Release Notes For GenBank Release 240

GBREL.TXT          Genetic Sequence Data Bank
                         October 15 2020

               NCBI-GenBank Flat File Release 240.0

                    Distribution Release Notes

  219055207 sequences,  698688094046 bases, for traditional GenBank records
 1947019989 sequences, 9627627030647 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 240.0
1.2 Cutoff Date
1.3 Important Changes in Release 240.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 240.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use the free Sequin software package
for sending sequence data, or the newly developed World Wide Web submission
form.  See Section 1.5 below for details.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       E-MAIL:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       E-MAIL:  update@ncbi.nlm.nih.gov

URL for GenBank's web-based submission tool (BankIt) :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/BankIt

(see Section 1.5 for additional details about submitting data to GenBank.)

*****************************************************************************

  GenBank Release 240.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 240.0, incorporates data processed by the INSDC databases
as of Sunday October 25 2020 at approximately 2:04PM EDT. For more recent data,
users are advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 240.0

1.3.1 Delivery of GenBank 240.0 delayed by two weeks

  A power surge at the NCBI data center and subsequent downtime for a critical
disk storage system led to a nearly two-week delay in the delivery of the data
files for GenBank 240.0. There were no data losses, and public-facing systems
remained available. However, between the direct impacts of the outage and
subsequent efforts to resume processing pipelines, the GenBank release timeline
was significantly pushed back. Our apologies for the delay!

1.3.2 Organizational changes

  The total number of sequence data files increased by 107 with this release:
  
  - the BCT division is now composed of 512 files (+22)
  - the CON division is now composed of 218 files (+1)
  - the INV division is now composed of  97 files (+2)
  - the PAT division is now composed of 213 files (+1)
  - the PLN division is now composed of 594 files (+47)
  - the PRI division is now composed of  45 files (+10)
  - the ROD division is now composed of  56 files (+15)
  - the VRL division is now composed of  44 files (+5)
  - the VRT division is now composed of 214 files (+4)
  
1.4 Upcoming Changes

1.4.1 New /ncRNA_class value : circRNA

  The allowed values for the /ncRNA_class qualifier have been extended
to include "circRNA", for circular RNA molecules. This change will not
appear until on/after GenBank Release 242.0 in February 2021.

1.4.2 New /circular_RNA qualifier

  Complementing the new "circRNA" ncRNA class, a new qualifier will be
introduced on/after GenBank Release 242.0 in February 2021. The
preliminary definition is as follows:

Qualifier       /circular_RNA
Definition      indicates that exons are out-of-order or overlapping because
                this spliced RNA product is a circular RNA (circRNA) created
		by backsplicing, for example when a downstream exon in the
		gene is located 5' of an upstream exon in the RNA product
Value format    none
Example         /circular_RNA
Comment         should be used on features such as CDS, mRNA, tRNA and other features
                that are produced as a result of a backsplicing event. This
                qualifier should be used only when the splice event is indicated in
                the "join" operator, eg join(complement(69611..69724),139856..140087)

  Examples demonstrating the use of /circular_RNA will be provided in
forthcoming GenBank release notes.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank in a usable form. It is especially
important that these submissions be in computer-readable form.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. To
assist researchers in entering their own sequence data, GenBank
provides a WWW submission tool called BankIt, as well as a stand-alone
software package called Sequin. BankIt and Sequin are both easy-to-use
programs that enable authors to enter a sequence, annotate it, and
submit it to GenBank.  Through the international collaboration of DNA
sequence databases, GenBank submissions are forwarded daily for inclusion
in the ENA and DDBJ databases.

  SEQUIN.  Sequin is an interactive, graphically-oriented program based
on screen forms and controlled vocabularies that guides you through the
process of entering your sequence and providing biological and
bibliographic annotation.  Sequin is designed to simplify the sequence submission
process, and to provide increased data handling capabilities to accomodate
very long sequences, complex annotations, and robust error checking.  E-mail
the completed submission file to : gb-sub@ncbi.nlm.nih.gov

  Sequin is provided for Macintosh, PC/Windows, UNIX and VMS computers.
It is available by annonymous ftp from ftp.ncbi.nih.gov; login as
anonymous and use your e-mail address as the password. It is located in
the sequin directory. Or direct your web browser to this URL:

	ftp://ftp.ncbi.nih.gov/sequin

  BANKIT.  BankIt provides a simple forms-based approach for submitting your
sequence and descriptive information to GenBank.  Your submission will
be submitted directly to GenBank via the World Wide Web, and
immediately forwarded for inclusion in the ENA and DDBJ databases.
BankIt may be used with any modern web browser. You can access BankIt
from GenBank's home page:   

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.  

