
GSS105       149829     126592844
GSS106       162068     125197053
GSS107       186640     116036674
GSS108       16014      9794559
GSS109       185786     119804494
GSS11        146520     107104696
GSS110       201450     104020421
GSS111       219926     124042541
GSS112       87280      56947051
GSS113       152300     114320098
GSS114       155174     118808877
GSS115       155139     118868834
GSS116       163490     106671356
GSS117       36986      21467879
GSS118       179848     132289982
GSS119       189894     117148040
GSS12        200845     104095407
GSS120       166036     55080797
GSS121       170071     76702837
GSS122       2028       1303403
GSS123       161778     105245778
GSS124       189210     124956394
GSS125       200987     81591982
GSS126       166850     79919427
GSS127       137307     94457298
GSS128       129872     104613764
GSS129       132040     108783227
GSS13        192061     84602804
GSS130       132451     106046726
GSS131       8003       5920029
GSS132       135214     112032054
GSS133       56598      47104660
GSS134       132584     107786768
GSS135       139149     116140565
GSS136       140043     114408742
GSS137       138251     109584898
GSS138       4155       2820771
GSS139       134784     106426486
GSS14        173230     89230312
GSS140       134049     108003847
GSS141       134400     111531585
GSS142       138188     116474348
GSS143       4675       3643453
GSS144       139468     108106612
GSS145       136810     113648547
GSS146       136898     113473892
GSS147       137299     112649085
GSS148       559        466085
GSS149       137155     110923756
GSS15        167983     83930679
GSS150       134480     106278327
GSS151       133002     107665198
GSS152       138659     116136290
GSS153       1985       1674795
GSS154       127182     92203837
GSS155       174275     105162567
GSS156       184915     110237841
GSS157       162344     108754861
GSS158       176892     102083573
GSS159       197105     129369627
GSS16        160060     81615096
GSS160       201456     133367764
GSS161       200727     134041970
GSS162       179380     125427766
GSS163       198341     136948587
GSS164       196713     139067120
GSS165       196065     138672070
GSS166       174298     134353538
GSS167       144791     97546246
GSS168       138200     80523134
GSS169       165330     73398615
GSS17        156174     85673627
GSS170       129814     57820242
GSS171       163014     141019316
GSS172       170950     113527672
GSS173       80812      52920567
GSS174       191881     129015715
GSS175       196554     117983862
GSS176       28456      14940540
GSS177       180225     98140530
GSS178       181302     123365801
GSS179       178800     126906476
GSS18        152981     95677320
GSS180       181098     127179984
GSS181       19114      12799890
GSS182       165902     130533276
GSS183       170977     155597399
GSS184       219919     123799690
GSS185       216581     103401654
GSS186       17290      8049466
GSS187       210015     95106166
GSS188       156579     134385514
GSS189       6807       6749646
GSS19        153777     72780066
GSS190       125540     102753347
GSS191       122235     93469471
GSS192       156847     154495780
GSS193       167720     158232911
GSS194       131396     104305071
GSS195       146409     106045244
GSS196       171951     142160534
GSS197       176113     118230948
GSS198       1822       1024249
GSS199       181316     133971324
GSS2         173590     107820163
GSS20        106476     59071274
GSS200       184911     120117379
GSS201       180126     93029105
GSS202       172829     121726073
GSS203       189216     117024741
GSS204       189414     116726891
GSS205       21729      12651457
GSS206       200615     129990067
GSS207       215712     142629172
GSS208       217635     140382802
GSS209       166429     136402995
GSS21        132536     64638951
GSS210       152471     108703336
GSS211       160065     120654204
GSS212       160039     145460383
GSS213       158365     140331734
GSS214       160859     145750229
GSS215       162431     144534355
GSS216       163049     142910892
GSS217       159417     122903915
GSS218       168345     139695448
GSS219       161743     115993986
GSS22        125191     56725897
GSS220       180530     88689585
GSS221       2575       1768585
GSS222       251369     52150506
GSS223       262481     40466091
GSS224       262523     40408947
GSS225       122800     38229504
GSS226       253355     52912344
GSS227       182565     86129448
GSS228       189053     56109501
GSS229       154111     118306719
GSS23        134196     73094577
GSS230       177033     144334259
GSS231       160568     145787944
GSS232       159531     147010793
GSS233       174549     109955224
GSS234       238210     57319690
GSS235       198151     101373468
GSS236       229425     39759432
GSS237       119092     74589582
GSS238       174037     112053848
GSS239       147876     90054034
GSS24        143035     74371292
GSS240       140667     84084607
GSS241       159799     149653479
GSS242       5867       4995483
GSS243       112668     95722541
GSS244       180351     149222837