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 3238 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct490.seq - Bacterial sequence entries, part 490.
436. gbbct491.seq - Bacterial sequence entries, part 491.
437. gbbct492.seq - Bacterial sequence entries, part 492.
438. gbbct493.seq - Bacterial sequence entries, part 493.
439. gbbct494.seq - Bacterial sequence entries, part 494.
440. gbbct495.seq - Bacterial sequence entries, part 495.
441. gbbct496.seq - Bacterial sequence entries, part 496.
442. gbbct497.seq - Bacterial sequence entries, part 497.
443. gbbct498.seq - Bacterial sequence entries, part 498.
444. gbbct499.seq - Bacterial sequence entries, part 499.
445. gbbct5.seq - Bacterial sequence entries, part 5.
446. gbbct50.seq - Bacterial sequence entries, part 50.
447. gbbct500.seq - Bacterial sequence entries, part 500.
448. gbbct501.seq - Bacterial sequence entries, part 501.
449. gbbct502.seq - Bacterial sequence entries, part 502.
450. gbbct503.seq - Bacterial sequence entries, part 503.
451. gbbct504.seq - Bacterial sequence entries, part 504.
452. gbbct505.seq - Bacterial sequence entries, part 505.
453. gbbct506.seq - Bacterial sequence entries, part 506.
454. gbbct507.seq - Bacterial sequence entries, part 507.
455. gbbct508.seq - Bacterial sequence entries, part 508.
456. gbbct509.seq - Bacterial sequence entries, part 509.
457. gbbct51.seq - Bacterial sequence entries, part 51.
458. gbbct510.seq - Bacterial sequence entries, part 510.
459. gbbct511.seq - Bacterial sequence entries, part 511.
460. gbbct512.seq - Bacterial sequence entries, part 512.
461. gbbct52.seq - Bacterial sequence entries, part 52.
462. gbbct53.seq - Bacterial sequence entries, part 53.
463. gbbct54.seq - Bacterial sequence entries, part 54.
464. gbbct55.seq - Bacterial sequence entries, part 55.
465. gbbct56.seq - Bacterial sequence entries, part 56.
466. gbbct57.seq - Bacterial sequence entries, part 57.
467. gbbct58.seq - Bacterial sequence entries, part 58.
468. gbbct59.seq - Bacterial sequence entries, part 59.
469. gbbct6.seq - Bacterial sequence entries, part 6.
470. gbbct60.seq - Bacterial sequence entries, part 60.
471. gbbct61.seq - Bacterial sequence entries, part 61.
472. gbbct62.seq - Bacterial sequence entries, part 62.
473. gbbct63.seq - Bacterial sequence entries, part 63.
474. gbbct64.seq - Bacterial sequence entries, part 64.
475. gbbct65.seq - Bacterial sequence entries, part 65.
476. gbbct66.seq - Bacterial sequence entries, part 66.
477. gbbct67.seq - Bacterial sequence entries, part 67.
478. gbbct68.seq - Bacterial sequence entries, part 68.
479. gbbct69.seq - Bacterial sequence entries, part 69.
480. gbbct7.seq - Bacterial sequence entries, part 7.
481. gbbct70.seq - Bacterial sequence entries, part 70.
482. gbbct71.seq - Bacterial sequence entries, part 71.
483. gbbct72.seq - Bacterial sequence entries, part 72.
484. gbbct73.seq - Bacterial sequence entries, part 73.
485. gbbct74.seq - Bacterial sequence entries, part 74.
486. gbbct75.seq - Bacterial sequence entries, part 75.
487. gbbct76.seq - Bacterial sequence entries, part 76.
488. gbbct77.seq - Bacterial sequence entries, part 77.
489. gbbct78.seq - Bacterial sequence entries, part 78.
490. gbbct79.seq - Bacterial sequence entries, part 79.
491. gbbct8.seq - Bacterial sequence entries, part 8.
492. gbbct80.seq - Bacterial sequence entries, part 80.
493. gbbct81.seq - Bacterial sequence entries, part 81.
494. gbbct82.seq - Bacterial sequence entries, part 82.
495. gbbct83.seq - Bacterial sequence entries, part 83.
496. gbbct84.seq - Bacterial sequence entries, part 84.
497. gbbct85.seq - Bacterial sequence entries, part 85.
498. gbbct86.seq - Bacterial sequence entries, part 86.
499. gbbct87.seq - Bacterial sequence entries, part 87.
500. gbbct88.seq - Bacterial sequence entries, part 88.
501. gbbct89.seq - Bacterial sequence entries, part 89.
502. gbbct9.seq - Bacterial sequence entries, part 9.
503. gbbct90.seq - Bacterial sequence entries, part 90.
504. gbbct91.seq - Bacterial sequence entries, part 91.
505. gbbct92.seq - Bacterial sequence entries, part 92.
506. gbbct93.seq - Bacterial sequence entries, part 93.
507. gbbct94.seq - Bacterial sequence entries, part 94.
508. gbbct95.seq - Bacterial sequence entries, part 95.
509. gbbct96.seq - Bacterial sequence entries, part 96.
510. gbbct97.seq - Bacterial sequence entries, part 97.
511. gbbct98.seq - Bacterial sequence entries, part 98.
512. gbbct99.seq - Bacterial sequence entries, part 99.
513. gbchg.txt - Accession numbers of entries updated since the previous release.
514. gbcon1.seq - Constructed sequence entries, part 1.
515. gbcon10.seq - Constructed sequence entries, part 10.
516. gbcon100.seq - Constructed sequence entries, part 100.
517. gbcon101.seq - Constructed sequence entries, part 101.
518. gbcon102.seq - Constructed sequence entries, part 102.
519. gbcon103.seq - Constructed sequence entries, part 103.
520. gbcon104.seq - Constructed sequence entries, part 104.
521. gbcon105.seq - Constructed sequence entries, part 105.
522. gbcon106.seq - Constructed sequence entries, part 106.
523. gbcon107.seq - Constructed sequence entries, part 107.
524. gbcon108.seq - Constructed sequence entries, part 108.
525. gbcon109.seq - Constructed sequence entries, part 109.
526. gbcon11.seq - Constructed sequence entries, part 11.
527. gbcon110.seq - Constructed sequence entries, part 110.
528. gbcon111.seq - Constructed sequence entries, part 111.
529. gbcon112.seq - Constructed sequence entries, part 112.
530. gbcon113.seq - Constructed sequence entries, part 113.
531. gbcon114.seq - Constructed sequence entries, part 114.
532. gbcon115.seq - Constructed sequence entries, part 115.
533. gbcon116.seq - Constructed sequence entries, part 116.
534. gbcon117.seq - Constructed sequence entries, part 117.
535. gbcon118.seq - Constructed sequence entries, part 118.
536. gbcon119.seq - Constructed sequence entries, part 119.
537. gbcon12.seq - Constructed sequence entries, part 12.
538. gbcon120.seq - Constructed sequence entries, part 120.
539. gbcon121.seq - Constructed sequence entries, part 121.
540. gbcon122.seq - Constructed sequence entries, part 122.
541. gbcon123.seq - Constructed sequence entries, part 123.
542. gbcon124.seq - Constructed sequence entries, part 124.
543. gbcon125.seq - Constructed sequence entries, part 125.
544. gbcon126.seq - Constructed sequence entries, part 126.
545. gbcon127.seq - Constructed sequence entries, part 127.
546. gbcon128.seq - Constructed sequence entries, part 128.
547. gbcon129.seq - Constructed sequence entries, part 129.
548. gbcon13.seq - Constructed sequence entries, part 13.
549. gbcon130.seq - Constructed sequence entries, part 130.
550. gbcon131.seq - Constructed sequence entries, part 131.
551. gbcon132.seq - Constructed sequence entries, part 132.
552. gbcon133.seq - Constructed sequence entries, part 133.
553. gbcon134.seq - Constructed sequence entries, part 134.
554. gbcon135.seq - Constructed sequence entries, part 135.
555. gbcon136.seq - Constructed sequence entries, part 136.
556. gbcon137.seq - Constructed sequence entries, part 137.
557. gbcon138.seq - Constructed sequence entries, part 138.
558. gbcon139.seq - Constructed sequence entries, part 139.
559. gbcon14.seq - Constructed sequence entries, part 14.
560. gbcon140.seq - Constructed sequence entries, part 140.
561. gbcon141.seq - Constructed sequence entries, part 141.
562. gbcon142.seq - Constructed sequence entries, part 142.
563. gbcon143.seq - Constructed sequence entries, part 143.
564. gbcon144.seq - Constructed sequence entries, part 144.
565. gbcon145.seq - Constructed sequence entries, part 145.
566. gbcon146.seq - Constructed sequence entries, part 146.
567. gbcon147.seq - Constructed sequence entries, part 147.
568. gbcon148.seq - Constructed sequence entries, part 148.
569. gbcon149.seq - Constructed sequence entries, part 149.
570. gbcon15.seq - Constructed sequence entries, part 15.
571. gbcon150.seq - Constructed sequence entries, part 150.
572. gbcon151.seq - Constructed sequence entries, part 151.
573. gbcon152.seq - Constructed sequence entries, part 152.
574. gbcon153.seq - Constructed sequence entries, part 153.
575. gbcon154.seq - Constructed sequence entries, part 154.
576. gbcon155.seq - Constructed sequence entries, part 155.
577. gbcon156.seq - Constructed sequence entries, part 156.
578. gbcon157.seq - Constructed sequence entries, part 157.
579. gbcon158.seq - Constructed sequence entries, part 158.
580. gbcon159.seq - Constructed sequence entries, part 159.
581. gbcon16.seq - Constructed sequence entries, part 16.
582. gbcon160.seq - Constructed sequence entries, part 160.
583. gbcon161.seq - Constructed sequence entries, part 161.
584. gbcon162.seq - Constructed sequence entries, part 162.
585. gbcon163.seq - Constructed sequence entries, part 163.
586. gbcon164.seq - Constructed sequence entries, part 164.
587. gbcon165.seq - Constructed sequence entries, part 165.
588. gbcon166.seq - Constructed sequence entries, part 166.
589. gbcon167.seq - Constructed sequence entries, part 167.
590. gbcon168.seq - Constructed sequence entries, part 168.
591. gbcon169.seq - Constructed sequence entries, part 169.
592. gbcon17.seq - Constructed sequence entries, part 17.
593. gbcon170.seq - Constructed sequence entries, part 170.
594. gbcon171.seq - Constructed sequence entries, part 171.
595. gbcon172.seq - Constructed sequence entries, part 172.
596. gbcon173.seq - Constructed sequence entries, part 173.
597. gbcon174.seq - Constructed sequence entries, part 174.
598. gbcon175.seq - Constructed sequence entries, part 175.
599. gbcon176.seq - Constructed sequence entries, part 176.
600. gbcon177.seq - Constructed sequence entries, part 177.
601. gbcon178.seq - Constructed sequence entries, part 178.
602. gbcon179.seq - Constructed sequence entries, part 179.
603. gbcon18.seq - Constructed sequence entries, part 18.
604. gbcon180.seq - Constructed sequence entries, part 180.
605. gbcon181.seq - Constructed sequence entries, part 181.
606. gbcon182.seq - Constructed sequence entries, part 182.
607. gbcon183.seq - Constructed sequence entries, part 183.
608. gbcon184.seq - Constructed sequence entries, part 184.
609. gbcon185.seq - Constructed sequence entries, part 185.
610. gbcon186.seq - Constructed sequence entries, part 186.
611. gbcon187.seq - Constructed sequence entries, part 187.
612. gbcon188.seq - Constructed sequence entries, part 188.
613. gbcon189.seq - Constructed sequence entries, part 189.
614. gbcon19.seq - Constructed sequence entries, part 19.
615. gbcon190.seq - Constructed sequence entries, part 190.
616. gbcon191.seq - Constructed sequence entries, part 191.
617. gbcon192.seq - Constructed sequence entries, part 192.
618. gbcon193.seq - Constructed sequence entries, part 193.
619. gbcon194.seq - Constructed sequence entries, part 194.
620. gbcon195.seq - Constructed sequence entries, part 195.
621. gbcon196.seq - Constructed sequence entries, part 196.
622. gbcon197.seq - Constructed sequence entries, part 197.
623. gbcon198.seq - Constructed sequence entries, part 198.
624. gbcon199.seq - Constructed sequence entries, part 199.
625. gbcon2.seq - Constructed sequence entries, part 2.
626. gbcon20.seq - Constructed sequence entries, part 20.
627. gbcon200.seq - Constructed sequence entries, part 200.
628. gbcon201.seq - Constructed sequence entries, part 201.
629. gbcon202.seq - Constructed sequence entries, part 202.
630. gbcon203.seq - Constructed sequence entries, part 203.
631. gbcon204.seq - Constructed sequence entries, part 204.
632. gbcon205.seq - Constructed sequence entries, part 205.
633. gbcon206.seq - Constructed sequence entries, part 206.
634. gbcon207.seq - Constructed sequence entries, part 207.
635. gbcon208.seq - Constructed sequence entries, part 208.
636. gbcon209.seq - Constructed sequence entries, part 209.
637. gbcon21.seq - Constructed sequence entries, part 21.
638. gbcon210.seq - Constructed sequence entries, part 210.
639. gbcon211.seq - Constructed sequence entries, part 211.
640. gbcon212.seq - Constructed sequence entries, part 212.
641. gbcon213.seq - Constructed sequence entries, part 213.
642. gbcon214.seq - Constructed sequence entries, part 214.
643. gbcon215.seq - Constructed sequence entries, part 215.
644. gbcon216.seq - Constructed sequence entries, part 216.
645. gbcon217.seq - Constructed sequence entries, part 217.
646. gbcon218.seq - Constructed sequence entries, part 218.
647. gbcon22.seq - Constructed sequence entries, part 22.
648. gbcon23.seq - Constructed sequence entries, part 23.
649. gbcon24.seq - Constructed sequence entries, part 24.
650. gbcon25.seq - Constructed sequence entries, part 25.
651. gbcon26.seq - Constructed sequence entries, part 26.
652. gbcon27.seq - Constructed sequence entries, part 27.
653. gbcon28.seq - Constructed sequence entries, part 28.
654. gbcon29.seq - Constructed sequence entries, part 29.
655. gbcon3.seq - Constructed sequence entries, part 3.
656. gbcon30.seq - Constructed sequence entries, part 30.
657. gbcon31.seq - Constructed sequence entries, part 31.
658. gbcon32.seq - Constructed sequence entries, part 32.
659. gbcon33.seq - Constructed sequence entries, part 33.
660. gbcon34.seq - Constructed sequence entries, part 34.
661. gbcon35.seq - Constructed sequence entries, part 35.
662. gbcon36.seq - Constructed sequence entries, part 36.
663. gbcon37.seq - Constructed sequence entries, part 37.
664. gbcon38.seq - Constructed sequence entries, part 38.
665. gbcon39.seq - Constructed sequence entries, part 39.
666. gbcon4.seq - Constructed sequence entries, part 4.
667. gbcon40.seq - Constructed sequence entries, part 40.
668. gbcon41.seq - Constructed sequence entries, part 41.
669. gbcon42.seq - Constructed sequence entries, part 42.
670. gbcon43.seq - Constructed sequence entries, part 43.
671. gbcon44.seq - Constructed sequence entries, part 44.
672. gbcon45.seq - Constructed sequence entries, part 45.
673. gbcon46.seq - Constructed sequence entries, part 46.
674. gbcon47.seq - Constructed sequence entries, part 47.
675. gbcon48.seq - Constructed sequence entries, part 48.
676. gbcon49.seq - Constructed sequence entries, part 49.
677. gbcon5.seq - Constructed sequence entries, part 5.
678. gbcon50.seq - Constructed sequence entries, part 50.
679. gbcon51.seq - Constructed sequence entries, part 51.
680. gbcon52.seq - Constructed sequence entries, part 52.
681. gbcon53.seq - Constructed sequence entries, part 53.
682. gbcon54.seq - Constructed sequence entries, part 54.
683. gbcon55.seq - Constructed sequence entries, part 55.
684. gbcon56.seq - Constructed sequence entries, part 56.
685. gbcon57.seq - Constructed sequence entries, part 57.
686. gbcon58.seq - Constructed sequence entries, part 58.
687. gbcon59.seq - Constructed sequence entries, part 59.
688. gbcon6.seq - Constructed sequence entries, part 6.
689. gbcon60.seq - Constructed sequence entries, part 60.
690. gbcon61.seq - Constructed sequence entries, part 61.
691. gbcon62.seq - Constructed sequence entries, part 62.
692. gbcon63.seq - Constructed sequence entries, part 63.
693. gbcon64.seq - Constructed sequence entries, part 64.
694. gbcon65.seq - Constructed sequence entries, part 65.
695. gbcon66.seq - Constructed sequence entries, part 66.
696. gbcon67.seq - Constructed sequence entries, part 67.
697. gbcon68.seq - Constructed sequence entries, part 68.
698. gbcon69.seq - Constructed sequence entries, part 69.
699. gbcon7.seq - Constructed sequence entries, part 7.
700. gbcon70.seq - Constructed sequence entries, part 70.
701. gbcon71.seq - Constructed sequence entries, part 71.
702. gbcon72.seq - Constructed sequence entries, part 72.
703. gbcon73.seq - Constructed sequence entries, part 73.
704. gbcon74.seq - Constructed sequence entries, part 74.
705. gbcon75.seq - Constructed sequence entries, part 75.
706. gbcon76.seq - Constructed sequence entries, part 76.
707. gbcon77.seq - Constructed sequence entries, part 77.
708. gbcon78.seq - Constructed sequence entries, part 78.
709. gbcon79.seq - Constructed sequence entries, part 79.
710. gbcon8.seq - Constructed sequence entries, part 8.
711. gbcon80.seq - Constructed sequence entries, part 80.
712. gbcon81.seq - Constructed sequence entries, part 81.
713. gbcon82.seq - Constructed sequence entries, part 82.
714. gbcon83.seq - Constructed sequence entries, part 83.
715. gbcon84.seq - Constructed sequence entries, part 84.
716. gbcon85.seq - Constructed sequence entries, part 85.
717. gbcon86.seq - Constructed sequence entries, part 86.
718. gbcon87.seq - Constructed sequence entries, part 87.
719. gbcon88.seq - Constructed sequence entries, part 88.
720. gbcon89.seq - Constructed sequence entries, part 89.
721. gbcon9.seq - Constructed sequence entries, part 9.
722. gbcon90.seq - Constructed sequence entries, part 90.
723. gbcon91.seq - Constructed sequence entries, part 91.
724. gbcon92.seq - Constructed sequence entries, part 92.
725. gbcon93.seq - Constructed sequence entries, part 93.
726. gbcon94.seq - Constructed sequence entries, part 94.
727. gbcon95.seq - Constructed sequence entries, part 95.
728. gbcon96.seq - Constructed sequence entries, part 96.
729. gbcon97.seq - Constructed sequence entries, part 97.
730. gbcon98.seq - Constructed sequence entries, part 98.
731. gbcon99.seq - Constructed sequence entries, part 99.
732. gbdel.txt - Accession numbers of entries deleted since the previous release.
733. gbenv1.seq - Environmental sampling sequence entries, part 1.
734. gbenv10.seq - Environmental sampling sequence entries, part 10.
735. gbenv11.seq - Environmental sampling sequence entries, part 11.
736. gbenv12.seq - Environmental sampling sequence entries, part 12.
737. gbenv13.seq - Environmental sampling sequence entries, part 13.
738. gbenv14.seq - Environmental sampling sequence entries, part 14.
739. gbenv15.seq - Environmental sampling sequence entries, part 15.
740. gbenv16.seq - Environmental sampling sequence entries, part 16.
741. gbenv17.seq - Environmental sampling sequence entries, part 17.
742. gbenv18.seq - Environmental sampling sequence entries, part 18.
743. gbenv19.seq - Environmental sampling sequence entries, part 19.
744. gbenv2.seq - Environmental sampling sequence entries, part 2.
745. gbenv20.seq - Environmental sampling sequence entries, part 20.
746. gbenv21.seq - Environmental sampling sequence entries, part 21.
747. gbenv22.seq - Environmental sampling sequence entries, part 22.
748. gbenv23.seq - Environmental sampling sequence entries, part 23.
749. gbenv24.seq - Environmental sampling sequence entries, part 24.
750. gbenv25.seq - Environmental sampling sequence entries, part 25.
751. gbenv26.seq - Environmental sampling sequence entries, part 26.
752. gbenv27.seq - Environmental sampling sequence entries, part 27.
753. gbenv28.seq - Environmental sampling sequence entries, part 28.
754. gbenv29.seq - Environmental sampling sequence entries, part 29.
755. gbenv3.seq - Environmental sampling sequence entries, part 3.
756. gbenv30.seq - Environmental sampling sequence entries, part 30.
757. gbenv31.seq - Environmental sampling sequence entries, part 31.
758. gbenv32.seq - Environmental sampling sequence entries, part 32.
759. gbenv33.seq - Environmental sampling sequence entries, part 33.
760. gbenv34.seq - Environmental sampling sequence entries, part 34.
761. gbenv35.seq - Environmental sampling sequence entries, part 35.
762. gbenv36.seq - Environmental sampling sequence entries, part 36.
763. gbenv37.seq - Environmental sampling sequence entries, part 37.
764. gbenv38.seq - Environmental sampling sequence entries, part 38.
765. gbenv39.seq - Environmental sampling sequence entries, part 39.
766. gbenv4.seq - Environmental sampling sequence entries, part 4.
767. gbenv40.seq - Environmental sampling sequence entries, part 40.
768. gbenv41.seq - Environmental sampling sequence entries, part 41.
769. gbenv42.seq - Environmental sampling sequence entries, part 42.
770. gbenv43.seq - Environmental sampling sequence entries, part 43.
771. gbenv44.seq - Environmental sampling sequence entries, part 44.
772. gbenv45.seq - Environmental sampling sequence entries, part 45.
773. gbenv46.seq - Environmental sampling sequence entries, part 46.
774. gbenv47.seq - Environmental sampling sequence entries, part 47.
775. gbenv48.seq - Environmental sampling sequence entries, part 48.
776. gbenv49.seq - Environmental sampling sequence entries, part 49.
777. gbenv5.seq - Environmental sampling sequence entries, part 5.
778. gbenv50.seq - Environmental sampling sequence entries, part 50.
779. gbenv51.seq - Environmental sampling sequence entries, part 51.
780. gbenv52.seq - Environmental sampling sequence entries, part 52.
781. gbenv53.seq - Environmental sampling sequence entries, part 53.
782. gbenv54.seq - Environmental sampling sequence entries, part 54.
783. gbenv55.seq - Environmental sampling sequence entries, part 55.
784. gbenv56.seq - Environmental sampling sequence entries, part 56.
785. gbenv57.seq - Environmental sampling sequence entries, part 57.
786. gbenv58.seq - Environmental sampling sequence entries, part 58.
787. gbenv59.seq - Environmental sampling sequence entries, part 59.
788. gbenv6.seq - Environmental sampling sequence entries, part 6.
789. gbenv60.seq - Environmental sampling sequence entries, part 60.
790. gbenv61.seq - Environmental sampling sequence entries, part 61.
791. gbenv62.seq - Environmental sampling sequence entries, part 62.
792. gbenv7.seq - Environmental sampling sequence entries, part 7.
793. gbenv8.seq - Environmental sampling sequence entries, part 8.
794. gbenv9.seq - Environmental sampling sequence entries, part 9.
795. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
796. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
797. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
798. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
799. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
800. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
801. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
802. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
803. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
804. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
805. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
806. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
807. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
808. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
809. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
810. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
811. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
812. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
813. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
814. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
815. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
816. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
817. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
818. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
819. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
820. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
821. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
822. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
823. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
824. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
825. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
826. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
827. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
828. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
829. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
830. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
831. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
832. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
833. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
834. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
835. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
836. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
837. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
838. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
839. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
840. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
841. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
842. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
843. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
844. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
845. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
846. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
847. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
848. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
849. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
850. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
851. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
852. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
853. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
854. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
855. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
856. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
857. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
858. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
859. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
860. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
861. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
862. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
863. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
864. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
865. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
866. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
867. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
868. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
869. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
870. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
871. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
872. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
873. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
874. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
875. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
876. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
877. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
878. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
879. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
880. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
881. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
882. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
883. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
884. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
885. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
886. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
887. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
888. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
889. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
890. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
891. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
892. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
893. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
894. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
895. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
896. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
897. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
898. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
899. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
900. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
901. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
902. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
903. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
904. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
905. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
906. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
907. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
908. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
909. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
910. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
911. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
912. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
913. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
914. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
915. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
916. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
917. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
918. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
919. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
920. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
921. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
922. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
923. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
924. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
925. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
926. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
927. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
928. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
929. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
930. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
931. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
932. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
933. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
934. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
935. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
936. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
937. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
938. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
939. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
940. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
941. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
942. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
943. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
944. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
945. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
946. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
947. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
948. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
949. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
950. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
951. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
952. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
953. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
954. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
955. gbest243.seq - EST (expressed sequence tag) sequence entries, part 243.
956. gbest244.seq - EST (expressed sequence tag) sequence entries, part 244.
957. gbest245.seq - EST (expressed sequence tag) sequence entries, part 245.
958. gbest246.seq - EST (expressed sequence tag) sequence entries, part 246.
959. gbest247.seq - EST (expressed sequence tag) sequence entries, part 247.
960. gbest248.seq - EST (expressed sequence tag) sequence entries, part 248.
961. gbest249.seq - EST (expressed sequence tag) sequence entries, part 249.
962. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
963. gbest250.seq - EST (expressed sequence tag) sequence entries, part 250.
964. gbest251.seq - EST (expressed sequence tag) sequence entries, part 251.
965. gbest252.seq - EST (expressed sequence tag) sequence entries, part 252.
966. gbest253.seq - EST (expressed sequence tag) sequence entries, part 253.
967. gbest254.seq - EST (expressed sequence tag) sequence entries, part 254.
968. gbest255.seq - EST (expressed sequence tag) sequence entries, part 255.
969. gbest256.seq - EST (expressed sequence tag) sequence entries, part 256.
970. gbest257.seq - EST (expressed sequence tag) sequence entries, part 257.
971. gbest258.seq - EST (expressed sequence tag) sequence entries, part 258.
972. gbest259.seq - EST (expressed sequence tag) sequence entries, part 259.
973. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
974. gbest260.seq - EST (expressed sequence tag) sequence entries, part 260.
975. gbest261.seq - EST (expressed sequence tag) sequence entries, part 261.
976. gbest262.seq - EST (expressed sequence tag) sequence entries, part 262.
977. gbest263.seq - EST (expressed sequence tag) sequence entries, part 263.
978. gbest264.seq - EST (expressed sequence tag) sequence entries, part 264.
979. gbest265.seq - EST (expressed sequence tag) sequence entries, part 265.
980. gbest266.seq - EST (expressed sequence tag) sequence entries, part 266.
981. gbest267.seq - EST (expressed sequence tag) sequence entries, part 267.
982. gbest268.seq - EST (expressed sequence tag) sequence entries, part 268.
983. gbest269.seq - EST (expressed sequence tag) sequence entries, part 269.
984. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
985. gbest270.seq - EST (expressed sequence tag) sequence entries, part 270.
986. gbest271.seq - EST (expressed sequence tag) sequence entries, part 271.
987. gbest272.seq - EST (expressed sequence tag) sequence entries, part 272.
988. gbest273.seq - EST (expressed sequence tag) sequence entries, part 273.
989. gbest274.seq - EST (expressed sequence tag) sequence entries, part 274.
990. gbest275.seq - EST (expressed sequence tag) sequence entries, part 275.
991. gbest276.seq - EST (expressed sequence tag) sequence entries, part 276.
992. gbest277.seq - EST (expressed sequence tag) sequence entries, part 277.
993. gbest278.seq - EST (expressed sequence tag) sequence entries, part 278.
994. gbest279.seq - EST (expressed sequence tag) sequence entries, part 279.
995. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
996. gbest280.seq - EST (expressed sequence tag) sequence entries, part 280.
997. gbest281.seq - EST (expressed sequence tag) sequence entries, part 281.
998. gbest282.seq - EST (expressed sequence tag) sequence entries, part 282.
999. gbest283.seq - EST (expressed sequence tag) sequence entries, part 283.
1000. gbest284.seq - EST (expressed sequence tag) sequence entries, part 284.
1001. gbest285.seq - EST (expressed sequence tag) sequence entries, part 285.
1002. gbest286.seq - EST (expressed sequence tag) sequence entries, part 286.
1003. gbest287.seq - EST (expressed sequence tag) sequence entries, part 287.
1004. gbest288.seq - EST (expressed sequence tag) sequence entries, part 288.
1005. gbest289.seq - EST (expressed sequence tag) sequence entries, part 289.
1006. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
1007. gbest290.seq - EST (expressed sequence tag) sequence entries, part 290.
1008. gbest291.seq - EST (expressed sequence tag) sequence entries, part 291.
1009. gbest292.seq - EST (expressed sequence tag) sequence entries, part 292.
1010. gbest293.seq - EST (expressed sequence tag) sequence entries, part 293.
1011. gbest294.seq - EST (expressed sequence tag) sequence entries, part 294.
1012. gbest295.seq - EST (expressed sequence tag) sequence entries, part 295.
1013. gbest296.seq - EST (expressed sequence tag) sequence entries, part 296.
1014. gbest297.seq - EST (expressed sequence tag) sequence entries, part 297.
1015. gbest298.seq - EST (expressed sequence tag) sequence entries, part 298.
1016. gbest299.seq - EST (expressed sequence tag) sequence entries, part 299.
1017. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
1018. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
1019. gbest300.seq - EST (expressed sequence tag) sequence entries, part 300.
1020. gbest301.seq - EST (expressed sequence tag) sequence entries, part 301.
1021. gbest302.seq - EST (expressed sequence tag) sequence entries, part 302.
1022. gbest303.seq - EST (expressed sequence tag) sequence entries, part 303.
1023. gbest304.seq - EST (expressed sequence tag) sequence entries, part 304.
1024. gbest305.seq - EST (expressed sequence tag) sequence entries, part 305.
1025. gbest306.seq - EST (expressed sequence tag) sequence entries, part 306.
1026. gbest307.seq - EST (expressed sequence tag) sequence entries, part 307.
1027. gbest308.seq - EST (expressed sequence tag) sequence entries, part 308.
1028. gbest309.seq - EST (expressed sequence tag) sequence entries, part 309.
1029. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
1030. gbest310.seq - EST (expressed sequence tag) sequence entries, part 310.
1031. gbest311.seq - EST (expressed sequence tag) sequence entries, part 311.
1032. gbest312.seq - EST (expressed sequence tag) sequence entries, part 312.
1033. gbest313.seq - EST (expressed sequence tag) sequence entries, part 313.
1034. gbest314.seq - EST (expressed sequence tag) sequence entries, part 314.
1035. gbest315.seq - EST (expressed sequence tag) sequence entries, part 315.
1036. gbest316.seq - EST (expressed sequence tag) sequence entries, part 316.
1037. gbest317.seq - EST (expressed sequence tag) sequence entries, part 317.
1038. gbest318.seq - EST (expressed sequence tag) sequence entries, part 318.
1039. gbest319.seq - EST (expressed sequence tag) sequence entries, part 319.
1040. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
1041. gbest320.seq - EST (expressed sequence tag) sequence entries, part 320.
1042. gbest321.seq - EST (expressed sequence tag) sequence entries, part 321.
1043. gbest322.seq - EST (expressed sequence tag) sequence entries, part 322.
1044. gbest323.seq - EST (expressed sequence tag) sequence entries, part 323.
1045. gbest324.seq - EST (expressed sequence tag) sequence entries, part 324.
1046. gbest325.seq - EST (expressed sequence tag) sequence entries, part 325.
1047. gbest326.seq - EST (expressed sequence tag) sequence entries, part 326.
1048. gbest327.seq - EST (expressed sequence tag) sequence entries, part 327.
1049. gbest328.seq - EST (expressed sequence tag) sequence entries, part 328.
1050. gbest329.seq - EST (expressed sequence tag) sequence entries, part 329.
1051. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
1052. gbest330.seq - EST (expressed sequence tag) sequence entries, part 330.
1053. gbest331.seq - EST (expressed sequence tag) sequence entries, part 331.
1054. gbest332.seq - EST (expressed sequence tag) sequence entries, part 332.
1055. gbest333.seq - EST (expressed sequence tag) sequence entries, part 333.
1056. gbest334.seq - EST (expressed sequence tag) sequence entries, part 334.
1057. gbest335.seq - EST (expressed sequence tag) sequence entries, part 335.
1058. gbest336.seq - EST (expressed sequence tag) sequence entries, part 336.
1059. gbest337.seq - EST (expressed sequence tag) sequence entries, part 337.
1060. gbest338.seq - EST (expressed sequence tag) sequence entries, part 338.
1061. gbest339.seq - EST (expressed sequence tag) sequence entries, part 339.
1062. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
1063. gbest340.seq - EST (expressed sequence tag) sequence entries, part 340.
1064. gbest341.seq - EST (expressed sequence tag) sequence entries, part 341.
1065. gbest342.seq - EST (expressed sequence tag) sequence entries, part 342.
1066. gbest343.seq - EST (expressed sequence tag) sequence entries, part 343.
1067. gbest344.seq - EST (expressed sequence tag) sequence entries, part 344.
1068. gbest345.seq - EST (expressed sequence tag) sequence entries, part 345.
1069. gbest346.seq - EST (expressed sequence tag) sequence entries, part 346.
1070. gbest347.seq - EST (expressed sequence tag) sequence entries, part 347.
1071. gbest348.seq - EST (expressed sequence tag) sequence entries, part 348.
1072. gbest349.seq - EST (expressed sequence tag) sequence entries, part 349.
1073. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
1074. gbest350.seq - EST (expressed sequence tag) sequence entries, part 350.
1075. gbest351.seq - EST (expressed sequence tag) sequence entries, part 351.
1076. gbest352.seq - EST (expressed sequence tag) sequence entries, part 352.
1077. gbest353.seq - EST (expressed sequence tag) sequence entries, part 353.
1078. gbest354.seq - EST (expressed sequence tag) sequence entries, part 354.
1079. gbest355.seq - EST (expressed sequence tag) sequence entries, part 355.
1080. gbest356.seq - EST (expressed sequence tag) sequence entries, part 356.
1081. gbest357.seq - EST (expressed sequence tag) sequence entries, part 357.
1082. gbest358.seq - EST (expressed sequence tag) sequence entries, part 358.
1083. gbest359.seq - EST (expressed sequence tag) sequence entries, part 359.
1084. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
1085. gbest360.seq - EST (expressed sequence tag) sequence entries, part 360.
1086. gbest361.seq - EST (expressed sequence tag) sequence entries, part 361.
1087. gbest362.seq - EST (expressed sequence tag) sequence entries, part 362.
1088. gbest363.seq - EST (expressed sequence tag) sequence entries, part 363.
1089. gbest364.seq - EST (expressed sequence tag) sequence entries, part 364.
1090. gbest365.seq - EST (expressed sequence tag) sequence entries, part 365.
1091. gbest366.seq - EST (expressed sequence tag) sequence entries, part 366.
1092. gbest367.seq - EST (expressed sequence tag) sequence entries, part 367.
1093. gbest368.seq - EST (expressed sequence tag) sequence entries, part 368.
1094. gbest369.seq - EST (expressed sequence tag) sequence entries, part 369.
1095. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
1096. gbest370.seq - EST (expressed sequence tag) sequence entries, part 370.
1097. gbest371.seq - EST (expressed sequence tag) sequence entries, part 371.
1098. gbest372.seq - EST (expressed sequence tag) sequence entries, part 372.
1099. gbest373.seq - EST (expressed sequence tag) sequence entries, part 373.
1100. gbest374.seq - EST (expressed sequence tag) sequence entries, part 374.
1101. gbest375.seq - EST (expressed sequence tag) sequence entries, part 375.
1102. gbest376.seq - EST (expressed sequence tag) sequence entries, part 376.
1103. gbest377.seq - EST (expressed sequence tag) sequence entries, part 377.
1104. gbest378.seq - EST (expressed sequence tag) sequence entries, part 378.
1105. gbest379.seq - EST (expressed sequence tag) sequence entries, part 379.
1106. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
1107. gbest380.seq - EST (expressed sequence tag) sequence entries, part 380.
1108. gbest381.seq - EST (expressed sequence tag) sequence entries, part 381.
1109. gbest382.seq - EST (expressed sequence tag) sequence entries, part 382.
1110. gbest383.seq - EST (expressed sequence tag) sequence entries, part 383.
1111. gbest384.seq - EST (expressed sequence tag) sequence entries, part 384.
1112. gbest385.seq - EST (expressed sequence tag) sequence entries, part 385.
1113. gbest386.seq - EST (expressed sequence tag) sequence entries, part 386.
1114. gbest387.seq - EST (expressed sequence tag) sequence entries, part 387.
1115. gbest388.seq - EST (expressed sequence tag) sequence entries, part 388.
1116. gbest389.seq - EST (expressed sequence tag) sequence entries, part 389.
1117. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
1118. gbest390.seq - EST (expressed sequence tag) sequence entries, part 390.
1119. gbest391.seq - EST (expressed sequence tag) sequence entries, part 391.
1120. gbest392.seq - EST (expressed sequence tag) sequence entries, part 392.
1121. gbest393.seq - EST (expressed sequence tag) sequence entries, part 393.
1122. gbest394.seq - EST (expressed sequence tag) sequence entries, part 394.
1123. gbest395.seq - EST (expressed sequence tag) sequence entries, part 395.
1124. gbest396.seq - EST (expressed sequence tag) sequence entries, part 396.
1125. gbest397.seq - EST (expressed sequence tag) sequence entries, part 397.
1126. gbest398.seq - EST (expressed sequence tag) sequence entries, part 398.
1127. gbest399.seq - EST (expressed sequence tag) sequence entries, part 399.
1128. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
1129. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
1130. gbest400.seq - EST (expressed sequence tag) sequence entries, part 400.
1131. gbest401.seq - EST (expressed sequence tag) sequence entries, part 401.
1132. gbest402.seq - EST (expressed sequence tag) sequence entries, part 402.
1133. gbest403.seq - EST (expressed sequence tag) sequence entries, part 403.
1134. gbest404.seq - EST (expressed sequence tag) sequence entries, part 404.
1135. gbest405.seq - EST (expressed sequence tag) sequence entries, part 405.
1136. gbest406.seq - EST (expressed sequence tag) sequence entries, part 406.
1137. gbest407.seq - EST (expressed sequence tag) sequence entries, part 407.
1138. gbest408.seq - EST (expressed sequence tag) sequence entries, part 408.
1139. gbest409.seq - EST (expressed sequence tag) sequence entries, part 409.
1140. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
1141. gbest410.seq - EST (expressed sequence tag) sequence entries, part 410.
1142. gbest411.seq - EST (expressed sequence tag) sequence entries, part 411.
1143. gbest412.seq - EST (expressed sequence tag) sequence entries, part 412.
1144. gbest413.seq - EST (expressed sequence tag) sequence entries, part 413.
1145. gbest414.seq - EST (expressed sequence tag) sequence entries, part 414.
1146. gbest415.seq - EST (expressed sequence tag) sequence entries, part 415.
1147. gbest416.seq - EST (expressed sequence tag) sequence entries, part 416.
1148. gbest417.seq - EST (expressed sequence tag) sequence entries, part 417.
1149. gbest418.seq - EST (expressed sequence tag) sequence entries, part 418.
1150. gbest419.seq - EST (expressed sequence tag) sequence entries, part 419.
1151. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
1152. gbest420.seq - EST (expressed sequence tag) sequence entries, part 420.
1153. gbest421.seq - EST (expressed sequence tag) sequence entries, part 421.
1154. gbest422.seq - EST (expressed sequence tag) sequence entries, part 422.
1155. gbest423.seq - EST (expressed sequence tag) sequence entries, part 423.
1156. gbest424.seq - EST (expressed sequence tag) sequence entries, part 424.
1157. gbest425.seq - EST (expressed sequence tag) sequence entries, part 425.
1158. gbest426.seq - EST (expressed sequence tag) sequence entries, part 426.
1159. gbest427.seq - EST (expressed sequence tag) sequence entries, part 427.
1160. gbest428.seq - EST (expressed sequence tag) sequence entries, part 428.
1161. gbest429.seq - EST (expressed sequence tag) sequence entries, part 429.
1162. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
1163. gbest430.seq - EST (expressed sequence tag) sequence entries, part 430.
1164. gbest431.seq - EST (expressed sequence tag) sequence entries, part 431.
1165. gbest432.seq - EST (expressed sequence tag) sequence entries, part 432.
1166. gbest433.seq - EST (expressed sequence tag) sequence entries, part 433.
1167. gbest434.seq - EST (expressed sequence tag) sequence entries, part 434.
1168. gbest435.seq - EST (expressed sequence tag) sequence entries, part 435.
1169. gbest436.seq - EST (expressed sequence tag) sequence entries, part 436.
1170. gbest437.seq - EST (expressed sequence tag) sequence entries, part 437.
1171. gbest438.seq - EST (expressed sequence tag) sequence entries, part 438.
1172. gbest439.seq - EST (expressed sequence tag) sequence entries, part 439.
1173. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
1174. gbest440.seq - EST (expressed sequence tag) sequence entries, part 440.
1175. gbest441.seq - EST (expressed sequence tag) sequence entries, part 441.
1176. gbest442.seq - EST (expressed sequence tag) sequence entries, part 442.
1177. gbest443.seq - EST (expressed sequence tag) sequence entries, part 443.
1178. gbest444.seq - EST (expressed sequence tag) sequence entries, part 444.
1179. gbest445.seq - EST (expressed sequence tag) sequence entries, part 445.
1180. gbest446.seq - EST (expressed sequence tag) sequence entries, part 446.
1181. gbest447.seq - EST (expressed sequence tag) sequence entries, part 447.
1182. gbest448.seq - EST (expressed sequence tag) sequence entries, part 448.
1183. gbest449.seq - EST (expressed sequence tag) sequence entries, part 449.
1184. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
1185. gbest450.seq - EST (expressed sequence tag) sequence entries, part 450.
1186. gbest451.seq - EST (expressed sequence tag) sequence entries, part 451.
1187. gbest452.seq - EST (expressed sequence tag) sequence entries, part 452.
1188. gbest453.seq - EST (expressed sequence tag) sequence entries, part 453.
1189. gbest454.seq - EST (expressed sequence tag) sequence entries, part 454.
1190. gbest455.seq - EST (expressed sequence tag) sequence entries, part 455.
1191. gbest456.seq - EST (expressed sequence tag) sequence entries, part 456.
1192. gbest457.seq - EST (expressed sequence tag) sequence entries, part 457.
1193. gbest458.seq - EST (expressed sequence tag) sequence entries, part 458.
1194. gbest459.seq - EST (expressed sequence tag) sequence entries, part 459.
1195. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
1196. gbest460.seq - EST (expressed sequence tag) sequence entries, part 460.
1197. gbest461.seq - EST (expressed sequence tag) sequence entries, part 461.
1198. gbest462.seq - EST (expressed sequence tag) sequence entries, part 462.
1199. gbest463.seq - EST (expressed sequence tag) sequence entries, part 463.
1200. gbest464.seq - EST (expressed sequence tag) sequence entries, part 464.
1201. gbest465.seq - EST (expressed sequence tag) sequence entries, part 465.
1202. gbest466.seq - EST (expressed sequence tag) sequence entries, part 466.
1203. gbest467.seq - EST (expressed sequence tag) sequence entries, part 467.
1204. gbest468.seq - EST (expressed sequence tag) sequence entries, part 468.
1205. gbest469.seq - EST (expressed sequence tag) sequence entries, part 469.
1206. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
1207. gbest470.seq - EST (expressed sequence tag) sequence entries, part 470.
1208. gbest471.seq - EST (expressed sequence tag) sequence entries, part 471.
1209. gbest472.seq - EST (expressed sequence tag) sequence entries, part 472.
1210. gbest473.seq - EST (expressed sequence tag) sequence entries, part 473.
1211. gbest474.seq - EST (expressed sequence tag) sequence entries, part 474.
1212. gbest475.seq - EST (expressed sequence tag) sequence entries, part 475.
1213. gbest476.seq - EST (expressed sequence tag) sequence entries, part 476.
1214. gbest477.seq - EST (expressed sequence tag) sequence entries, part 477.
1215. gbest478.seq - EST (expressed sequence tag) sequence entries, part 478.
1216. gbest479.seq - EST (expressed sequence tag) sequence entries, part 479.
1217. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
1218. gbest480.seq - EST (expressed sequence tag) sequence entries, part 480.
1219. gbest481.seq - EST (expressed sequence tag) sequence entries, part 481.
1220. gbest482.seq - EST (expressed sequence tag) sequence entries, part 482.
1221. gbest483.seq - EST (expressed sequence tag) sequence entries, part 483.
1222. gbest484.seq - EST (expressed sequence tag) sequence entries, part 484.
1223. gbest485.seq - EST (expressed sequence tag) sequence entries, part 485.
1224. gbest486.seq - EST (expressed sequence tag) sequence entries, part 486.
1225. gbest487.seq - EST (expressed sequence tag) sequence entries, part 487.
1226. gbest488.seq - EST (expressed sequence tag) sequence entries, part 488.
1227. gbest489.seq - EST (expressed sequence tag) sequence entries, part 489.
1228. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
1229. gbest490.seq - EST (expressed sequence tag) sequence entries, part 490.
1230. gbest491.seq - EST (expressed sequence tag) sequence entries, part 491.
1231. gbest492.seq - EST (expressed sequence tag) sequence entries, part 492.
1232. gbest493.seq - EST (expressed sequence tag) sequence entries, part 493.
1233. gbest494.seq - EST (expressed sequence tag) sequence entries, part 494.
1234. gbest495.seq - EST (expressed sequence tag) sequence entries, part 495.
1235. gbest496.seq - EST (expressed sequence tag) sequence entries, part 496.
1236. gbest497.seq - EST (expressed sequence tag) sequence entries, part 497.
1237. gbest498.seq - EST (expressed sequence tag) sequence entries, part 498.
1238. gbest499.seq - EST (expressed sequence tag) sequence entries, part 499.
1239. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
1240. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
1241. gbest500.seq - EST (expressed sequence tag) sequence entries, part 500.
1242. gbest501.seq - EST (expressed sequence tag) sequence entries, part 501.
1243. gbest502.seq - EST (expressed sequence tag) sequence entries, part 502.
1244. gbest503.seq - EST (expressed sequence tag) sequence entries, part 503.
1245. gbest504.seq - EST (expressed sequence tag) sequence entries, part 504.
1246. gbest505.seq - EST (expressed sequence tag) sequence entries, part 505.
1247. gbest506.seq - EST (expressed sequence tag) sequence entries, part 506.
1248. gbest507.seq - EST (expressed sequence tag) sequence entries, part 507.
1249. gbest508.seq - EST (expressed sequence tag) sequence entries, part 508.
1250. gbest509.seq - EST (expressed sequence tag) sequence entries, part 509.
1251. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
1252. gbest510.seq - EST (expressed sequence tag) sequence entries, part 510.
1253. gbest511.seq - EST (expressed sequence tag) sequence entries, part 511.
1254. gbest512.seq - EST (expressed sequence tag) sequence entries, part 512.
1255. gbest513.seq - EST (expressed sequence tag) sequence entries, part 513.
1256. gbest514.seq - EST (expressed sequence tag) sequence entries, part 514.
1257. gbest515.seq - EST (expressed sequence tag) sequence entries, part 515.
1258. gbest516.seq - EST (expressed sequence tag) sequence entries, part 516.
1259. gbest517.seq - EST (expressed sequence tag) sequence entries, part 517.
1260. gbest518.seq - EST (expressed sequence tag) sequence entries, part 518.
1261. gbest519.seq - EST (expressed sequence tag) sequence entries, part 519.
1262. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
1263. gbest520.seq - EST (expressed sequence tag) sequence entries, part 520.
1264. gbest521.seq - EST (expressed sequence tag) sequence entries, part 521.
1265. gbest522.seq - EST (expressed sequence tag) sequence entries, part 522.
1266. gbest523.seq - EST (expressed sequence tag) sequence entries, part 523.
1267. gbest524.seq - EST (expressed sequence tag) sequence entries, part 524.
1268. gbest525.seq - EST (expressed sequence tag) sequence entries, part 525.
1269. gbest526.seq - EST (expressed sequence tag) sequence entries, part 526.
1270. gbest527.seq - EST (expressed sequence tag) sequence entries, part 527.
1271. gbest528.seq - EST (expressed sequence tag) sequence entries, part 528.
1272. gbest529.seq - EST (expressed sequence tag) sequence entries, part 529.
1273. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
1274. gbest530.seq - EST (expressed sequence tag) sequence entries, part 530.
1275. gbest531.seq - EST (expressed sequence tag) sequence entries, part 531.
1276. gbest532.seq - EST (expressed sequence tag) sequence entries, part 532.
1277. gbest533.seq - EST (expressed sequence tag) sequence entries, part 533.
1278. gbest534.seq - EST (expressed sequence tag) sequence entries, part 534.
1279. gbest535.seq - EST (expressed sequence tag) sequence entries, part 535.
1280. gbest536.seq - EST (expressed sequence tag) sequence entries, part 536.
1281. gbest537.seq - EST (expressed sequence tag) sequence entries, part 537.
1282. gbest538.seq - EST (expressed sequence tag) sequence entries, part 538.
1283. gbest539.seq - EST (expressed sequence tag) sequence entries, part 539.
1284. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
1285. gbest540.seq - EST (expressed sequence tag) sequence entries, part 540.
1286. gbest541.seq - EST (expressed sequence tag) sequence entries, part 541.
1287. gbest542.seq - EST (expressed sequence tag) sequence entries, part 542.
1288. gbest543.seq - EST (expressed sequence tag) sequence entries, part 543.
1289. gbest544.seq - EST (expressed sequence tag) sequence entries, part 544.
1290. gbest545.seq - EST (expressed sequence tag) sequence entries, part 545.
1291. gbest546.seq - EST (expressed sequence tag) sequence entries, part 546.
1292. gbest547.seq - EST (expressed sequence tag) sequence entries, part 547.
1293. gbest548.seq - EST (expressed sequence tag) sequence entries, part 548.
1294. gbest549.seq - EST (expressed sequence tag) sequence entries, part 549.
1295. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
1296. gbest550.seq - EST (expressed sequence tag) sequence entries, part 550.
1297. gbest551.seq - EST (expressed sequence tag) sequence entries, part 551.
1298. gbest552.seq - EST (expressed sequence tag) sequence entries, part 552.
1299. gbest553.seq - EST (expressed sequence tag) sequence entries, part 553.
1300. gbest554.seq - EST (expressed sequence tag) sequence entries, part 554.
1301. gbest555.seq - EST (expressed sequence tag) sequence entries, part 555.
1302. gbest556.seq - EST (expressed sequence tag) sequence entries, part 556.
1303. gbest557.seq - EST (expressed sequence tag) sequence entries, part 557.
1304. gbest558.seq - EST (expressed sequence tag) sequence entries, part 558.
1305. gbest559.seq - EST (expressed sequence tag) sequence entries, part 559.
1306. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
1307. gbest560.seq - EST (expressed sequence tag) sequence entries, part 560.
1308. gbest561.seq - EST (expressed sequence tag) sequence entries, part 561.
1309. gbest562.seq - EST (expressed sequence tag) sequence entries, part 562.
1310. gbest563.seq - EST (expressed sequence tag) sequence entries, part 563.
1311. gbest564.seq - EST (expressed sequence tag) sequence entries, part 564.
1312. gbest565.seq - EST (expressed sequence tag) sequence entries, part 565.
1313. gbest566.seq - EST (expressed sequence tag) sequence entries, part 566.
1314. gbest567.seq - EST (expressed sequence tag) sequence entries, part 567.
1315. gbest568.seq - EST (expressed sequence tag) sequence entries, part 568.
1316. gbest569.seq - EST (expressed sequence tag) sequence entries, part 569.
1317. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
1318. gbest570.seq - EST (expressed sequence tag) sequence entries, part 570.
1319. gbest571.seq - EST (expressed sequence tag) sequence entries, part 571.
1320. gbest572.seq - EST (expressed sequence tag) sequence entries, part 572.
1321. gbest573.seq - EST (expressed sequence tag) sequence entries, part 573.
1322. gbest574.seq - EST (expressed sequence tag) sequence entries, part 574.
1323. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
1324. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
1325. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
1326. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
1327. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
1328. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
1329. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
1330. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