GSS245       172954     122407496
GSS246       201906     127716652
GSS247       188210     120275961
GSS248       166175     94403497
GSS249       159875     84508026
GSS25        12092      5172754
GSS250       156434     119873333
GSS251       203514     148104231
GSS252       14295      9396358
GSS253       171523     67875770
GSS254       176683     96454754
GSS255       195475     152072364
GSS256       199776     154504000
GSS257       7495       6183699
GSS258       197814     157230621
GSS259       197524     124135449
GSS26        140902     65659537
GSS260       194877     142594284
GSS261       692        477602
GSS262       214689     131396752
GSS263       189975     57643041
GSS264       218563     111965788
GSS265       170728     153965245
GSS266       163848     150141940
GSS267       234900     132469628
GSS268       220564     118386800
GSS27        159866     79842837
GSS28        156781     92819331
GSS29        165485     85429158
GSS3         138092     115755088
GSS30        9306       4806100
GSS31        171978     102877480
GSS32        182794     109078835
GSS33        182359     87084166
GSS34        172891     102147817
GSS35        191042     104301903
GSS36        162180     112295088
GSS37        160412     98258266
GSS38        173347     108755974
GSS39        3657       2623945
GSS4         140176     112446194
GSS40        183985     122974505
GSS41        181701     117299100
GSS42        52326      27358639
GSS43        177832     102911728
GSS44        164530     141989063
GSS45        179635     148565674
GSS46        139660     92477151
GSS47        182857     132009511
GSS48        181606     114545298
GSS49        204426     116967806
GSS5         11597      8660962
GSS50        185610     99476531
GSS51        211954     108037045
GSS52        211747     108318359
GSS53        197315     132797049
GSS54        158211     124808059
GSS55        185589     139410158
GSS56        196775     63134337
GSS57        171826     96464104
GSS58        157611     106106204
GSS59        23373      13575160
GSS6         152749     116375726
GSS60        166616     156645100
GSS61        177157     98801574
GSS62        161196     115202462
GSS63        172331     112351434
GSS64        173858     117792409
GSS65        184258     127655843
GSS66        205711     128748730
GSS67        189998     113287440
GSS68        200686     134224634
GSS69        215702     158336970
GSS7         170888     120025042
GSS70        189038     138024221
GSS71        173742     107642623
GSS72        198219     111980277
GSS73        140725     76414851
GSS74        163079     95884017
GSS75        10697      6814502
GSS76        159270     97756741
GSS77        159481     96970229
GSS78        172285     114351414
GSS79        170749     109399099
GSS8         177211     109005139
GSS80        174370     122402741
GSS81        188943     105261510
GSS82        174817     125816253
GSS83        164286     106564743
GSS84        1705       1353768
GSS85        189623     108718187
GSS86        182037     114287366
GSS87        167146     118346285
GSS88        193343     106201902
GSS89        7220       4213495
GSS9         141891     118699622
GSS90        213933     107583686
GSS91        227285     89235627
GSS92        213465     139505605
GSS93        182539     91847418
GSS94        94686      37020965
GSS95        193805     75823638
GSS96        201086     123394316
GSS97        191020     122180795
GSS98        156116     139401502
GSS99        16660      10968419
HTC1         41206      63404125
HTC2         32318      72275691
HTC3         32080      77890442
HTC4         84836      50647832
HTC5         129901     161568308
HTC6         124887     122728899
HTC7         137620     130764902
HTC8         62038      53520591
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2973       383248998
HTG6         2          386956
HTG60        884        128257683
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3185       360470245
HTG68        3128       367751420
HTG69        2905       377593202
HTG7         2327       375791086
HTG70        1760       298788658
HTG71        3421       365667463
HTG72        2072       381392462
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3219       384192102
HTG8         1500       384347777
HTG80        2166       384708164
HTG81        3033       373087380
HTG82        1921       201803484
HTG9         1582       384062276
INV1         153868     141602635
INV10        14         359428768
INV11        9          363281720
INV12        45         381339161
INV13        17         391129107
INV14        148877     144586674
INV15        4167       4013332
INV16        167348     134486549
INV17        126638     112153422
INV18        37136      273256295
INV19        131142     159761685
INV2         2279       314337091
INV20        92446      75409033
INV21        28890      264750581
INV22        132574     153108098
INV23        116642     81309292
INV24        148922     103533705
INV25        153137     117408891
INV26        116977     79812397
INV27        155150     113580037
INV28        153822     120338111