1331. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
1332. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
1333. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
1334. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
1335. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
1336. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
1337. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
1338. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
1339. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
1340. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
1341. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
1342. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
1343. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
1344. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
1345. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
1346. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
1347. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
1348. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
1349. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
1350. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
1351. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
1352. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
1353. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
1354. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
1355. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
1356. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
1357. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
1358. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
1359. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
1360. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
1361. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
1362. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
1363. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
1364. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
1365. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
1366. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
1367. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
1368. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
1369. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
1370. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
1371. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
1372. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
1373. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
1374. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
1375. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
1376. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
1377. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
1378. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
1379. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
1380. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
1381. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
1382. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
1383. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
1384. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
1385. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
1386. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
1387. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
1388. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
1389. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
1390. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
1391. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
1392. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
1393. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
1394. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
1395. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
1396. gbgss123.seq - GSS (genome survey sequence) sequence entries, part 123.
1397. gbgss124.seq - GSS (genome survey sequence) sequence entries, part 124.
1398. gbgss125.seq - GSS (genome survey sequence) sequence entries, part 125.
1399. gbgss126.seq - GSS (genome survey sequence) sequence entries, part 126.
1400. gbgss127.seq - GSS (genome survey sequence) sequence entries, part 127.
1401. gbgss128.seq - GSS (genome survey sequence) sequence entries, part 128.
1402. gbgss129.seq - GSS (genome survey sequence) sequence entries, part 129.
1403. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
1404. gbgss130.seq - GSS (genome survey sequence) sequence entries, part 130.
1405. gbgss131.seq - GSS (genome survey sequence) sequence entries, part 131.
1406. gbgss132.seq - GSS (genome survey sequence) sequence entries, part 132.
1407. gbgss133.seq - GSS (genome survey sequence) sequence entries, part 133.
1408. gbgss134.seq - GSS (genome survey sequence) sequence entries, part 134.
1409. gbgss135.seq - GSS (genome survey sequence) sequence entries, part 135.
1410. gbgss136.seq - GSS (genome survey sequence) sequence entries, part 136.
1411. gbgss137.seq - GSS (genome survey sequence) sequence entries, part 137.
1412. gbgss138.seq - GSS (genome survey sequence) sequence entries, part 138.
1413. gbgss139.seq - GSS (genome survey sequence) sequence entries, part 139.
1414. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
1415. gbgss140.seq - GSS (genome survey sequence) sequence entries, part 140.
1416. gbgss141.seq - GSS (genome survey sequence) sequence entries, part 141.
1417. gbgss142.seq - GSS (genome survey sequence) sequence entries, part 142.
1418. gbgss143.seq - GSS (genome survey sequence) sequence entries, part 143.
1419. gbgss144.seq - GSS (genome survey sequence) sequence entries, part 144.
1420. gbgss145.seq - GSS (genome survey sequence) sequence entries, part 145.
1421. gbgss146.seq - GSS (genome survey sequence) sequence entries, part 146.
1422. gbgss147.seq - GSS (genome survey sequence) sequence entries, part 147.
1423. gbgss148.seq - GSS (genome survey sequence) sequence entries, part 148.
1424. gbgss149.seq - GSS (genome survey sequence) sequence entries, part 149.
1425. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
1426. gbgss150.seq - GSS (genome survey sequence) sequence entries, part 150.
1427. gbgss151.seq - GSS (genome survey sequence) sequence entries, part 151.
1428. gbgss152.seq - GSS (genome survey sequence) sequence entries, part 152.
1429. gbgss153.seq - GSS (genome survey sequence) sequence entries, part 153.
1430. gbgss154.seq - GSS (genome survey sequence) sequence entries, part 154.
1431. gbgss155.seq - GSS (genome survey sequence) sequence entries, part 155.
1432. gbgss156.seq - GSS (genome survey sequence) sequence entries, part 156.
1433. gbgss157.seq - GSS (genome survey sequence) sequence entries, part 157.
1434. gbgss158.seq - GSS (genome survey sequence) sequence entries, part 158.
1435. gbgss159.seq - GSS (genome survey sequence) sequence entries, part 159.
1436. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
1437. gbgss160.seq - GSS (genome survey sequence) sequence entries, part 160.
1438. gbgss161.seq - GSS (genome survey sequence) sequence entries, part 161.
1439. gbgss162.seq - GSS (genome survey sequence) sequence entries, part 162.
1440. gbgss163.seq - GSS (genome survey sequence) sequence entries, part 163.
1441. gbgss164.seq - GSS (genome survey sequence) sequence entries, part 164.
1442. gbgss165.seq - GSS (genome survey sequence) sequence entries, part 165.
1443. gbgss166.seq - GSS (genome survey sequence) sequence entries, part 166.
1444. gbgss167.seq - GSS (genome survey sequence) sequence entries, part 167.
1445. gbgss168.seq - GSS (genome survey sequence) sequence entries, part 168.
1446. gbgss169.seq - GSS (genome survey sequence) sequence entries, part 169.
1447. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
1448. gbgss170.seq - GSS (genome survey sequence) sequence entries, part 170.
1449. gbgss171.seq - GSS (genome survey sequence) sequence entries, part 171.
1450. gbgss172.seq - GSS (genome survey sequence) sequence entries, part 172.
1451. gbgss173.seq - GSS (genome survey sequence) sequence entries, part 173.
1452. gbgss174.seq - GSS (genome survey sequence) sequence entries, part 174.
1453. gbgss175.seq - GSS (genome survey sequence) sequence entries, part 175.
1454. gbgss176.seq - GSS (genome survey sequence) sequence entries, part 176.
1455. gbgss177.seq - GSS (genome survey sequence) sequence entries, part 177.
1456. gbgss178.seq - GSS (genome survey sequence) sequence entries, part 178.
1457. gbgss179.seq - GSS (genome survey sequence) sequence entries, part 179.
1458. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
1459. gbgss180.seq - GSS (genome survey sequence) sequence entries, part 180.
1460. gbgss181.seq - GSS (genome survey sequence) sequence entries, part 181.
1461. gbgss182.seq - GSS (genome survey sequence) sequence entries, part 182.
1462. gbgss183.seq - GSS (genome survey sequence) sequence entries, part 183.
1463. gbgss184.seq - GSS (genome survey sequence) sequence entries, part 184.
1464. gbgss185.seq - GSS (genome survey sequence) sequence entries, part 185.
1465. gbgss186.seq - GSS (genome survey sequence) sequence entries, part 186.
1466. gbgss187.seq - GSS (genome survey sequence) sequence entries, part 187.
1467. gbgss188.seq - GSS (genome survey sequence) sequence entries, part 188.
1468. gbgss189.seq - GSS (genome survey sequence) sequence entries, part 189.
1469. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
1470. gbgss190.seq - GSS (genome survey sequence) sequence entries, part 190.
1471. gbgss191.seq - GSS (genome survey sequence) sequence entries, part 191.
1472. gbgss192.seq - GSS (genome survey sequence) sequence entries, part 192.
1473. gbgss193.seq - GSS (genome survey sequence) sequence entries, part 193.
1474. gbgss194.seq - GSS (genome survey sequence) sequence entries, part 194.
1475. gbgss195.seq - GSS (genome survey sequence) sequence entries, part 195.
1476. gbgss196.seq - GSS (genome survey sequence) sequence entries, part 196.
1477. gbgss197.seq - GSS (genome survey sequence) sequence entries, part 197.
1478. gbgss198.seq - GSS (genome survey sequence) sequence entries, part 198.
1479. gbgss199.seq - GSS (genome survey sequence) sequence entries, part 199.
1480. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
1481. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
1482. gbgss200.seq - GSS (genome survey sequence) sequence entries, part 200.
1483. gbgss201.seq - GSS (genome survey sequence) sequence entries, part 201.
1484. gbgss202.seq - GSS (genome survey sequence) sequence entries, part 202.
1485. gbgss203.seq - GSS (genome survey sequence) sequence entries, part 203.
1486. gbgss204.seq - GSS (genome survey sequence) sequence entries, part 204.
1487. gbgss205.seq - GSS (genome survey sequence) sequence entries, part 205.
1488. gbgss206.seq - GSS (genome survey sequence) sequence entries, part 206.
1489. gbgss207.seq - GSS (genome survey sequence) sequence entries, part 207.
1490. gbgss208.seq - GSS (genome survey sequence) sequence entries, part 208.
1491. gbgss209.seq - GSS (genome survey sequence) sequence entries, part 209.
1492. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
1493. gbgss210.seq - GSS (genome survey sequence) sequence entries, part 210.
1494. gbgss211.seq - GSS (genome survey sequence) sequence entries, part 211.
1495. gbgss212.seq - GSS (genome survey sequence) sequence entries, part 212.
1496. gbgss213.seq - GSS (genome survey sequence) sequence entries, part 213.
1497. gbgss214.seq - GSS (genome survey sequence) sequence entries, part 214.
1498. gbgss215.seq - GSS (genome survey sequence) sequence entries, part 215.
1499. gbgss216.seq - GSS (genome survey sequence) sequence entries, part 216.
1500. gbgss217.seq - GSS (genome survey sequence) sequence entries, part 217.
1501. gbgss218.seq - GSS (genome survey sequence) sequence entries, part 218.
1502. gbgss219.seq - GSS (genome survey sequence) sequence entries, part 219.
1503. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
1504. gbgss220.seq - GSS (genome survey sequence) sequence entries, part 220.
1505. gbgss221.seq - GSS (genome survey sequence) sequence entries, part 221.
1506. gbgss222.seq - GSS (genome survey sequence) sequence entries, part 222.
1507. gbgss223.seq - GSS (genome survey sequence) sequence entries, part 223.
1508. gbgss224.seq - GSS (genome survey sequence) sequence entries, part 224.
1509. gbgss225.seq - GSS (genome survey sequence) sequence entries, part 225.
1510. gbgss226.seq - GSS (genome survey sequence) sequence entries, part 226.
1511. gbgss227.seq - GSS (genome survey sequence) sequence entries, part 227.
1512. gbgss228.seq - GSS (genome survey sequence) sequence entries, part 228.
1513. gbgss229.seq - GSS (genome survey sequence) sequence entries, part 229.
1514. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
1515. gbgss230.seq - GSS (genome survey sequence) sequence entries, part 230.
1516. gbgss231.seq - GSS (genome survey sequence) sequence entries, part 231.
1517. gbgss232.seq - GSS (genome survey sequence) sequence entries, part 232.
1518. gbgss233.seq - GSS (genome survey sequence) sequence entries, part 233.
1519. gbgss234.seq - GSS (genome survey sequence) sequence entries, part 234.
1520. gbgss235.seq - GSS (genome survey sequence) sequence entries, part 235.
1521. gbgss236.seq - GSS (genome survey sequence) sequence entries, part 236.
1522. gbgss237.seq - GSS (genome survey sequence) sequence entries, part 237.
1523. gbgss238.seq - GSS (genome survey sequence) sequence entries, part 238.
1524. gbgss239.seq - GSS (genome survey sequence) sequence entries, part 239.
1525. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
1526. gbgss240.seq - GSS (genome survey sequence) sequence entries, part 240.
1527. gbgss241.seq - GSS (genome survey sequence) sequence entries, part 241.
1528. gbgss242.seq - GSS (genome survey sequence) sequence entries, part 242.
1529. gbgss243.seq - GSS (genome survey sequence) sequence entries, part 243.
1530. gbgss244.seq - GSS (genome survey sequence) sequence entries, part 244.
1531. gbgss245.seq - GSS (genome survey sequence) sequence entries, part 245.
1532. gbgss246.seq - GSS (genome survey sequence) sequence entries, part 246.
1533. gbgss247.seq - GSS (genome survey sequence) sequence entries, part 247.
1534. gbgss248.seq - GSS (genome survey sequence) sequence entries, part 248.
1535. gbgss249.seq - GSS (genome survey sequence) sequence entries, part 249.
1536. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
1537. gbgss250.seq - GSS (genome survey sequence) sequence entries, part 250.
1538. gbgss251.seq - GSS (genome survey sequence) sequence entries, part 251.
1539. gbgss252.seq - GSS (genome survey sequence) sequence entries, part 252.
1540. gbgss253.seq - GSS (genome survey sequence) sequence entries, part 253.
1541. gbgss254.seq - GSS (genome survey sequence) sequence entries, part 254.
1542. gbgss255.seq - GSS (genome survey sequence) sequence entries, part 255.
1543. gbgss256.seq - GSS (genome survey sequence) sequence entries, part 256.
1544. gbgss257.seq - GSS (genome survey sequence) sequence entries, part 257.
1545. gbgss258.seq - GSS (genome survey sequence) sequence entries, part 258.
1546. gbgss259.seq - GSS (genome survey sequence) sequence entries, part 259.
1547. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
1548. gbgss260.seq - GSS (genome survey sequence) sequence entries, part 260.
1549. gbgss261.seq - GSS (genome survey sequence) sequence entries, part 261.
1550. gbgss262.seq - GSS (genome survey sequence) sequence entries, part 262.
1551. gbgss263.seq - GSS (genome survey sequence) sequence entries, part 263.
1552. gbgss264.seq - GSS (genome survey sequence) sequence entries, part 264.
1553. gbgss265.seq - GSS (genome survey sequence) sequence entries, part 265.
1554. gbgss266.seq - GSS (genome survey sequence) sequence entries, part 266.
1555. gbgss267.seq - GSS (genome survey sequence) sequence entries, part 267.
1556. gbgss268.seq - GSS (genome survey sequence) sequence entries, part 268.
1557. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
1558. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
1559. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
1560. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
1561. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
1562. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
1563. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
1564. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
1565. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
1566. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
1567. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
1568. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
1569. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
1570. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
1571. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
1572. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
1573. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
1574. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
1575. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
1576. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
1577. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
1578. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
1579. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
1580. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
1581. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
1582. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
1583. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
1584. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
1585. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
1586. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
1587. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
1588. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
1589. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
1590. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
1591. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
1592. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
1593. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
1594. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
1595. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
1596. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
1597. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
1598. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
1599. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
1600. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
1601. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
1602. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
1603. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
1604. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
1605. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
1606. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
1607. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
1608. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
1609. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
1610. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
1611. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
1612. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
1613. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
1614. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
1615. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
1616. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
1617. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
1618. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
1619. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
1620. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
1621. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
1622. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
1623. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
1624. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
1625. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
1626. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
1627. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
1628. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
1629. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
1630. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
1631. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
1632. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
1633. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
1634. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
1635. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
1636. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
1637. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
1638. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
1639. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
1640. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
1641. gbhtc5.seq - HTC (high throughput cDNA sequencing) sequence entries, part 5.
1642. gbhtc6.seq - HTC (high throughput cDNA sequencing) sequence entries, part 6.
1643. gbhtc7.seq - HTC (high throughput cDNA sequencing) sequence entries, part 7.
1644. gbhtc8.seq - HTC (high throughput cDNA sequencing) sequence entries, part 8.
1645. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1646. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1647. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1648. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1649. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1650. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1651. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1652. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1653. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1654. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1655. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1656. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1657. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1658. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1659. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1660. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1661. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1662. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1663. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1664. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1665. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1666. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1667. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1668. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1669. gbhtg31.seq - HTGS (high throughput genomic sequencing) sequence entries, part 31.
1670. gbhtg32.seq - HTGS (high throughput genomic sequencing) sequence entries, part 32.
1671. gbhtg33.seq - HTGS (high throughput genomic sequencing) sequence entries, part 33.
1672. gbhtg34.seq - HTGS (high throughput genomic sequencing) sequence entries, part 34.
1673. gbhtg35.seq - HTGS (high throughput genomic sequencing) sequence entries, part 35.
1674. gbhtg36.seq - HTGS (high throughput genomic sequencing) sequence entries, part 36.
1675. gbhtg37.seq - HTGS (high throughput genomic sequencing) sequence entries, part 37.
1676. gbhtg38.seq - HTGS (high throughput genomic sequencing) sequence entries, part 38.
1677. gbhtg39.seq - HTGS (high throughput genomic sequencing) sequence entries, part 39.
1678. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1679. gbhtg40.seq - HTGS (high throughput genomic sequencing) sequence entries, part 40.
1680. gbhtg41.seq - HTGS (high throughput genomic sequencing) sequence entries, part 41.
1681. gbhtg42.seq - HTGS (high throughput genomic sequencing) sequence entries, part 42.
1682. gbhtg43.seq - HTGS (high throughput genomic sequencing) sequence entries, part 43.
1683. gbhtg44.seq - HTGS (high throughput genomic sequencing) sequence entries, part 44.
1684. gbhtg45.seq - HTGS (high throughput genomic sequencing) sequence entries, part 45.
1685. gbhtg46.seq - HTGS (high throughput genomic sequencing) sequence entries, part 46.
1686. gbhtg47.seq - HTGS (high throughput genomic sequencing) sequence entries, part 47.
1687. gbhtg48.seq - HTGS (high throughput genomic sequencing) sequence entries, part 48.
1688. gbhtg49.seq - HTGS (high throughput genomic sequencing) sequence entries, part 49.
1689. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1690. gbhtg50.seq - HTGS (high throughput genomic sequencing) sequence entries, part 50.
1691. gbhtg51.seq - HTGS (high throughput genomic sequencing) sequence entries, part 51.
1692. gbhtg52.seq - HTGS (high throughput genomic sequencing) sequence entries, part 52.
1693. gbhtg53.seq - HTGS (high throughput genomic sequencing) sequence entries, part 53.
1694. gbhtg54.seq - HTGS (high throughput genomic sequencing) sequence entries, part 54.
1695. gbhtg55.seq - HTGS (high throughput genomic sequencing) sequence entries, part 55.
1696. gbhtg56.seq - HTGS (high throughput genomic sequencing) sequence entries, part 56.
1697. gbhtg57.seq - HTGS (high throughput genomic sequencing) sequence entries, part 57.
1698. gbhtg58.seq - HTGS (high throughput genomic sequencing) sequence entries, part 58.
1699. gbhtg59.seq - HTGS (high throughput genomic sequencing) sequence entries, part 59.
1700. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1701. gbhtg60.seq - HTGS (high throughput genomic sequencing) sequence entries, part 60.
1702. gbhtg61.seq - HTGS (high throughput genomic sequencing) sequence entries, part 61.
1703. gbhtg62.seq - HTGS (high throughput genomic sequencing) sequence entries, part 62.
1704. gbhtg63.seq - HTGS (high throughput genomic sequencing) sequence entries, part 63.
1705. gbhtg64.seq - HTGS (high throughput genomic sequencing) sequence entries, part 64.
1706. gbhtg65.seq - HTGS (high throughput genomic sequencing) sequence entries, part 65.
1707. gbhtg66.seq - HTGS (high throughput genomic sequencing) sequence entries, part 66.
1708. gbhtg67.seq - HTGS (high throughput genomic sequencing) sequence entries, part 67.
1709. gbhtg68.seq - HTGS (high throughput genomic sequencing) sequence entries, part 68.
1710. gbhtg69.seq - HTGS (high throughput genomic sequencing) sequence entries, part 69.
1711. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1712. gbhtg70.seq - HTGS (high throughput genomic sequencing) sequence entries, part 70.
1713. gbhtg71.seq - HTGS (high throughput genomic sequencing) sequence entries, part 71.
1714. gbhtg72.seq - HTGS (high throughput genomic sequencing) sequence entries, part 72.
1715. gbhtg73.seq - HTGS (high throughput genomic sequencing) sequence entries, part 73.
1716. gbhtg74.seq - HTGS (high throughput genomic sequencing) sequence entries, part 74.
1717. gbhtg75.seq - HTGS (high throughput genomic sequencing) sequence entries, part 75.
1718. gbhtg76.seq - HTGS (high throughput genomic sequencing) sequence entries, part 76.
1719. gbhtg77.seq - HTGS (high throughput genomic sequencing) sequence entries, part 77.
1720. gbhtg78.seq - HTGS (high throughput genomic sequencing) sequence entries, part 78.
1721. gbhtg79.seq - HTGS (high throughput genomic sequencing) sequence entries, part 79.
1722. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1723. gbhtg80.seq - HTGS (high throughput genomic sequencing) sequence entries, part 80.
1724. gbhtg81.seq - HTGS (high throughput genomic sequencing) sequence entries, part 81.
1725. gbhtg82.seq - HTGS (high throughput genomic sequencing) sequence entries, part 82.
1726. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1727. gbinv1.seq - Invertebrate sequence entries, part 1.
1728. gbinv10.seq - Invertebrate sequence entries, part 10.
1729. gbinv11.seq - Invertebrate sequence entries, part 11.
1730. gbinv12.seq - Invertebrate sequence entries, part 12.
1731. gbinv13.seq - Invertebrate sequence entries, part 13.
1732. gbinv14.seq - Invertebrate sequence entries, part 14.
1733. gbinv15.seq - Invertebrate sequence entries, part 15.
1734. gbinv16.seq - Invertebrate sequence entries, part 16.
1735. gbinv17.seq - Invertebrate sequence entries, part 17.
1736. gbinv18.seq - Invertebrate sequence entries, part 18.
1737. gbinv19.seq - Invertebrate sequence entries, part 19.
1738. gbinv2.seq - Invertebrate sequence entries, part 2.
1739. gbinv20.seq - Invertebrate sequence entries, part 20.
1740. gbinv21.seq - Invertebrate sequence entries, part 21.
1741. gbinv22.seq - Invertebrate sequence entries, part 22.
1742. gbinv23.seq - Invertebrate sequence entries, part 23.
1743. gbinv24.seq - Invertebrate sequence entries, part 24.
1744. gbinv25.seq - Invertebrate sequence entries, part 25.
1745. gbinv26.seq - Invertebrate sequence entries, part 26.
1746. gbinv27.seq - Invertebrate sequence entries, part 27.
1747. gbinv28.seq - Invertebrate sequence entries, part 28.
1748. gbinv29.seq - Invertebrate sequence entries, part 29.
1749. gbinv3.seq - Invertebrate sequence entries, part 3.
1750. gbinv30.seq - Invertebrate sequence entries, part 30.
1751. gbinv31.seq - Invertebrate sequence entries, part 31.
1752. gbinv32.seq - Invertebrate sequence entries, part 32.
1753. gbinv33.seq - Invertebrate sequence entries, part 33.
1754. gbinv34.seq - Invertebrate sequence entries, part 34.
1755. gbinv35.seq - Invertebrate sequence entries, part 35.
1756. gbinv36.seq - Invertebrate sequence entries, part 36.
1757. gbinv37.seq - Invertebrate sequence entries, part 37.
1758. gbinv38.seq - Invertebrate sequence entries, part 38.
1759. gbinv39.seq - Invertebrate sequence entries, part 39.
1760. gbinv4.seq - Invertebrate sequence entries, part 4.