INV29        52885      35351766
INV3         105148     182218701
INV30        152938     109461626
INV31        153598     115686150
INV32        36112      31366287
INV33        141599     88524971
INV34        147896     93708271
INV35        43524      33244090
INV36        148243     97312441
INV37        139033     81414768
INV38        42968      25472644
INV39        138453     82788298
INV4         58839      272144569
INV40        138186     82828169
INV41        53379      35288107
INV42        139133     83451617
INV43        135606     98991745
INV44        74349      58154310
INV45        142311     108178984
INV46        151816     119924851
INV47        156069     119305063
INV48        84099      209023966
INV49        183035     236941459
INV5         37209      48816190
INV50        216228     165877386
INV51        38629      187147326
INV52        800        42674647
INV53        566        40635863
INV54        8037       115580217
INV55        23329      332915377
INV56        23255      171962006
INV57        68041      305365919
INV58        123287     266863020
INV59        64375      76908791
INV6         129081     165754653
INV60        180571     237306452
INV61        41592      302727004
INV62        310        394019273
INV63        1009       189187131
INV64        103        379133813
INV65        762        278926033
INV66        512        361583828
INV67        8          378508614
INV68        1951       345881985
INV69        5711       352178541
INV7         207        346774014
INV70        11996      307725008
INV71        25602      192918061
INV72        149103     105428031
INV73        153092     93845088
INV74        76962      44716138
INV75        151523     93727799
INV76        152249     109961002
INV77        52298      44968623
INV78        152747     123710935
INV79        152322     116543320
INV8         85         322154899
INV80        131886     142696882
INV9         3          136766944
MAM1         34371      321458046
MAM10        3          325384739
MAM11        1          90795278
MAM12        4          322903327
MAM13        4          298795355
MAM14        6          353843759
MAM15        5          329700903
MAM16        2          289079565
MAM17        3          348530310
MAM18        4          336581445
MAM19        5          375256260
MAM2         21164      32477375
MAM20        6          373952570
MAM21        8          377813420
MAM22        10         189786622
MAM23        54         7614329
MAM24        215        34073042
MAM25        431        71272130
MAM26        861        68509101
MAM27        1706       2411269
MAM28        6836       6159435
MAM29        110526     193401624
MAM3         26813      24993452
MAM30        146727     135857264
MAM31        118658     168124194
MAM32        21010      22561887
MAM33        1          716413629
MAM34        1          662751787
MAM35        1          611347268
MAM36        1          464895054
MAM37        1          288121652
MAM38        3          338107697
MAM39        1          223449203
MAM4         13731      20581276
MAM40        1          210645437
MAM41        1          201318998
MAM42        1          197708286
MAM43        2          320231256
MAM44        2          293750401
MAM45        3          367535284
MAM46        4          351244600
MAM47        3621       272715261
MAM48        66440      269366703
MAM49        5032       5536187
MAM5         3445       7368868
MAM6         107        699953
MAM7         20         277696380
MAM8         1          249270926
MAM9         2          343930246
PAT1         420112     157401527
PAT10        304145     130867951
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185612     168256052
PAT109       194888     145513813
PAT11        235978     217051891
PAT110       97898      55960690
PAT111       244010     110313663
PAT112       143108     226392216
PAT113       78455      27179427
PAT114       88301      271849721
PAT115       224916     124892755
PAT116       225548     104940567
PAT117       1383       4373373
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83496      75711256
PAT120       94887      123404429
PAT121       98575      119757116
PAT122       81936      115813086
PAT123       203246     107719007
PAT124       26004      9048598
PAT125       203754     100553637
PAT126       183516     80730551
PAT127       117379     19495857
PAT128       249678     208804686
PAT129       386274     114660241
PAT13        242994     211781414
PAT130       52277      7524866
PAT131       284013     180154212
PAT132       123570     298400798
PAT133       110156     303168611
PAT134       393190     122432429
PAT135       291155     159112257
PAT136       12156      8181942
PAT137       287143     182661675
PAT138       409358     14024130
PAT139       496819     33315489
PAT14        328430     148444388
PAT140       525210     7878150
PAT141       153451     3896468
PAT142       377434     123823946
PAT143       245688     106279325
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140528     153756176
PAT149       6430       91690961
PAT15        63576      1589400