1761. gbinv40.seq - Invertebrate sequence entries, part 40.
1762. gbinv41.seq - Invertebrate sequence entries, part 41.
1763. gbinv42.seq - Invertebrate sequence entries, part 42.
1764. gbinv43.seq - Invertebrate sequence entries, part 43.
1765. gbinv44.seq - Invertebrate sequence entries, part 44.
1766. gbinv45.seq - Invertebrate sequence entries, part 45.
1767. gbinv46.seq - Invertebrate sequence entries, part 46.
1768. gbinv47.seq - Invertebrate sequence entries, part 47.
1769. gbinv48.seq - Invertebrate sequence entries, part 48.
1770. gbinv49.seq - Invertebrate sequence entries, part 49.
1771. gbinv5.seq - Invertebrate sequence entries, part 5.
1772. gbinv50.seq - Invertebrate sequence entries, part 50.
1773. gbinv51.seq - Invertebrate sequence entries, part 51.
1774. gbinv52.seq - Invertebrate sequence entries, part 52.
1775. gbinv53.seq - Invertebrate sequence entries, part 53.
1776. gbinv54.seq - Invertebrate sequence entries, part 54.
1777. gbinv55.seq - Invertebrate sequence entries, part 55.
1778. gbinv56.seq - Invertebrate sequence entries, part 56.
1779. gbinv57.seq - Invertebrate sequence entries, part 57.
1780. gbinv58.seq - Invertebrate sequence entries, part 58.
1781. gbinv59.seq - Invertebrate sequence entries, part 59.
1782. gbinv6.seq - Invertebrate sequence entries, part 6.
1783. gbinv60.seq - Invertebrate sequence entries, part 60.
1784. gbinv61.seq - Invertebrate sequence entries, part 61.
1785. gbinv62.seq - Invertebrate sequence entries, part 62.
1786. gbinv63.seq - Invertebrate sequence entries, part 63.
1787. gbinv64.seq - Invertebrate sequence entries, part 64.
1788. gbinv65.seq - Invertebrate sequence entries, part 65.
1789. gbinv66.seq - Invertebrate sequence entries, part 66.
1790. gbinv67.seq - Invertebrate sequence entries, part 67.
1791. gbinv68.seq - Invertebrate sequence entries, part 68.
1792. gbinv69.seq - Invertebrate sequence entries, part 69.
1793. gbinv7.seq - Invertebrate sequence entries, part 7.
1794. gbinv70.seq - Invertebrate sequence entries, part 70.
1795. gbinv71.seq - Invertebrate sequence entries, part 71.
1796. gbinv72.seq - Invertebrate sequence entries, part 72.
1797. gbinv73.seq - Invertebrate sequence entries, part 73.
1798. gbinv74.seq - Invertebrate sequence entries, part 74.
1799. gbinv75.seq - Invertebrate sequence entries, part 75.
1800. gbinv76.seq - Invertebrate sequence entries, part 76.
1801. gbinv77.seq - Invertebrate sequence entries, part 77.
1802. gbinv78.seq - Invertebrate sequence entries, part 78.
1803. gbinv79.seq - Invertebrate sequence entries, part 79.
1804. gbinv8.seq - Invertebrate sequence entries, part 8.
1805. gbinv80.seq - Invertebrate sequence entries, part 80.
1806. gbinv81.seq - Invertebrate sequence entries, part 81.
1807. gbinv82.seq - Invertebrate sequence entries, part 82.
1808. gbinv83.seq - Invertebrate sequence entries, part 83.
1809. gbinv84.seq - Invertebrate sequence entries, part 84.
1810. gbinv85.seq - Invertebrate sequence entries, part 85.
1811. gbinv86.seq - Invertebrate sequence entries, part 86.
1812. gbinv87.seq - Invertebrate sequence entries, part 87.
1813. gbinv88.seq - Invertebrate sequence entries, part 88.
1814. gbinv89.seq - Invertebrate sequence entries, part 89.
1815. gbinv9.seq - Invertebrate sequence entries, part 9.
1816. gbinv90.seq - Invertebrate sequence entries, part 90.
1817. gbinv91.seq - Invertebrate sequence entries, part 91.
1818. gbinv92.seq - Invertebrate sequence entries, part 92.
1819. gbinv93.seq - Invertebrate sequence entries, part 93.
1820. gbinv94.seq - Invertebrate sequence entries, part 94.
1821. gbinv95.seq - Invertebrate sequence entries, part 95.
1822. gbinv96.seq - Invertebrate sequence entries, part 96.
1823. gbinv97.seq - Invertebrate sequence entries, part 97.
1824. gbmam1.seq - Other mammalian sequence entries, part 1.
1825. gbmam10.seq - Other mammalian sequence entries, part 10.
1826. gbmam11.seq - Other mammalian sequence entries, part 11.
1827. gbmam12.seq - Other mammalian sequence entries, part 12.
1828. gbmam13.seq - Other mammalian sequence entries, part 13.
1829. gbmam14.seq - Other mammalian sequence entries, part 14.
1830. gbmam15.seq - Other mammalian sequence entries, part 15.
1831. gbmam16.seq - Other mammalian sequence entries, part 16.
1832. gbmam17.seq - Other mammalian sequence entries, part 17.
1833. gbmam18.seq - Other mammalian sequence entries, part 18.
1834. gbmam19.seq - Other mammalian sequence entries, part 19.
1835. gbmam2.seq - Other mammalian sequence entries, part 2.
1836. gbmam20.seq - Other mammalian sequence entries, part 20.
1837. gbmam21.seq - Other mammalian sequence entries, part 21.
1838. gbmam22.seq - Other mammalian sequence entries, part 22.
1839. gbmam23.seq - Other mammalian sequence entries, part 23.
1840. gbmam24.seq - Other mammalian sequence entries, part 24.
1841. gbmam25.seq - Other mammalian sequence entries, part 25.
1842. gbmam26.seq - Other mammalian sequence entries, part 26.
1843. gbmam27.seq - Other mammalian sequence entries, part 27.
1844. gbmam28.seq - Other mammalian sequence entries, part 28.
1845. gbmam29.seq - Other mammalian sequence entries, part 29.
1846. gbmam3.seq - Other mammalian sequence entries, part 3.
1847. gbmam30.seq - Other mammalian sequence entries, part 30.
1848. gbmam31.seq - Other mammalian sequence entries, part 31.
1849. gbmam32.seq - Other mammalian sequence entries, part 32.
1850. gbmam33.seq - Other mammalian sequence entries, part 33.
1851. gbmam34.seq - Other mammalian sequence entries, part 34.
1852. gbmam35.seq - Other mammalian sequence entries, part 35.
1853. gbmam36.seq - Other mammalian sequence entries, part 36.
1854. gbmam37.seq - Other mammalian sequence entries, part 37.
1855. gbmam38.seq - Other mammalian sequence entries, part 38.
1856. gbmam39.seq - Other mammalian sequence entries, part 39.
1857. gbmam4.seq - Other mammalian sequence entries, part 4.
1858. gbmam40.seq - Other mammalian sequence entries, part 40.
1859. gbmam41.seq - Other mammalian sequence entries, part 41.
1860. gbmam42.seq - Other mammalian sequence entries, part 42.
1861. gbmam43.seq - Other mammalian sequence entries, part 43.
1862. gbmam44.seq - Other mammalian sequence entries, part 44.
1863. gbmam45.seq - Other mammalian sequence entries, part 45.
1864. gbmam46.seq - Other mammalian sequence entries, part 46.
1865. gbmam47.seq - Other mammalian sequence entries, part 47.
1866. gbmam48.seq - Other mammalian sequence entries, part 48.
1867. gbmam49.seq - Other mammalian sequence entries, part 49.
1868. gbmam5.seq - Other mammalian sequence entries, part 5.
1869. gbmam50.seq - Other mammalian sequence entries, part 50.
1870. gbmam51.seq - Other mammalian sequence entries, part 51.
1871. gbmam52.seq - Other mammalian sequence entries, part 52.
1872. gbmam53.seq - Other mammalian sequence entries, part 53.
1873. gbmam54.seq - Other mammalian sequence entries, part 54.
1874. gbmam55.seq - Other mammalian sequence entries, part 55.
1875. gbmam56.seq - Other mammalian sequence entries, part 56.
1876. gbmam57.seq - Other mammalian sequence entries, part 57.
1877. gbmam58.seq - Other mammalian sequence entries, part 58.
1878. gbmam59.seq - Other mammalian sequence entries, part 59.
1879. gbmam6.seq - Other mammalian sequence entries, part 6.
1880. gbmam60.seq - Other mammalian sequence entries, part 60.
1881. gbmam61.seq - Other mammalian sequence entries, part 61.
1882. gbmam62.seq - Other mammalian sequence entries, part 62.
1883. gbmam63.seq - Other mammalian sequence entries, part 63.
1884. gbmam64.seq - Other mammalian sequence entries, part 64.
1885. gbmam65.seq - Other mammalian sequence entries, part 65.
1886. gbmam66.seq - Other mammalian sequence entries, part 66.
1887. gbmam67.seq - Other mammalian sequence entries, part 67.
1888. gbmam68.seq - Other mammalian sequence entries, part 68.
1889. gbmam69.seq - Other mammalian sequence entries, part 69.
1890. gbmam7.seq - Other mammalian sequence entries, part 7.
1891. gbmam70.seq - Other mammalian sequence entries, part 70.
1892. gbmam71.seq - Other mammalian sequence entries, part 71.
1893. gbmam72.seq - Other mammalian sequence entries, part 72.
1894. gbmam73.seq - Other mammalian sequence entries, part 73.
1895. gbmam74.seq - Other mammalian sequence entries, part 74.
1896. gbmam75.seq - Other mammalian sequence entries, part 75.
1897. gbmam76.seq - Other mammalian sequence entries, part 76.
1898. gbmam8.seq - Other mammalian sequence entries, part 8.
1899. gbmam9.seq - Other mammalian sequence entries, part 9.
1900. gbnew.txt - Accession numbers of entries new since the previous release.
1901. gbpat1.seq - Patent sequence entries, part 1.
1902. gbpat10.seq - Patent sequence entries, part 10.
1903. gbpat100.seq - Patent sequence entries, part 100.
1904. gbpat101.seq - Patent sequence entries, part 101.
1905. gbpat102.seq - Patent sequence entries, part 102.
1906. gbpat103.seq - Patent sequence entries, part 103.
1907. gbpat104.seq - Patent sequence entries, part 104.
1908. gbpat105.seq - Patent sequence entries, part 105.
1909. gbpat106.seq - Patent sequence entries, part 106.
1910. gbpat107.seq - Patent sequence entries, part 107.
1911. gbpat108.seq - Patent sequence entries, part 108.
1912. gbpat109.seq - Patent sequence entries, part 109.
1913. gbpat11.seq - Patent sequence entries, part 11.
1914. gbpat110.seq - Patent sequence entries, part 110.
1915. gbpat111.seq - Patent sequence entries, part 111.
1916. gbpat112.seq - Patent sequence entries, part 112.
1917. gbpat113.seq - Patent sequence entries, part 113.
1918. gbpat114.seq - Patent sequence entries, part 114.
1919. gbpat115.seq - Patent sequence entries, part 115.
1920. gbpat116.seq - Patent sequence entries, part 116.
1921. gbpat117.seq - Patent sequence entries, part 117.
1922. gbpat118.seq - Patent sequence entries, part 118.
1923. gbpat119.seq - Patent sequence entries, part 119.
1924. gbpat12.seq - Patent sequence entries, part 12.
1925. gbpat120.seq - Patent sequence entries, part 120.
1926. gbpat121.seq - Patent sequence entries, part 121.
1927. gbpat122.seq - Patent sequence entries, part 122.
1928. gbpat123.seq - Patent sequence entries, part 123.
1929. gbpat124.seq - Patent sequence entries, part 124.
1930. gbpat125.seq - Patent sequence entries, part 125.
1931. gbpat126.seq - Patent sequence entries, part 126.
1932. gbpat127.seq - Patent sequence entries, part 127.
1933. gbpat128.seq - Patent sequence entries, part 128.
1934. gbpat129.seq - Patent sequence entries, part 129.
1935. gbpat13.seq - Patent sequence entries, part 13.
1936. gbpat130.seq - Patent sequence entries, part 130.
1937. gbpat131.seq - Patent sequence entries, part 131.
1938. gbpat132.seq - Patent sequence entries, part 132.
1939. gbpat133.seq - Patent sequence entries, part 133.
1940. gbpat134.seq - Patent sequence entries, part 134.
1941. gbpat135.seq - Patent sequence entries, part 135.
1942. gbpat136.seq - Patent sequence entries, part 136.
1943. gbpat137.seq - Patent sequence entries, part 137.
1944. gbpat138.seq - Patent sequence entries, part 138.
1945. gbpat139.seq - Patent sequence entries, part 139.
1946. gbpat14.seq - Patent sequence entries, part 14.
1947. gbpat140.seq - Patent sequence entries, part 140.
1948. gbpat141.seq - Patent sequence entries, part 141.
1949. gbpat142.seq - Patent sequence entries, part 142.
1950. gbpat143.seq - Patent sequence entries, part 143.
1951. gbpat144.seq - Patent sequence entries, part 144.
1952. gbpat145.seq - Patent sequence entries, part 145.
1953. gbpat146.seq - Patent sequence entries, part 146.
1954. gbpat147.seq - Patent sequence entries, part 147.
1955. gbpat148.seq - Patent sequence entries, part 148.
1956. gbpat149.seq - Patent sequence entries, part 149.
1957. gbpat15.seq - Patent sequence entries, part 15.
1958. gbpat150.seq - Patent sequence entries, part 150.
1959. gbpat151.seq - Patent sequence entries, part 151.
1960. gbpat152.seq - Patent sequence entries, part 152.
1961. gbpat153.seq - Patent sequence entries, part 153.
1962. gbpat154.seq - Patent sequence entries, part 154.
1963. gbpat155.seq - Patent sequence entries, part 155.
1964. gbpat156.seq - Patent sequence entries, part 156.
1965. gbpat157.seq - Patent sequence entries, part 157.
1966. gbpat158.seq - Patent sequence entries, part 158.
1967. gbpat159.seq - Patent sequence entries, part 159.
1968. gbpat16.seq - Patent sequence entries, part 16.
1969. gbpat160.seq - Patent sequence entries, part 160.
1970. gbpat161.seq - Patent sequence entries, part 161.
1971. gbpat162.seq - Patent sequence entries, part 162.
1972. gbpat163.seq - Patent sequence entries, part 163.
1973. gbpat164.seq - Patent sequence entries, part 164.
1974. gbpat165.seq - Patent sequence entries, part 165.
1975. gbpat166.seq - Patent sequence entries, part 166.
1976. gbpat167.seq - Patent sequence entries, part 167.
1977. gbpat168.seq - Patent sequence entries, part 168.
1978. gbpat169.seq - Patent sequence entries, part 169.
1979. gbpat17.seq - Patent sequence entries, part 17.
1980. gbpat170.seq - Patent sequence entries, part 170.
1981. gbpat171.seq - Patent sequence entries, part 171.
1982. gbpat172.seq - Patent sequence entries, part 172.
1983. gbpat173.seq - Patent sequence entries, part 173.
1984. gbpat174.seq - Patent sequence entries, part 174.
1985. gbpat175.seq - Patent sequence entries, part 175.
1986. gbpat176.seq - Patent sequence entries, part 176.
1987. gbpat177.seq - Patent sequence entries, part 177.
1988. gbpat178.seq - Patent sequence entries, part 178.
1989. gbpat179.seq - Patent sequence entries, part 179.
1990. gbpat18.seq - Patent sequence entries, part 18.
1991. gbpat180.seq - Patent sequence entries, part 180.
1992. gbpat181.seq - Patent sequence entries, part 181.
1993. gbpat182.seq - Patent sequence entries, part 182.
1994. gbpat183.seq - Patent sequence entries, part 183.
1995. gbpat184.seq - Patent sequence entries, part 184.
1996. gbpat185.seq - Patent sequence entries, part 185.
1997. gbpat186.seq - Patent sequence entries, part 186.
1998. gbpat187.seq - Patent sequence entries, part 187.
1999. gbpat188.seq - Patent sequence entries, part 188.
2000. gbpat189.seq - Patent sequence entries, part 189.
2001. gbpat19.seq - Patent sequence entries, part 19.
2002. gbpat190.seq - Patent sequence entries, part 190.
2003. gbpat191.seq - Patent sequence entries, part 191.
2004. gbpat192.seq - Patent sequence entries, part 192.
2005. gbpat193.seq - Patent sequence entries, part 193.
2006. gbpat194.seq - Patent sequence entries, part 194.
2007. gbpat195.seq - Patent sequence entries, part 195.
2008. gbpat196.seq - Patent sequence entries, part 196.
2009. gbpat197.seq - Patent sequence entries, part 197.
2010. gbpat198.seq - Patent sequence entries, part 198.
2011. gbpat199.seq - Patent sequence entries, part 199.
2012. gbpat2.seq - Patent sequence entries, part 2.
2013. gbpat20.seq - Patent sequence entries, part 20.
2014. gbpat200.seq - Patent sequence entries, part 200.
2015. gbpat201.seq - Patent sequence entries, part 201.
2016. gbpat202.seq - Patent sequence entries, part 202.
2017. gbpat203.seq - Patent sequence entries, part 203.
2018. gbpat204.seq - Patent sequence entries, part 204.
2019. gbpat205.seq - Patent sequence entries, part 205.
2020. gbpat206.seq - Patent sequence entries, part 206.
2021. gbpat207.seq - Patent sequence entries, part 207.
2022. gbpat208.seq - Patent sequence entries, part 208.
2023. gbpat209.seq - Patent sequence entries, part 209.
2024. gbpat21.seq - Patent sequence entries, part 21.
2025. gbpat210.seq - Patent sequence entries, part 210.
2026. gbpat211.seq - Patent sequence entries, part 211.
2027. gbpat212.seq - Patent sequence entries, part 212.
2028. gbpat213.seq - Patent sequence entries, part 213.
2029. gbpat22.seq - Patent sequence entries, part 22.
2030. gbpat23.seq - Patent sequence entries, part 23.
2031. gbpat24.seq - Patent sequence entries, part 24.
2032. gbpat25.seq - Patent sequence entries, part 25.
2033. gbpat26.seq - Patent sequence entries, part 26.
2034. gbpat27.seq - Patent sequence entries, part 27.
2035. gbpat28.seq - Patent sequence entries, part 28.
2036. gbpat29.seq - Patent sequence entries, part 29.
2037. gbpat3.seq - Patent sequence entries, part 3.
2038. gbpat30.seq - Patent sequence entries, part 30.
2039. gbpat31.seq - Patent sequence entries, part 31.
2040. gbpat32.seq - Patent sequence entries, part 32.
2041. gbpat33.seq - Patent sequence entries, part 33.
2042. gbpat34.seq - Patent sequence entries, part 34.
2043. gbpat35.seq - Patent sequence entries, part 35.
2044. gbpat36.seq - Patent sequence entries, part 36.
2045. gbpat37.seq - Patent sequence entries, part 37.
2046. gbpat38.seq - Patent sequence entries, part 38.
2047. gbpat39.seq - Patent sequence entries, part 39.
2048. gbpat4.seq - Patent sequence entries, part 4.
2049. gbpat40.seq - Patent sequence entries, part 40.
2050. gbpat41.seq - Patent sequence entries, part 41.
2051. gbpat42.seq - Patent sequence entries, part 42.
2052. gbpat43.seq - Patent sequence entries, part 43.
2053. gbpat44.seq - Patent sequence entries, part 44.
2054. gbpat45.seq - Patent sequence entries, part 45.
2055. gbpat46.seq - Patent sequence entries, part 46.
2056. gbpat47.seq - Patent sequence entries, part 47.
2057. gbpat48.seq - Patent sequence entries, part 48.
2058. gbpat49.seq - Patent sequence entries, part 49.
2059. gbpat5.seq - Patent sequence entries, part 5.
2060. gbpat50.seq - Patent sequence entries, part 50.
2061. gbpat51.seq - Patent sequence entries, part 51.
2062. gbpat52.seq - Patent sequence entries, part 52.
2063. gbpat53.seq - Patent sequence entries, part 53.
2064. gbpat54.seq - Patent sequence entries, part 54.
2065. gbpat55.seq - Patent sequence entries, part 55.
2066. gbpat56.seq - Patent sequence entries, part 56.
2067. gbpat57.seq - Patent sequence entries, part 57.
2068. gbpat58.seq - Patent sequence entries, part 58.
2069. gbpat59.seq - Patent sequence entries, part 59.
2070. gbpat6.seq - Patent sequence entries, part 6.
2071. gbpat60.seq - Patent sequence entries, part 60.
2072. gbpat61.seq - Patent sequence entries, part 61.
2073. gbpat62.seq - Patent sequence entries, part 62.
2074. gbpat63.seq - Patent sequence entries, part 63.
2075. gbpat64.seq - Patent sequence entries, part 64.
2076. gbpat65.seq - Patent sequence entries, part 65.
2077. gbpat66.seq - Patent sequence entries, part 66.
2078. gbpat67.seq - Patent sequence entries, part 67.
2079. gbpat68.seq - Patent sequence entries, part 68.
2080. gbpat69.seq - Patent sequence entries, part 69.
2081. gbpat7.seq - Patent sequence entries, part 7.
2082. gbpat70.seq - Patent sequence entries, part 70.
2083. gbpat71.seq - Patent sequence entries, part 71.
2084. gbpat72.seq - Patent sequence entries, part 72.
2085. gbpat73.seq - Patent sequence entries, part 73.
2086. gbpat74.seq - Patent sequence entries, part 74.
2087. gbpat75.seq - Patent sequence entries, part 75.
2088. gbpat76.seq - Patent sequence entries, part 76.
2089. gbpat77.seq - Patent sequence entries, part 77.
2090. gbpat78.seq - Patent sequence entries, part 78.
2091. gbpat79.seq - Patent sequence entries, part 79.
2092. gbpat8.seq - Patent sequence entries, part 8.
2093. gbpat80.seq - Patent sequence entries, part 80.
2094. gbpat81.seq - Patent sequence entries, part 81.
2095. gbpat82.seq - Patent sequence entries, part 82.
2096. gbpat83.seq - Patent sequence entries, part 83.
2097. gbpat84.seq - Patent sequence entries, part 84.
2098. gbpat85.seq - Patent sequence entries, part 85.
2099. gbpat86.seq - Patent sequence entries, part 86.
2100. gbpat87.seq - Patent sequence entries, part 87.
2101. gbpat88.seq - Patent sequence entries, part 88.
2102. gbpat89.seq - Patent sequence entries, part 89.
2103. gbpat9.seq - Patent sequence entries, part 9.
2104. gbpat90.seq - Patent sequence entries, part 90.
2105. gbpat91.seq - Patent sequence entries, part 91.
2106. gbpat92.seq - Patent sequence entries, part 92.
2107. gbpat93.seq - Patent sequence entries, part 93.
2108. gbpat94.seq - Patent sequence entries, part 94.
2109. gbpat95.seq - Patent sequence entries, part 95.
2110. gbpat96.seq - Patent sequence entries, part 96.
2111. gbpat97.seq - Patent sequence entries, part 97.
2112. gbpat98.seq - Patent sequence entries, part 98.
2113. gbpat99.seq - Patent sequence entries, part 99.
2114. gbphg1.seq - Phage sequence entries, part 1.
2115. gbphg2.seq - Phage sequence entries, part 2.
2116. gbphg3.seq - Phage sequence entries, part 3.
2117. gbphg4.seq - Phage sequence entries, part 4.
2118. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2119. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2120. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2121. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2122. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2123. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2124. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2125. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2126. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2127. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2128. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2129. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2130. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2131. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2132. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2133. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2134. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2135. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2136. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2137. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2138. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2139. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2140. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2141. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2142. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2143. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2144. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2145. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2146. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2147. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2148. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2149. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2150. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2151. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2152. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2153. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2154. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2155. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2156. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2157. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2158. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2159. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2160. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2161. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2162. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2163. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2164. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2165. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2166. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2167. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2168. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2169. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2170. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2171. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2172. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2173. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2174. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2175. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2176. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2177. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2178. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2179. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2180. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2181. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2182. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2183. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2184. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2185. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2186. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2187. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2188. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2189. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2190. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2191. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2192. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2193. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2194. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2195. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2196. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2197. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2198. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2199. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2200. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2201. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2202. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2203. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2204. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2205. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2206. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2207. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
2208. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
2209. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
2210. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
2211. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
2212. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
2213. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
2214. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
2215. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
2216. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
2217. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
2218. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
2219. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
2220. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
2221. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
2222. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
2223. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
2224. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
2225. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
2226. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
2227. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
2228. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
2229. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
2230. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
2231. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
2232. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
2233. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
2234. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
2235. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
2236. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
2237. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
2238. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
2239. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
2240. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
2241. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
2242. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
2243. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
2244. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
2245. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
2246. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
2247. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
2248. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
2249. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
2250. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
2251. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
2252. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
2253. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
2254. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
2255. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
2256. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
2257. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
2258. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
2259. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
2260. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
2261. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
2262. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
2263. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
2264. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
2265. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
2266. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
2267. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
2268. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
2269. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
2270. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
2271. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
2272. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
2273. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
2274. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
2275. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