PAT150       177885     181303248
PAT151       71549      185117590
PAT152       75797      115785873
PAT153       75754      115777597
PAT154       46228      38672101
PAT155       245593     68644096
PAT156       201620     63080405
PAT157       264589     57807808
PAT158       309610     83974682
PAT159       458682     54677011
PAT16        197506     165336355
PAT160       227775     118065838
PAT161       360582     132777471
PAT162       287956     50150817
PAT163       153953     4619268
PAT164       229302     77216332
PAT165       228264     72764362
PAT166       281030     19059507
PAT167       63875      6659946
PAT168       153386     170244271
PAT169       73419      134972964
PAT17        217940     141818088
PAT170       74138      123434478
PAT171       137245     84262620
PAT172       175172     2627580
PAT173       234159     99508566
PAT174       198467     145160935
PAT175       89440      118146847
PAT176       175775     91493086
PAT177       289938     10994120
PAT178       135296     2029440
PAT179       278538     10765362
PAT18        217688     104541162
PAT180       99592      135918967
PAT181       220914     105893965
PAT182       23911      35257067
PAT183       144001     206631238
PAT184       173336     186681447
PAT185       70092      243273682
PAT186       6526       8851302
PAT187       137168     133366031
PAT188       136602     204925855
PAT189       208602     98958365
PAT19        238917     105580979
PAT190       284142     31395558
PAT191       223837     149338323
PAT192       268658     230373189
PAT193       282624     222310160
PAT194       192664     139614235
PAT195       276098     235021090
PAT196       188385     291326630
PAT197       137484     196232251
PAT198       247191     246690030
PAT199       11728      387687504
PAT2         329738     202995707
PAT20        217554     131791854
PAT200       313354     152356909
PAT201       244602     252477336
PAT202       160029     300870611
PAT203       304966     196376510
PAT204       209322     56876953
PAT21        295499     53725241
PAT22        146908     94520680
PAT23        196060     155924286
PAT24        280008     73004339
PAT25        228074     148393949
PAT26        209894     139743682
PAT27        61917      53439850
PAT28        304664     206981310
PAT29        321053     202865066
PAT3         50087      20252853
PAT30        69599      127456494
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255780     169065336
PAT34        232591     137948949
PAT35        62064      29220139
PAT36        159617     193124839
PAT37        187242     152015394
PAT38        212010     134504747
PAT39        97860      9819883
PAT4         329673     180395109
PAT40        349674     21562484
PAT41        269125     102154806
PAT42        166        390395449
PAT43        7307       386172183
PAT44        91531      5254998
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188215     183535869
PAT48        31080      33385575
PAT49        100027     274298521
PAT5         262341     200084354
PAT50        347929     22043956
PAT51        356635     6776065
PAT52        92410      1755790
PAT53        351491     15876326
PAT54        360979     6858601
PAT55        133548     2537412
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217071     164392413
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481513     50384338
PAT63        225625     89296787
PAT64        255032     194791883
PAT65        328497     204098575
PAT66        171125     140507573
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247457     122528606
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224383     103195875
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481332     57361248
PAT84        327286     49350227
PAT85        457190     82984297
PAT86        157264     115535330
PAT87        167236     186402708
PAT88        316483     151149377
PAT89        224121     179749002
PAT9         153178     77962131
PAT90        160632     39956911
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509422     32511534
PAT94        211221     45759082
PAT95        257695     203243540
PAT96        388350     141465739
PAT97        39403      44060491
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8935       215966420
PHG2         4437       221210329
PHG3         5565       215789551
PHG4         1423       58976000
PLN1         135257     172336589
PLN10        18921      157294990
PLN100       25061      110565816
PLN101       13561      89764040
PLN102       1          774434471
PLN103       8305       28494037
PLN104       1861       361385154
PLN105       5          372618381
PLN106       6          372447772
PLN107       6          368295254
PLN108       12434      261982605
PLN109       175681     124267958
PLN11        29377      278503063
PLN110       23026      15606740
PLN111       148616     156368663
PLN112       149754     145545085
PLN113       85659      71262724
PLN114       154197     132601433
PLN115       164258     118613249
PLN116       22396      25509250
PLN117       146804     135199660
PLN118       121680     152171185
PLN119       167377     121846490
PLN12        2653       334345703
PLN120       115275     120198362
PLN121       133875     150414567
PLN122       101586     119879516
PLN123       136038     150081506
PLN124       126836     163452986
PLN125       120572     166343966
PLN126       19219      17406896
PLN127       124602     164192935
PLN128       113175     172859647
PLN129       82232      145384254
PLN13        36         328212626
PLN130       119075     172465593
PLN131       88800      196055372
PLN132       6245       365223017
PLN133       18834      71928444
PLN134       19737      363518883
PLN135       9716       333279100
PLN136       302        288936846
PLN137       5          324373291
PLN138       2471       362574573
PLN139       300        386007137
PLN14        51         343512393
PLN140       8          179149947
PLN141       886        232040685
PLN142       1          522466905
PLN143       1          675310294
PLN144       1          628753756
PLN145       1          624247919
PLN146       1          599018945
PLN147       1          573247234
PLN148       1          634667502
PLN149       27338      160264704
PLN15        2385       347058273
PLN150       5636       1862075
PLN151       5224       2478918
PLN152       1          563502314
PLN153       2014       4567060
PLN154       1          594102056
PLN155       1          689851870
PLN156       1          495453186
PLN157       1          780798557
PLN158       1          801256715
PLN159       1          651852609
PLN16        21648      172849582
PLN160       1          750843639
PLN161       1          830829764
PLN162       1          615552423
PLN163       1          744588157
PLN164       1          673617499
PLN165       1          509857067
PLN166       1          709773743
PLN167       1          713149757
PLN168       1          566080677
PLN169       1          618079260
PLN17        96587      101382138
PLN170       1          720988478
PLN171       1          473592718
PLN172       1          736706236
PLN173       1          750620385
PLN174       1          638686055
PLN175       1          480980714
PLN176       6629       330538619
PLN177       3760       370633860
PLN178       10097      328242863
PLN179       1738       10553159
PLN18        113243     117387036
PLN180       1          585266722
PLN181       1          681112512
PLN182       1          775448786
PLN183       1          790338525
PLN184       1          746673839
PLN185       1          836514780
PLN186       1          736872137
PLN187       1          676292951
PLN188       1          669155517
PLN189       1          701372996
PLN19        57311      72144580
PLN190       1          615672275
PLN191       1          698614761
PLN192       1          728031845
PLN193       1          722970987
PLN194       12266      8463745
PLN195       93849      139156959
PLN196       107657     178298123
PLN197       84847      207428571
PLN198       69656      160966972
PLN199       101606     188768887
PLN2         39213      283450962
PLN20        28689      28922869
PLN200       107158     179927318
PLN201       99251      199557835
PLN202       104150     185665970
PLN203       78847      216126033
PLN204       63306      113344026
PLN21        2648       194594881
PLN22        344        254550430
PLN23        400        261235914
PLN24        198        168828441
PLN25        298        258873545
PLN26        339        265493888
PLN27        485        350911896
PLN28        112        80604200
PLN29        455        379563194
PLN3         3695       380511610
PLN30        127        379253996
PLN31        91         241350431
PLN32        107        353068716
PLN33        21         391404607
PLN34        229        244592824
PLN35        181        340210184
PLN36        12         380640183
PLN37        26         364323699
PLN38        6          339659276
PLN39        4          249554057
PLN4         3520       387700579
PLN40        93         388494695
PLN41        15         373888800
PLN42        9          363551984
PLN43        60         374148929
PLN44        14         212654302
PLN45        74         124609184
PLN46        8          358353307
PLN47        3          347496433
PLN48        4          370651368
PLN49        2          271593360
PLN5         97712      198760858
PLN50        1          150766190
PLN51        2          288204953
PLN52        2          286787940
PLN53        2          295931502
PLN54        41         379963265
PLN55        7          322635309
PLN56        7          376229618
PLN57        6          342806685
PLN58        6          347730275
PLN59        6          350661716
PLN6         111717     128159921
PLN60        43         144640005
PLN61        144        326417895
PLN62        7          298887356
PLN63        6          332369654
PLN64        50         340388796
PLN65        34         333743749
PLN66        1          48961553
PLN67        176        319207187
PLN68        6          349441353
PLN69        5          315927722
PLN7         64132      184832975
PLN70        6          337181162
PLN71        5          299052774
PLN72        13         295635548
PLN73        5          292734482
PLN74        47         313544204