2276. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
2277. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
2278. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
2279. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
2280. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
2281. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
2282. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
2283. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
2284. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
2285. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
2286. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
2287. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
2288. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
2289. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
2290. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
2291. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
2292. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
2293. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
2294. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
2295. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
2296. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
2297. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
2298. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
2299. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
2300. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
2301. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
2302. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
2303. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
2304. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
2305. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
2306. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
2307. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
2308. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
2309. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
2310. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
2311. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
2312. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
2313. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
2314. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
2315. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
2316. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
2317. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
2318. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
2319. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
2320. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
2321. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
2322. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
2323. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
2324. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
2325. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
2326. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
2327. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
2328. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
2329. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
2330. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
2331. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
2332. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
2333. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
2334. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
2335. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
2336. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
2337. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
2338. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
2339. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
2340. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
2341. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
2342. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
2343. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
2344. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
2345. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
2346. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
2347. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
2348. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
2349. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
2350. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
2351. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
2352. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
2353. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
2354. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
2355. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
2356. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
2357. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
2358. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
2359. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
2360. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
2361. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
2362. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
2363. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
2364. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
2365. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
2366. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
2367. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
2368. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
2369. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
2370. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
2371. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
2372. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
2373. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
2374. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
2375. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
2376. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
2377. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
2378. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
2379. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
2380. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
2381. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
2382. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
2383. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
2384. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
2385. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
2386. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
2387. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
2388. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
2389. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
2390. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
2391. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
2392. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
2393. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
2394. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
2395. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
2396. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
2397. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
2398. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
2399. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
2400. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
2401. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
2402. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
2403. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
2404. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
2405. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
2406. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
2407. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
2408. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
2409. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
2410. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
2411. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
2412. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
2413. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
2414. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
2415. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
2416. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
2417. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
2418. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
2419. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
2420. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
2421. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
2422. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
2423. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
2424. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
2425. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
2426. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
2427. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
2428. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
2429. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
2430. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
2431. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
2432. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
2433. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
2434. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
2435. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
2436. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
2437. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
2438. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
2439. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
2440. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
2441. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
2442. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
2443. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
2444. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
2445. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
2446. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
2447. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
2448. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
2449. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
2450. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
2451. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
2452. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
2453. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
2454. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
2455. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
2456. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
2457. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
2458. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
2459. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
2460. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
2461. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
2462. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
2463. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
2464. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
2465. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
2466. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
2467. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
2468. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
2469. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
2470. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
2471. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
2472. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
2473. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
2474. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
2475. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
2476. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
2477. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
2478. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
2479. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
2480. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
2481. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
2482. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
2483. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
2484. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
2485. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
2486. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
2487. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
2488. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
2489. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
2490. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
2491. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
2492. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
2493. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
2494. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
2495. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
2496. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
2497. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
2498. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
2499. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
2500. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
2501. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
2502. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
2503. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
2504. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
2505. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
2506. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
2507. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
2508. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
2509. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
2510. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
2511. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
2512. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
2513. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
2514. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
2515. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
2516. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
2517. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
2518. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
2519. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
2520. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
2521. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
2522. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
2523. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
2524. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
2525. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
2526. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
2527. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
2528. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
2529. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
2530. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
2531. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
2532. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
2533. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
2534. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
2535. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
2536. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
2537. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
2538. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
2539. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
2540. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
2541. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
2542. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
2543. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
2544. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
2545. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
2546. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
2547. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
2548. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
2549. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
2550. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
2551. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
2552. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
2553. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
2554. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
2555. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
2556. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
2557. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
2558. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
2559. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
2560. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
2561. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
2562. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
2563. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
2564. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
2565. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
2566. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
2567. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
2568. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
2569. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
2570. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
2571. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
2572. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
2573. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
2574. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
2575. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
2576. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
2577. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
2578. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
2579. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
2580. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
2581. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
2582. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
2583. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
2584. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
2585. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
2586. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
2587. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
2588. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
2589. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
2590. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
2591. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
2592. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
2593. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
2594. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
2595. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
2596. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
2597. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
2598. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
2599. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
2600. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
2601. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
2602. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
2603. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
2604. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
2605. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
2606. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
2607. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
2608. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
2609. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
2610. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
2611. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
2612. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
2613. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
2614. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
2615. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
2616. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
2617. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
2618. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
2619. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
2620. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
2621. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
2622. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
2623. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
2624. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
2625. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
2626. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
2627. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
2628. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
2629. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
2630. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
2631. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
2632. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
2633. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
2634. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
2635. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
2636. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
2637. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
2638. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
2639. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
2640. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
2641. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
2642. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
2643. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
2644. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
2645. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
2646. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
2647. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
2648. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
2649. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
2650. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
2651. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
2652. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
2653. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
2654. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
2655. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
2656. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
2657. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
2658. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
2659. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
2660. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
2661. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
2662. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
2663. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
2664. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
2665. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
2666. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
2667. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
2668. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
2669. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
2670. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
2671. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
2672. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
2673. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
2674. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
2675. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
2676. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
2677. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
2678. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
2679. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
2680. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
2681. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
2682. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
2683. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
2684. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
2685. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
2686. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
2687. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
2688. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
2689. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
2690. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
2691. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
2692. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
2693. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
2694. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
2695. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
2696. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
2697. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
2698. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
2699. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
2700. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
2701. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
2702. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
2703. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
2704. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
2705. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
2706. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
2707. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
2708. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
2709. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
2710. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
2711. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
2712. gbpri1.seq - Primate sequence entries, part 1.
2713. gbpri10.seq - Primate sequence entries, part 10.
2714. gbpri11.seq - Primate sequence entries, part 11.
2715. gbpri12.seq - Primate sequence entries, part 12.
2716. gbpri13.seq - Primate sequence entries, part 13.
2717. gbpri14.seq - Primate sequence entries, part 14.
2718. gbpri15.seq - Primate sequence entries, part 15.
2719. gbpri16.seq - Primate sequence entries, part 16.
2720. gbpri17.seq - Primate sequence entries, part 17.
2721. gbpri18.seq - Primate sequence entries, part 18.
2722. gbpri19.seq - Primate sequence entries, part 19.
2723. gbpri2.seq - Primate sequence entries, part 2.
2724. gbpri20.seq - Primate sequence entries, part 20.
2725. gbpri21.seq - Primate sequence entries, part 21.
2726. gbpri22.seq - Primate sequence entries, part 22.
2727. gbpri23.seq - Primate sequence entries, part 23.
2728. gbpri24.seq - Primate sequence entries, part 24.
2729. gbpri25.seq - Primate sequence entries, part 25.
2730. gbpri26.seq - Primate sequence entries, part 26.
2731. gbpri27.seq - Primate sequence entries, part 27.
2732. gbpri28.seq - Primate sequence entries, part 28.
2733. gbpri29.seq - Primate sequence entries, part 29.
2734. gbpri3.seq - Primate sequence entries, part 3.
2735. gbpri30.seq - Primate sequence entries, part 30.
2736. gbpri31.seq - Primate sequence entries, part 31.
2737. gbpri32.seq - Primate sequence entries, part 32.
2738. gbpri33.seq - Primate sequence entries, part 33.
2739. gbpri34.seq - Primate sequence entries, part 34.
2740. gbpri35.seq - Primate sequence entries, part 35.
2741. gbpri36.seq - Primate sequence entries, part 36.
2742. gbpri37.seq - Primate sequence entries, part 37.
2743. gbpri38.seq - Primate sequence entries, part 38.
2744. gbpri39.seq - Primate sequence entries, part 39.
2745. gbpri4.seq - Primate sequence entries, part 4.
2746. gbpri40.seq - Primate sequence entries, part 40.
2747. gbpri41.seq - Primate sequence entries, part 41.
2748. gbpri42.seq - Primate sequence entries, part 42.
2749. gbpri43.seq - Primate sequence entries, part 43.
2750. gbpri44.seq - Primate sequence entries, part 44.
2751. gbpri45.seq - Primate sequence entries, part 45.
2752. gbpri5.seq - Primate sequence entries, part 5.
2753. gbpri6.seq - Primate sequence entries, part 6.
2754. gbpri7.seq - Primate sequence entries, part 7.
2755. gbpri8.seq - Primate sequence entries, part 8.
2756. gbpri9.seq - Primate sequence entries, part 9.
2757. gbrel.txt - Release notes (this document).
2758. gbrod1.seq - Rodent sequence entries, part 1.
2759. gbrod10.seq - Rodent sequence entries, part 10.
2760. gbrod11.seq - Rodent sequence entries, part 11.
2761. gbrod12.seq - Rodent sequence entries, part 12.
2762. gbrod13.seq - Rodent sequence entries, part 13.
2763. gbrod14.seq - Rodent sequence entries, part 14.
2764. gbrod15.seq - Rodent sequence entries, part 15.
2765. gbrod16.seq - Rodent sequence entries, part 16.
2766. gbrod17.seq - Rodent sequence entries, part 17.
2767. gbrod18.seq - Rodent sequence entries, part 18.
2768. gbrod19.seq - Rodent sequence entries, part 19.
2769. gbrod2.seq - Rodent sequence entries, part 2.
2770. gbrod20.seq - Rodent sequence entries, part 20.
2771. gbrod21.seq - Rodent sequence entries, part 21.
2772. gbrod22.seq - Rodent sequence entries, part 22.
2773. gbrod23.seq - Rodent sequence entries, part 23.
2774. gbrod24.seq - Rodent sequence entries, part 24.
2775. gbrod25.seq - Rodent sequence entries, part 25.
2776. gbrod26.seq - Rodent sequence entries, part 26.
2777. gbrod27.seq - Rodent sequence entries, part 27.
2778. gbrod28.seq - Rodent sequence entries, part 28.
2779. gbrod29.seq - Rodent sequence entries, part 29.
2780. gbrod3.seq - Rodent sequence entries, part 3.
2781. gbrod30.seq - Rodent sequence entries, part 30.
2782. gbrod31.seq - Rodent sequence entries, part 31.
2783. gbrod32.seq - Rodent sequence entries, part 32.
2784. gbrod33.seq - Rodent sequence entries, part 33.
2785. gbrod34.seq - Rodent sequence entries, part 34.
2786. gbrod35.seq - Rodent sequence entries, part 35.