PLN75        2          355063454
PLN76        1          333667882
PLN77        1          302574826
PLN78        1          296818136
PLN79        1          257455782
PLN8         21748      106778457
PLN80        1          252943167
PLN81        1          225803546
PLN82        1          219123305
PLN83        14         394306053
PLN84        37         16871
PLN85        149        79314
PLN86        2469       93786416
PLN87        7181       18795412
PLN88        14346      29953091
PLN89        97817      209452284
PLN9         35233      291274408
PLN90        129325     89960279
PLN91        159111     148407493
PLN92        162954     146660328
PLN93        57327      31180564
PLN94        181662     125850968
PLN95        49813      255589519
PLN96        41703      287605797
PLN97        71413      107590451
PLN98        98644      85504678
PLN99        49729      72847341
PRI1         23036      59776132
PRI10        2265       387936439
PRI11        4375       381729455
PRI12        2069       191983096
PRI13        2459       391020768
PRI14        16196      92542847
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23835      319333697
PRI20        59152      259982661
PRI21        3806       7249854
PRI22        53142      193855733
PRI23        87999      233146434
PRI24        90506      166078696
PRI25        74330      199952244
PRI26        54429      215566213
PRI27        34622      144332518
PRI28        69715      214205348
PRI29        91796      160385664
PRI3         2613       370370379
PRI30        1          229594237
PRI31        1          190673448
PRI32        9367       358515150
PRI33        48946      210914587
PRI34        86157      138329111
PRI4         2409       360399901
PRI5         2593       353874487
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38425      309722718
ROD10        15332      351795437
ROD11        1044       1485319
ROD12        22214      347968493
ROD13        1002       157743814
ROD14        53466      238707384
ROD15        21658      310382782
ROD16        228373     97440021
ROD17        96759      64927759
ROD18        36778      243903259
ROD19        2          383374219
ROD2         1810       346957759
ROD20        2          353017828
ROD21        2          317259772
ROD22        2          289653994
ROD23        1          140975125
ROD24        3          385591618
ROD25        4          335044383
ROD26        5          356599364
ROD27        2          394024503
ROD28        2          369416674
ROD29        2          335852806
ROD3         1885       352024250
ROD30        2          300392300
ROD31        2          283621167
ROD32        3          348161973
ROD33        5          386542915
ROD34        61556      104943433
ROD4         1943       360884621
ROD5         1990       363733749
ROD6         306        57843793
ROD7         1975       368354297
ROD8         1990       369693686
ROD9         1959       368016559
STS1         170465     86854641
STS10        202214     61354897
STS11        167033     59462982
STS2         143549     63344935
STS3         8241       4837486
STS4         108725     63673512
STS5         110379     70040590
STS6         106166     81423611
STS7         122523     86626565
STS8         198746     60874592
STS9         8947       2429326
SYN1         54442      100617525
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        550        392407673
SYN23        65803      184898352
SYN24        9183       352928592
SYN25        17242      334473254
SYN26        109185     160432149
SYN27        26517      80828761
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233380     79653983
TSA10        168620     151882439
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       155667     149676184
TSA109       183762     101150200
TSA11        157833     129928381
TSA110       47316      107437033
TSA111       136931     166476864
TSA112       166663     125028887
TSA113       97439      238063556
TSA114       99621      234258577
TSA115       12096      5797980
TSA116       134299     172499287
TSA117       127822     180391048
TSA118       129653     177320123
TSA119       120977     167690794
TSA12        96970      81223522
TSA120       161752     123773928
TSA121       122463     187577773
TSA122       148092     145309800
TSA123       94145      61033986
TSA124       136345     168539405
TSA125       159333     125157880
TSA126       156667     125822948
TSA127       123052     121148961
TSA13        144445     166877725
TSA14        183430     128404479
TSA15        63704      19333264
TSA16        207559     109270376
TSA17        186915     104023410
TSA18        49380      65170400
TSA19        154786     149639718
TSA2         222501     88764704
TSA20        217000     100217335
TSA21        206229     104285391
TSA22        22275      12385671
TSA23        159463     127641062
TSA24        173240     148979716
TSA25        215107     83751466
TSA26        105264     74950797
TSA27        172910     71716168
TSA28        221930     89798997
TSA29        26888      19147632
TSA3         74593      22546411
TSA30        206110     106021139
TSA31        179811     146674399
TSA32        67801      29056436
TSA33        188249     126080028
TSA34        147266     171548953
TSA35        162994     142851570
TSA36        149877     161586478
TSA37        167355     152088001
TSA38        141407     134166635
TSA39        170803     157995856
TSA4         200107     117397278
TSA40        68091      94849454
TSA41        171892     122248327
TSA42        190077     128883583
TSA43        179459     129714662
TSA44        74818      42557603
TSA45        179837     148961559
TSA46        157618     110427650
TSA47        134614     95382384
TSA48        185173     132793697
TSA49        208467     104145310
TSA5         215390     134315100
TSA50        79060      109863998
TSA51        193326     109684073
TSA52        179856     119164458
TSA53        111895     116975633
TSA54        155188     135994981
TSA55        161488     91817715
TSA56        130888     143857547
TSA57        137093     81293196
TSA58        155281     162331143
TSA59        162871     156980202
TSA6         15756      19456676
TSA60        194209     122378904
TSA61        57557      94587557
TSA62        173905     118336916
TSA63        151865     162169607
TSA64        60980      124236262
TSA65        201109     152115772
TSA66        185638     143700395
TSA67        163479     121752466
TSA68        182133     137371012
TSA69        170697     97722816
TSA7         194553     54897033
TSA70        40596      38103163
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        152989     102336522
TSA76        156503     143538644
TSA77        40595      33645981
TSA78        177556     139010934
TSA79        162022     159228390
TSA8         158334     121004747
TSA80        10510      8595284
TSA81        185669     115791752
TSA82        143419     147913350
TSA83        177759     145455461
TSA84        159235     177039745
TSA85        17013      11869134
TSA86        168307     128893220
TSA87        156344     150391937
TSA88        195418     125564755
TSA89        31945      22564229
TSA9         98089      68621619
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141044     144633048
TSA97        106079     76616395
TSA98        74427      65411867
TSA99        33717      32835466
UNA1         564        582625
VRL1         134045     140236066
VRL10        121864     140078292
VRL11        48847      61484628
VRL12        114872     146034460
VRL13        113644     148452821
VRL14        24479      42657968
VRL15        91401      159503077
VRL16        97984      150726399
VRL17        59041      97793325
VRL18        93145      166828518
VRL19        91430      164885494
VRL2         129414     152180088
VRL20        52829      119061639
VRL21        83663      173680219
VRL22        87105      167903740
VRL23        67656      117139509
VRL24        83471      168430471
VRL25        83536      168934817
VRL26        48253      107670887
VRL27        91757      185406189
VRL28        76543      189135566
VRL29        53160      128163087
VRL3         95146      100272221
VRL30        67860      184161892
VRL31        77588      187659964
VRL32        56334      136341571
VRL33        75782      192755615
VRL34        86332      165501456
VRL35        99700      150797514
VRL36        14184      15162339
VRL4         94868      149464837
VRL5         87454      144791211
VRL6         94251      145056245
VRL7         131613     142488710
VRL8         67496      86228549
VRL9         122119     145552141
VRT1         69923      272854547
VRT10        1171       26255719
VRT100       1          46063367
VRT101       7          344525641
VRT102       6          384186008
VRT103       8          388949147
VRT104       10         334173277
VRT105       1          221441380
VRT106       3          375404155
VRT107       10         379167312
VRT108       34         391313315
VRT109       5          50284038
VRT11        293        13983146
VRT110       1          772932187
VRT111       1          662004353
VRT112       1          535506559
VRT113       1          376147139
VRT114       1          364230008
VRT115       1          346409914
VRT116       1          311292523
VRT117       1          247732340
VRT118       1          228143320
VRT119       1          221182781
VRT12        37         392789976
VRT120       2          321892640
VRT121       463        332402899
VRT122       12         378048109
VRT123       9          378909870
VRT124       6          345737823
VRT125       2          137693511
VRT126       7          385107928
VRT127       8          360581972
VRT128       10         364952837
VRT129       4          133261911
VRT13        13         392458500
VRT130       8          359905961
VRT131       5          370674748
VRT132       9          378247816
VRT133       6          166907986
VRT134       14         379842153
VRT135       15         375595384
VRT136       41         289507176
VRT137       11         366984719
VRT138       1          550518975
VRT139       1          529596002
VRT14        12         379958897
VRT140       1          413748038
VRT141       1          326378286
VRT142       1          272612222