2787. gbrod36.seq - Rodent sequence entries, part 36.
2788. gbrod37.seq - Rodent sequence entries, part 37.
2789. gbrod38.seq - Rodent sequence entries, part 38.
2790. gbrod39.seq - Rodent sequence entries, part 39.
2791. gbrod4.seq - Rodent sequence entries, part 4.
2792. gbrod40.seq - Rodent sequence entries, part 40.
2793. gbrod41.seq - Rodent sequence entries, part 41.
2794. gbrod42.seq - Rodent sequence entries, part 42.
2795. gbrod43.seq - Rodent sequence entries, part 43.
2796. gbrod44.seq - Rodent sequence entries, part 44.
2797. gbrod45.seq - Rodent sequence entries, part 45.
2798. gbrod46.seq - Rodent sequence entries, part 46.
2799. gbrod47.seq - Rodent sequence entries, part 47.
2800. gbrod48.seq - Rodent sequence entries, part 48.
2801. gbrod49.seq - Rodent sequence entries, part 49.
2802. gbrod5.seq - Rodent sequence entries, part 5.
2803. gbrod50.seq - Rodent sequence entries, part 50.
2804. gbrod51.seq - Rodent sequence entries, part 51.
2805. gbrod52.seq - Rodent sequence entries, part 52.
2806. gbrod53.seq - Rodent sequence entries, part 53.
2807. gbrod54.seq - Rodent sequence entries, part 54.
2808. gbrod55.seq - Rodent sequence entries, part 55.
2809. gbrod56.seq - Rodent sequence entries, part 56.
2810. gbrod6.seq - Rodent sequence entries, part 6.
2811. gbrod7.seq - Rodent sequence entries, part 7.
2812. gbrod8.seq - Rodent sequence entries, part 8.
2813. gbrod9.seq - Rodent sequence entries, part 9.
2814. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
2815. gbsts10.seq - STS (sequence tagged site) sequence entries, part 10.
2816. gbsts11.seq - STS (sequence tagged site) sequence entries, part 11.
2817. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
2818. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
2819. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
2820. gbsts5.seq - STS (sequence tagged site) sequence entries, part 5.
2821. gbsts6.seq - STS (sequence tagged site) sequence entries, part 6.
2822. gbsts7.seq - STS (sequence tagged site) sequence entries, part 7.
2823. gbsts8.seq - STS (sequence tagged site) sequence entries, part 8.
2824. gbsts9.seq - STS (sequence tagged site) sequence entries, part 9.
2825. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
2826. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
2827. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
2828. gbsyn12.seq - Synthetic and chimeric sequence entries, part 12.
2829. gbsyn13.seq - Synthetic and chimeric sequence entries, part 13.
2830. gbsyn14.seq - Synthetic and chimeric sequence entries, part 14.
2831. gbsyn15.seq - Synthetic and chimeric sequence entries, part 15.
2832. gbsyn16.seq - Synthetic and chimeric sequence entries, part 16.
2833. gbsyn17.seq - Synthetic and chimeric sequence entries, part 17.
2834. gbsyn18.seq - Synthetic and chimeric sequence entries, part 18.
2835. gbsyn19.seq - Synthetic and chimeric sequence entries, part 19.
2836. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
2837. gbsyn20.seq - Synthetic and chimeric sequence entries, part 20.
2838. gbsyn21.seq - Synthetic and chimeric sequence entries, part 21.
2839. gbsyn22.seq - Synthetic and chimeric sequence entries, part 22.
2840. gbsyn23.seq - Synthetic and chimeric sequence entries, part 23.
2841. gbsyn24.seq - Synthetic and chimeric sequence entries, part 24.
2842. gbsyn25.seq - Synthetic and chimeric sequence entries, part 25.
2843. gbsyn26.seq - Synthetic and chimeric sequence entries, part 26.
2844. gbsyn27.seq - Synthetic and chimeric sequence entries, part 27.
2845. gbsyn28.seq - Synthetic and chimeric sequence entries, part 28.
2846. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
2847. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
2848. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
2849. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
2850. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
2851. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
2852. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
2853. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
2854. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
2855. gbtsa100.seq - TSA (transcriptome shotgun assembly) sequence entries, part 100.
2856. gbtsa101.seq - TSA (transcriptome shotgun assembly) sequence entries, part 101.
2857. gbtsa102.seq - TSA (transcriptome shotgun assembly) sequence entries, part 102.
2858. gbtsa103.seq - TSA (transcriptome shotgun assembly) sequence entries, part 103.
2859. gbtsa104.seq - TSA (transcriptome shotgun assembly) sequence entries, part 104.
2860. gbtsa105.seq - TSA (transcriptome shotgun assembly) sequence entries, part 105.
2861. gbtsa106.seq - TSA (transcriptome shotgun assembly) sequence entries, part 106.
2862. gbtsa107.seq - TSA (transcriptome shotgun assembly) sequence entries, part 107.
2863. gbtsa108.seq - TSA (transcriptome shotgun assembly) sequence entries, part 108.
2864. gbtsa109.seq - TSA (transcriptome shotgun assembly) sequence entries, part 109.
2865. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
2866. gbtsa110.seq - TSA (transcriptome shotgun assembly) sequence entries, part 110.
2867. gbtsa111.seq - TSA (transcriptome shotgun assembly) sequence entries, part 111.
2868. gbtsa112.seq - TSA (transcriptome shotgun assembly) sequence entries, part 112.
2869. gbtsa113.seq - TSA (transcriptome shotgun assembly) sequence entries, part 113.
2870. gbtsa114.seq - TSA (transcriptome shotgun assembly) sequence entries, part 114.
2871. gbtsa115.seq - TSA (transcriptome shotgun assembly) sequence entries, part 115.
2872. gbtsa116.seq - TSA (transcriptome shotgun assembly) sequence entries, part 116.
2873. gbtsa117.seq - TSA (transcriptome shotgun assembly) sequence entries, part 117.
2874. gbtsa118.seq - TSA (transcriptome shotgun assembly) sequence entries, part 118.
2875. gbtsa119.seq - TSA (transcriptome shotgun assembly) sequence entries, part 119.
2876. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
2877. gbtsa120.seq - TSA (transcriptome shotgun assembly) sequence entries, part 120.
2878. gbtsa121.seq - TSA (transcriptome shotgun assembly) sequence entries, part 121.
2879. gbtsa122.seq - TSA (transcriptome shotgun assembly) sequence entries, part 122.
2880. gbtsa123.seq - TSA (transcriptome shotgun assembly) sequence entries, part 123.
2881. gbtsa124.seq - TSA (transcriptome shotgun assembly) sequence entries, part 124.
2882. gbtsa125.seq - TSA (transcriptome shotgun assembly) sequence entries, part 125.
2883. gbtsa126.seq - TSA (transcriptome shotgun assembly) sequence entries, part 126.
2884. gbtsa127.seq - TSA (transcriptome shotgun assembly) sequence entries, part 127.
2885. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
2886. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
2887. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
2888. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
2889. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
2890. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
2891. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
2892. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
2893. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
2894. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
2895. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
2896. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
2897. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
2898. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
2899. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
2900. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
2901. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
2902. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
2903. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
2904. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
2905. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
2906. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
2907. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
2908. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
2909. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
2910. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
2911. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
2912. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
2913. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
2914. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
2915. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
2916. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
2917. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
2918. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
2919. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
2920. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
2921. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
2922. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
2923. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
2924. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
2925. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
2926. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
2927. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
2928. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
2929. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
2930. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
2931. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
2932. gbtsa56.seq - TSA (transcriptome shotgun assembly) sequence entries, part 56.
2933. gbtsa57.seq - TSA (transcriptome shotgun assembly) sequence entries, part 57.
2934. gbtsa58.seq - TSA (transcriptome shotgun assembly) sequence entries, part 58.
2935. gbtsa59.seq - TSA (transcriptome shotgun assembly) sequence entries, part 59.
2936. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
2937. gbtsa60.seq - TSA (transcriptome shotgun assembly) sequence entries, part 60.
2938. gbtsa61.seq - TSA (transcriptome shotgun assembly) sequence entries, part 61.
2939. gbtsa62.seq - TSA (transcriptome shotgun assembly) sequence entries, part 62.
2940. gbtsa63.seq - TSA (transcriptome shotgun assembly) sequence entries, part 63.
2941. gbtsa64.seq - TSA (transcriptome shotgun assembly) sequence entries, part 64.
2942. gbtsa65.seq - TSA (transcriptome shotgun assembly) sequence entries, part 65.
2943. gbtsa66.seq - TSA (transcriptome shotgun assembly) sequence entries, part 66.
2944. gbtsa67.seq - TSA (transcriptome shotgun assembly) sequence entries, part 67.
2945. gbtsa68.seq - TSA (transcriptome shotgun assembly) sequence entries, part 68.
2946. gbtsa69.seq - TSA (transcriptome shotgun assembly) sequence entries, part 69.
2947. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
2948. gbtsa70.seq - TSA (transcriptome shotgun assembly) sequence entries, part 70.
2949. gbtsa71.seq - TSA (transcriptome shotgun assembly) sequence entries, part 71.
2950. gbtsa72.seq - TSA (transcriptome shotgun assembly) sequence entries, part 72.
2951. gbtsa73.seq - TSA (transcriptome shotgun assembly) sequence entries, part 73.
2952. gbtsa74.seq - TSA (transcriptome shotgun assembly) sequence entries, part 74.
2953. gbtsa75.seq - TSA (transcriptome shotgun assembly) sequence entries, part 75.
2954. gbtsa76.seq - TSA (transcriptome shotgun assembly) sequence entries, part 76.
2955. gbtsa77.seq - TSA (transcriptome shotgun assembly) sequence entries, part 77.
2956. gbtsa78.seq - TSA (transcriptome shotgun assembly) sequence entries, part 78.
2957. gbtsa79.seq - TSA (transcriptome shotgun assembly) sequence entries, part 79.
2958. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
2959. gbtsa80.seq - TSA (transcriptome shotgun assembly) sequence entries, part 80.
2960. gbtsa81.seq - TSA (transcriptome shotgun assembly) sequence entries, part 81.
2961. gbtsa82.seq - TSA (transcriptome shotgun assembly) sequence entries, part 82.
2962. gbtsa83.seq - TSA (transcriptome shotgun assembly) sequence entries, part 83.
2963. gbtsa84.seq - TSA (transcriptome shotgun assembly) sequence entries, part 84.
2964. gbtsa85.seq - TSA (transcriptome shotgun assembly) sequence entries, part 85.
2965. gbtsa86.seq - TSA (transcriptome shotgun assembly) sequence entries, part 86.
2966. gbtsa87.seq - TSA (transcriptome shotgun assembly) sequence entries, part 87.
2967. gbtsa88.seq - TSA (transcriptome shotgun assembly) sequence entries, part 88.
2968. gbtsa89.seq - TSA (transcriptome shotgun assembly) sequence entries, part 89.
2969. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
2970. gbtsa90.seq - TSA (transcriptome shotgun assembly) sequence entries, part 90.
2971. gbtsa91.seq - TSA (transcriptome shotgun assembly) sequence entries, part 91.
2972. gbtsa92.seq - TSA (transcriptome shotgun assembly) sequence entries, part 92.
2973. gbtsa93.seq - TSA (transcriptome shotgun assembly) sequence entries, part 93.
2974. gbtsa94.seq - TSA (transcriptome shotgun assembly) sequence entries, part 94.
2975. gbtsa95.seq - TSA (transcriptome shotgun assembly) sequence entries, part 95.
2976. gbtsa96.seq - TSA (transcriptome shotgun assembly) sequence entries, part 96.
2977. gbtsa97.seq - TSA (transcriptome shotgun assembly) sequence entries, part 97.
2978. gbtsa98.seq - TSA (transcriptome shotgun assembly) sequence entries, part 98.
2979. gbtsa99.seq - TSA (transcriptome shotgun assembly) sequence entries, part 99.
2980. gbuna1.seq - Unannotated sequence entries, part 1.
2981. gbvrl1.seq - Viral sequence entries, part 1.
2982. gbvrl10.seq - Viral sequence entries, part 10.
2983. gbvrl11.seq - Viral sequence entries, part 11.
2984. gbvrl12.seq - Viral sequence entries, part 12.
2985. gbvrl13.seq - Viral sequence entries, part 13.
2986. gbvrl14.seq - Viral sequence entries, part 14.
2987. gbvrl15.seq - Viral sequence entries, part 15.
2988. gbvrl16.seq - Viral sequence entries, part 16.
2989. gbvrl17.seq - Viral sequence entries, part 17.
2990. gbvrl18.seq - Viral sequence entries, part 18.
2991. gbvrl19.seq - Viral sequence entries, part 19.
2992. gbvrl2.seq - Viral sequence entries, part 2.
2993. gbvrl20.seq - Viral sequence entries, part 20.
2994. gbvrl21.seq - Viral sequence entries, part 21.
2995. gbvrl22.seq - Viral sequence entries, part 22.
2996. gbvrl23.seq - Viral sequence entries, part 23.
2997. gbvrl24.seq - Viral sequence entries, part 24.
2998. gbvrl25.seq - Viral sequence entries, part 25.
2999. gbvrl26.seq - Viral sequence entries, part 26.
3000. gbvrl27.seq - Viral sequence entries, part 27.
3001. gbvrl28.seq - Viral sequence entries, part 28.
3002. gbvrl29.seq - Viral sequence entries, part 29.
3003. gbvrl3.seq - Viral sequence entries, part 3.
3004. gbvrl30.seq - Viral sequence entries, part 30.
3005. gbvrl31.seq - Viral sequence entries, part 31.
3006. gbvrl32.seq - Viral sequence entries, part 32.
3007. gbvrl33.seq - Viral sequence entries, part 33.
3008. gbvrl34.seq - Viral sequence entries, part 34.
3009. gbvrl35.seq - Viral sequence entries, part 35.
3010. gbvrl36.seq - Viral sequence entries, part 36.
3011. gbvrl37.seq - Viral sequence entries, part 37.
3012. gbvrl38.seq - Viral sequence entries, part 38.
3013. gbvrl39.seq - Viral sequence entries, part 39.
3014. gbvrl4.seq - Viral sequence entries, part 4.
3015. gbvrl40.seq - Viral sequence entries, part 40.
3016. gbvrl41.seq - Viral sequence entries, part 41.
3017. gbvrl42.seq - Viral sequence entries, part 42.
3018. gbvrl43.seq - Viral sequence entries, part 43.
3019. gbvrl44.seq - Viral sequence entries, part 44.
3020. gbvrl5.seq - Viral sequence entries, part 5.
3021. gbvrl6.seq - Viral sequence entries, part 6.
3022. gbvrl7.seq - Viral sequence entries, part 7.
3023. gbvrl8.seq - Viral sequence entries, part 8.
3024. gbvrl9.seq - Viral sequence entries, part 9.
3025. gbvrt1.seq - Other vertebrate sequence entries, part 1.
3026. gbvrt10.seq - Other vertebrate sequence entries, part 10.
3027. gbvrt100.seq - Other vertebrate sequence entries, part 100.
3028. gbvrt101.seq - Other vertebrate sequence entries, part 101.
3029. gbvrt102.seq - Other vertebrate sequence entries, part 102.
3030. gbvrt103.seq - Other vertebrate sequence entries, part 103.
3031. gbvrt104.seq - Other vertebrate sequence entries, part 104.
3032. gbvrt105.seq - Other vertebrate sequence entries, part 105.
3033. gbvrt106.seq - Other vertebrate sequence entries, part 106.
3034. gbvrt107.seq - Other vertebrate sequence entries, part 107.
3035. gbvrt108.seq - Other vertebrate sequence entries, part 108.
3036. gbvrt109.seq - Other vertebrate sequence entries, part 109.
3037. gbvrt11.seq - Other vertebrate sequence entries, part 11.
3038. gbvrt110.seq - Other vertebrate sequence entries, part 110.
3039. gbvrt111.seq - Other vertebrate sequence entries, part 111.
3040. gbvrt112.seq - Other vertebrate sequence entries, part 112.
3041. gbvrt113.seq - Other vertebrate sequence entries, part 113.
3042. gbvrt114.seq - Other vertebrate sequence entries, part 114.
3043. gbvrt115.seq - Other vertebrate sequence entries, part 115.
3044. gbvrt116.seq - Other vertebrate sequence entries, part 116.
3045. gbvrt117.seq - Other vertebrate sequence entries, part 117.
3046. gbvrt118.seq - Other vertebrate sequence entries, part 118.
3047. gbvrt119.seq - Other vertebrate sequence entries, part 119.
3048. gbvrt12.seq - Other vertebrate sequence entries, part 12.
3049. gbvrt120.seq - Other vertebrate sequence entries, part 120.
3050. gbvrt121.seq - Other vertebrate sequence entries, part 121.
3051. gbvrt122.seq - Other vertebrate sequence entries, part 122.
3052. gbvrt123.seq - Other vertebrate sequence entries, part 123.
3053. gbvrt124.seq - Other vertebrate sequence entries, part 124.
3054. gbvrt125.seq - Other vertebrate sequence entries, part 125.
3055. gbvrt126.seq - Other vertebrate sequence entries, part 126.
3056. gbvrt127.seq - Other vertebrate sequence entries, part 127.
3057. gbvrt128.seq - Other vertebrate sequence entries, part 128.
3058. gbvrt129.seq - Other vertebrate sequence entries, part 129.
3059. gbvrt13.seq - Other vertebrate sequence entries, part 13.
3060. gbvrt130.seq - Other vertebrate sequence entries, part 130.
3061. gbvrt131.seq - Other vertebrate sequence entries, part 131.
3062. gbvrt132.seq - Other vertebrate sequence entries, part 132.
3063. gbvrt133.seq - Other vertebrate sequence entries, part 133.
3064. gbvrt134.seq - Other vertebrate sequence entries, part 134.
3065. gbvrt135.seq - Other vertebrate sequence entries, part 135.
3066. gbvrt136.seq - Other vertebrate sequence entries, part 136.
3067. gbvrt137.seq - Other vertebrate sequence entries, part 137.
3068. gbvrt138.seq - Other vertebrate sequence entries, part 138.
3069. gbvrt139.seq - Other vertebrate sequence entries, part 139.
3070. gbvrt14.seq - Other vertebrate sequence entries, part 14.
3071. gbvrt140.seq - Other vertebrate sequence entries, part 140.
3072. gbvrt141.seq - Other vertebrate sequence entries, part 141.
3073. gbvrt142.seq - Other vertebrate sequence entries, part 142.
3074. gbvrt143.seq - Other vertebrate sequence entries, part 143.
3075. gbvrt144.seq - Other vertebrate sequence entries, part 144.
3076. gbvrt145.seq - Other vertebrate sequence entries, part 145.
3077. gbvrt146.seq - Other vertebrate sequence entries, part 146.
3078. gbvrt147.seq - Other vertebrate sequence entries, part 147.
3079. gbvrt148.seq - Other vertebrate sequence entries, part 148.
3080. gbvrt149.seq - Other vertebrate sequence entries, part 149.
3081. gbvrt15.seq - Other vertebrate sequence entries, part 15.
3082. gbvrt150.seq - Other vertebrate sequence entries, part 150.
3083. gbvrt151.seq - Other vertebrate sequence entries, part 151.
3084. gbvrt152.seq - Other vertebrate sequence entries, part 152.
3085. gbvrt153.seq - Other vertebrate sequence entries, part 153.
3086. gbvrt154.seq - Other vertebrate sequence entries, part 154.
3087. gbvrt155.seq - Other vertebrate sequence entries, part 155.
3088. gbvrt156.seq - Other vertebrate sequence entries, part 156.
3089. gbvrt157.seq - Other vertebrate sequence entries, part 157.
3090. gbvrt158.seq - Other vertebrate sequence entries, part 158.
3091. gbvrt159.seq - Other vertebrate sequence entries, part 159.
3092. gbvrt16.seq - Other vertebrate sequence entries, part 16.
3093. gbvrt160.seq - Other vertebrate sequence entries, part 160.
3094. gbvrt161.seq - Other vertebrate sequence entries, part 161.
3095. gbvrt162.seq - Other vertebrate sequence entries, part 162.
3096. gbvrt163.seq - Other vertebrate sequence entries, part 163.
3097. gbvrt164.seq - Other vertebrate sequence entries, part 164.
3098. gbvrt165.seq - Other vertebrate sequence entries, part 165.
3099. gbvrt166.seq - Other vertebrate sequence entries, part 166.
3100. gbvrt167.seq - Other vertebrate sequence entries, part 167.
3101. gbvrt168.seq - Other vertebrate sequence entries, part 168.
3102. gbvrt169.seq - Other vertebrate sequence entries, part 169.
3103. gbvrt17.seq - Other vertebrate sequence entries, part 17.
3104. gbvrt170.seq - Other vertebrate sequence entries, part 170.
3105. gbvrt171.seq - Other vertebrate sequence entries, part 171.
3106. gbvrt172.seq - Other vertebrate sequence entries, part 172.
3107. gbvrt173.seq - Other vertebrate sequence entries, part 173.
3108. gbvrt174.seq - Other vertebrate sequence entries, part 174.
3109. gbvrt175.seq - Other vertebrate sequence entries, part 175.
3110. gbvrt176.seq - Other vertebrate sequence entries, part 176.
3111. gbvrt177.seq - Other vertebrate sequence entries, part 177.
3112. gbvrt178.seq - Other vertebrate sequence entries, part 178.
3113. gbvrt179.seq - Other vertebrate sequence entries, part 179.
3114. gbvrt18.seq - Other vertebrate sequence entries, part 18.
3115. gbvrt180.seq - Other vertebrate sequence entries, part 180.
3116. gbvrt181.seq - Other vertebrate sequence entries, part 181.
3117. gbvrt182.seq - Other vertebrate sequence entries, part 182.
3118. gbvrt183.seq - Other vertebrate sequence entries, part 183.
3119. gbvrt184.seq - Other vertebrate sequence entries, part 184.
3120. gbvrt185.seq - Other vertebrate sequence entries, part 185.
3121. gbvrt186.seq - Other vertebrate sequence entries, part 186.
3122. gbvrt187.seq - Other vertebrate sequence entries, part 187.
3123. gbvrt188.seq - Other vertebrate sequence entries, part 188.
3124. gbvrt189.seq - Other vertebrate sequence entries, part 189.
3125. gbvrt19.seq - Other vertebrate sequence entries, part 19.
3126. gbvrt190.seq - Other vertebrate sequence entries, part 190.
3127. gbvrt191.seq - Other vertebrate sequence entries, part 191.
3128. gbvrt192.seq - Other vertebrate sequence entries, part 192.
3129. gbvrt193.seq - Other vertebrate sequence entries, part 193.
3130. gbvrt194.seq - Other vertebrate sequence entries, part 194.
3131. gbvrt195.seq - Other vertebrate sequence entries, part 195.
3132. gbvrt196.seq - Other vertebrate sequence entries, part 196.
3133. gbvrt197.seq - Other vertebrate sequence entries, part 197.
3134. gbvrt198.seq - Other vertebrate sequence entries, part 198.
3135. gbvrt199.seq - Other vertebrate sequence entries, part 199.
3136. gbvrt2.seq - Other vertebrate sequence entries, part 2.
3137. gbvrt20.seq - Other vertebrate sequence entries, part 20.
3138. gbvrt200.seq - Other vertebrate sequence entries, part 200.
3139. gbvrt201.seq - Other vertebrate sequence entries, part 201.
3140. gbvrt202.seq - Other vertebrate sequence entries, part 202.
3141. gbvrt203.seq - Other vertebrate sequence entries, part 203.
3142. gbvrt204.seq - Other vertebrate sequence entries, part 204.
3143. gbvrt205.seq - Other vertebrate sequence entries, part 205.
3144. gbvrt206.seq - Other vertebrate sequence entries, part 206.
3145. gbvrt207.seq - Other vertebrate sequence entries, part 207.
3146. gbvrt208.seq - Other vertebrate sequence entries, part 208.
3147. gbvrt209.seq - Other vertebrate sequence entries, part 209.
3148. gbvrt21.seq - Other vertebrate sequence entries, part 21.
3149. gbvrt210.seq - Other vertebrate sequence entries, part 210.
3150. gbvrt211.seq - Other vertebrate sequence entries, part 211.
3151. gbvrt212.seq - Other vertebrate sequence entries, part 212.
3152. gbvrt213.seq - Other vertebrate sequence entries, part 213.
3153. gbvrt214.seq - Other vertebrate sequence entries, part 214.
3154. gbvrt22.seq - Other vertebrate sequence entries, part 22.
3155. gbvrt23.seq - Other vertebrate sequence entries, part 23.
3156. gbvrt24.seq - Other vertebrate sequence entries, part 24.
3157. gbvrt25.seq - Other vertebrate sequence entries, part 25.
3158. gbvrt26.seq - Other vertebrate sequence entries, part 26.
3159. gbvrt27.seq - Other vertebrate sequence entries, part 27.
3160. gbvrt28.seq - Other vertebrate sequence entries, part 28.
3161. gbvrt29.seq - Other vertebrate sequence entries, part 29.
3162. gbvrt3.seq - Other vertebrate sequence entries, part 3.
3163. gbvrt30.seq - Other vertebrate sequence entries, part 30.
3164. gbvrt31.seq - Other vertebrate sequence entries, part 31.
3165. gbvrt32.seq - Other vertebrate sequence entries, part 32.
3166. gbvrt33.seq - Other vertebrate sequence entries, part 33.
3167. gbvrt34.seq - Other vertebrate sequence entries, part 34.
3168. gbvrt35.seq - Other vertebrate sequence entries, part 35.
3169. gbvrt36.seq - Other vertebrate sequence entries, part 36.
3170. gbvrt37.seq - Other vertebrate sequence entries, part 37.
3171. gbvrt38.seq - Other vertebrate sequence entries, part 38.
3172. gbvrt39.seq - Other vertebrate sequence entries, part 39.
3173. gbvrt4.seq - Other vertebrate sequence entries, part 4.
3174. gbvrt40.seq - Other vertebrate sequence entries, part 40.
3175. gbvrt41.seq - Other vertebrate sequence entries, part 41.
3176. gbvrt42.seq - Other vertebrate sequence entries, part 42.
3177. gbvrt43.seq - Other vertebrate sequence entries, part 43.
3178. gbvrt44.seq - Other vertebrate sequence entries, part 44.
3179. gbvrt45.seq - Other vertebrate sequence entries, part 45.
3180. gbvrt46.seq - Other vertebrate sequence entries, part 46.
3181. gbvrt47.seq - Other vertebrate sequence entries, part 47.
3182. gbvrt48.seq - Other vertebrate sequence entries, part 48.
3183. gbvrt49.seq - Other vertebrate sequence entries, part 49.
3184. gbvrt5.seq - Other vertebrate sequence entries, part 5.
3185. gbvrt50.seq - Other vertebrate sequence entries, part 50.
3186. gbvrt51.seq - Other vertebrate sequence entries, part 51.
3187. gbvrt52.seq - Other vertebrate sequence entries, part 52.
3188. gbvrt53.seq - Other vertebrate sequence entries, part 53.
3189. gbvrt54.seq - Other vertebrate sequence entries, part 54.
3190. gbvrt55.seq - Other vertebrate sequence entries, part 55.
3191. gbvrt56.seq - Other vertebrate sequence entries, part 56.
3192. gbvrt57.seq - Other vertebrate sequence entries, part 57.
3193. gbvrt58.seq - Other vertebrate sequence entries, part 58.
3194. gbvrt59.seq - Other vertebrate sequence entries, part 59.
3195. gbvrt6.seq - Other vertebrate sequence entries, part 6.
3196. gbvrt60.seq - Other vertebrate sequence entries, part 60.
3197. gbvrt61.seq - Other vertebrate sequence entries, part 61.
3198. gbvrt62.seq - Other vertebrate sequence entries, part 62.
3199. gbvrt63.seq - Other vertebrate sequence entries, part 63.
3200. gbvrt64.seq - Other vertebrate sequence entries, part 64.
3201. gbvrt65.seq - Other vertebrate sequence entries, part 65.
3202. gbvrt66.seq - Other vertebrate sequence entries, part 66.
3203. gbvrt67.seq - Other vertebrate sequence entries, part 67.
3204. gbvrt68.seq - Other vertebrate sequence entries, part 68.
3205. gbvrt69.seq - Other vertebrate sequence entries, part 69.
3206. gbvrt7.seq - Other vertebrate sequence entries, part 7.
3207. gbvrt70.seq - Other vertebrate sequence entries, part 70.
3208. gbvrt71.seq - Other vertebrate sequence entries, part 71.
3209. gbvrt72.seq - Other vertebrate sequence entries, part 72.
3210. gbvrt73.seq - Other vertebrate sequence entries, part 73.
3211. gbvrt74.seq - Other vertebrate sequence entries, part 74.
3212. gbvrt75.seq - Other vertebrate sequence entries, part 75.
3213. gbvrt76.seq - Other vertebrate sequence entries, part 76.
3214. gbvrt77.seq - Other vertebrate sequence entries, part 77.
3215. gbvrt78.seq - Other vertebrate sequence entries, part 78.
3216. gbvrt79.seq - Other vertebrate sequence entries, part 79.
3217. gbvrt8.seq - Other vertebrate sequence entries, part 8.
3218. gbvrt80.seq - Other vertebrate sequence entries, part 80.
3219. gbvrt81.seq - Other vertebrate sequence entries, part 81.
3220. gbvrt82.seq - Other vertebrate sequence entries, part 82.
3221. gbvrt83.seq - Other vertebrate sequence entries, part 83.
3222. gbvrt84.seq - Other vertebrate sequence entries, part 84.
3223. gbvrt85.seq - Other vertebrate sequence entries, part 85.
3224. gbvrt86.seq - Other vertebrate sequence entries, part 86.
3225. gbvrt87.seq - Other vertebrate sequence entries, part 87.
3226. gbvrt88.seq - Other vertebrate sequence entries, part 88.
3227. gbvrt89.seq - Other vertebrate sequence entries, part 89.
3228. gbvrt9.seq - Other vertebrate sequence entries, part 9.
3229. gbvrt90.seq - Other vertebrate sequence entries, part 90.
3230. gbvrt91.seq - Other vertebrate sequence entries, part 91.
3231. gbvrt92.seq - Other vertebrate sequence entries, part 92.
3232. gbvrt93.seq - Other vertebrate sequence entries, part 93.
3233. gbvrt94.seq - Other vertebrate sequence entries, part 94.
3234. gbvrt95.seq - Other vertebrate sequence entries, part 95.
3235. gbvrt96.seq - Other vertebrate sequence entries, part 96.
3236. gbvrt97.seq - Other vertebrate sequence entries, part 97.
3237. gbvrt98.seq - Other vertebrate sequence entries, part 98.
3238. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 240.0 flatfiles require roughly 1524 GB, including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