VRT143       1          260396842
VRT144       1          197956435
VRT145       2          384149701
VRT146       2          288058306
VRT147       4          353983664
VRT148       314        371742678
VRT149       2          310725315
VRT15        11         316368323
VRT150       2          280326572
VRT151       3          371471404
VRT152       3          354148189
VRT153       3          303679844
VRT154       4          341249946
VRT155       18         371172209
VRT156       13         392880011
VRT157       4316       375254950
VRT158       15979      316656110
VRT159       139528     132369610
VRT16        13         385338369
VRT160       143779     126004744
VRT161       25949      21791046
VRT17        14         372163844
VRT18        14         352781625
VRT19        19         384683297
VRT2         72836      271705911
VRT20        16         379729070
VRT21        16         381718727
VRT22        2          51507477
VRT23        27         3633251
VRT24        147        10842596
VRT25        586        15797052
VRT26        2343       67436863
VRT27        19198      357652178
VRT28        54169      304802665
VRT29        158690     137238565
VRT3         39507      107094109
VRT30        18060      13357997
VRT31        117719     200760131
VRT32        158112     126703299
VRT33        119709     84176726
VRT34        185725     123623897
VRT35        147975     105388490
VRT36        168362     113566950
VRT37        8178       6929709
VRT38        132976     105585162
VRT39        157550     117896171
VRT4         74944      70627326
VRT40        138138     85010787
VRT41        188429     120013626
VRT42        102727     60970834
VRT43        157968     118976961
VRT44        139953     152409191
VRT45        136        381690353
VRT46        378        379606833
VRT47        1980       384952821
VRT48        93276      219917117
VRT49        145106     21008965
VRT5         37396      74041240
VRT50        75789      25336814
VRT51        13375      365641119
VRT52        20         379347618
VRT53        270        393447049
VRT54        3067       391133617
VRT55        3471       230588304
VRT56        6443       378555114
VRT57        16         388667304
VRT58        16         378559418
VRT59        12         379509384
VRT6         18698      27611025
VRT60        7          285874095
VRT61        12         387522266
VRT62        18         375242791
VRT63        16         386329687
VRT64        180        277847814
VRT65        17         367327734
VRT66        15         385834222
VRT67        7          149460915
VRT68        1          350098611
VRT69        1          332461053
VRT7         5986       380511905
VRT70        1          309313702
VRT71        1          293870033
VRT72        1          232056431
VRT73        1          209933285
VRT74        1          199226436
VRT75        2          392231039
VRT76        2          338442208
VRT77        2          304508243
VRT78        3          317261932
VRT79        7          378896727
VRT8         3363       217068541
VRT80        11         374771935
VRT81        13         379441801
VRT82        3          70710155
VRT83        16         344076996
VRT84        10         385210617
VRT85        15         392781064
VRT86        22         370094349
VRT87        1          839681426
VRT88        1          825560060
VRT89        1          595904407
VRT9         4685       4674270
VRT90        1          486875112
VRT91        1          387033265
VRT92        1          371528181
VRT93        1          313513962
VRT94        1          277530821
VRT95        1          268302114
VRT96        3          319484498
VRT97        5          386368861
VRT98        7          393936069
VRT99        7          384166854

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 236.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, and
uncultured sequences:

Entries        Bases   Species

27106739 20511607704   Homo sapiens
1939555  17189584790   Triticum aestivum
10021332 10445925807   Mus musculus
22996     9981146120   Triticum turgidum subsp. durum
1347097   7585991363   Hordeum vulgare subsp. vulgare
2200722   6537920111   Rattus norvegicus
134824    5721412861   Escherichia coli
2239568   5439163443   Bos taurus
4212790   5252290543   Zea mays
53        5178609725   Rhinatrema bivittatum
3302949   5078176532   Sus scrofa
15        4548060207   Microcaecilia unicolor
39        3773645297   Geotrypetes seraphini
67        3468702984   Erpetoichthys calabaricus
1729828   3191662668   Danio rerio
851       3086460368   Sarcophilus harrisii
2032      2952662191   Bordetella pertussis
1239355   2837036442   Oryzias latipes
311775    2682599514   Arachis hypogaea
852       2668782606   Sciurus vulgaris

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          February 15 2020

                NCBI-GenBank Flat File Release 236.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated MEDLINE entries. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Jim Ostell, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Jim Ostell : Director, NCBI
	Kim Pruitt : Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center