 499041667     gbbct1.seq
 487478217     gbbct10.seq
 494745395     gbbct100.seq
 495416548     gbbct101.seq
 491069716     gbbct102.seq
 195549944     gbbct103.seq
 494137426     gbbct104.seq
 492528796     gbbct105.seq
 493221798     gbbct106.seq
 496768213     gbbct107.seq
  99480363     gbbct108.seq
 499009965     gbbct109.seq
 499351621     gbbct11.seq
 494100520     gbbct110.seq
 498830058     gbbct111.seq
 333064214     gbbct112.seq
 499522605     gbbct113.seq
 493011387     gbbct114.seq
 496289463     gbbct115.seq
 426871456     gbbct116.seq
 491212955     gbbct117.seq
 489083376     gbbct118.seq
 487156049     gbbct119.seq
 488016939     gbbct12.seq
 499721398     gbbct120.seq
 490720930     gbbct121.seq
 487897214     gbbct122.seq
 407731566     gbbct123.seq
 498287206     gbbct124.seq
 489447997     gbbct125.seq
 499733988     gbbct126.seq
 461301736     gbbct127.seq
 495776406     gbbct128.seq
 493829169     gbbct129.seq
 499887187     gbbct13.seq
 491368404     gbbct130.seq
 498684861     gbbct131.seq
 499805922     gbbct132.seq
 147979133     gbbct133.seq
 496895924     gbbct134.seq
 497684582     gbbct135.seq
 499142526     gbbct136.seq
 497972495     gbbct137.seq
 352908324     gbbct138.seq
 489367146     gbbct139.seq
 499212940     gbbct14.seq
 490446639     gbbct140.seq
 498394330     gbbct141.seq
 497203441     gbbct142.seq
 492635253     gbbct143.seq
 341075271     gbbct144.seq
 497655827     gbbct145.seq
 494967367     gbbct146.seq
 496738611     gbbct147.seq
 489042515     gbbct148.seq
 493286965     gbbct149.seq
 498283030     gbbct15.seq
 496050645     gbbct150.seq
 159717871     gbbct151.seq
 494733672     gbbct152.seq
 491514742     gbbct153.seq
 495159360     gbbct154.seq
 475148340     gbbct155.seq
 497456210     gbbct156.seq
 493139210     gbbct157.seq
 492198324     gbbct158.seq
 490869904     gbbct159.seq
 383570666     gbbct16.seq
 490322275     gbbct160.seq
 497884705     gbbct161.seq
 498282277     gbbct162.seq
 492406540     gbbct163.seq
 148663232     gbbct164.seq
 494475952     gbbct165.seq
 492696378     gbbct166.seq
 499251741     gbbct167.seq
 260566716     gbbct168.seq
 495003668     gbbct169.seq
 499746275     gbbct17.seq
 495931454     gbbct170.seq
 489789434     gbbct171.seq
 303707273     gbbct172.seq
 499225263     gbbct173.seq
 489058156     gbbct174.seq
 491425585     gbbct175.seq
 495482221     gbbct176.seq
  34087966     gbbct177.seq
 498035669     gbbct178.seq
 497778389     gbbct179.seq
 494194652     gbbct18.seq
 496082295     gbbct180.seq
 489047044     gbbct181.seq
 498721299     gbbct182.seq
 180648099     gbbct183.seq
 497820682     gbbct184.seq
 496360837     gbbct185.seq
 494749491     gbbct186.seq
 499579814     gbbct187.seq
 265632471     gbbct188.seq
 499905891     gbbct189.seq
 495386303     gbbct19.seq
 492390539     gbbct190.seq
 499395301     gbbct191.seq
 490188991     gbbct192.seq
 176738759     gbbct193.seq
 489278133     gbbct194.seq
 499568265     gbbct195.seq
 499217765     gbbct196.seq
 498329777     gbbct197.seq
 379026941     gbbct198.seq
 499899988     gbbct199.seq
 496416169     gbbct2.seq
 396427600     gbbct20.seq
 496011357     gbbct200.seq
 481292016     gbbct201.seq
 496168474     gbbct202.seq
 495261913     gbbct203.seq
 499945625     gbbct204.seq
 304211632     gbbct205.seq
 496984978     gbbct206.seq
 497245658     gbbct207.seq
 489436589     gbbct208.seq
 372443871     gbbct209.seq
 492285759     gbbct21.seq
 484832177     gbbct210.seq
 495646047     gbbct211.seq
 499614783     gbbct212.seq
 498653795     gbbct213.seq
 213706266     gbbct214.seq
 493985776     gbbct215.seq
 489508939     gbbct216.seq
 488961009     gbbct217.seq
 165439229     gbbct218.seq
 493892096     gbbct219.seq
 496032929     gbbct22.seq
 487708561     gbbct220.seq
 498455384     gbbct221.seq
 496216461     gbbct222.seq
 103775238     gbbct223.seq
 494063240     gbbct224.seq
 488280586     gbbct225.seq
 499476913     gbbct226.seq
 498178483     gbbct227.seq
 106712552     gbbct228.seq
 495740210     gbbct229.seq
 498176736     gbbct23.seq
 491776507     gbbct230.seq
 489570461     gbbct231.seq
 446055641     gbbct232.seq
 492193681     gbbct233.seq
 487559480     gbbct234.seq
 492443429     gbbct235.seq
 457216214     gbbct236.seq
 499715727     gbbct237.seq
 495907353     gbbct238.seq
 492786262     gbbct239.seq
 498818099     gbbct24.seq
 496300832     gbbct240.seq
 499288983     gbbct241.seq
  14132066     gbbct242.seq
 491982516     gbbct243.seq
 498433809     gbbct244.seq
 499878383     gbbct245.seq
 418786364     gbbct246.seq
 499502354     gbbct247.seq
 499033572     gbbct248.seq
 493715362     gbbct249.seq
 496436375     gbbct25.seq
 433847544     gbbct250.seq
 495808325     gbbct251.seq
 498958389     gbbct252.seq
 497112537     gbbct253.seq
 495440536     gbbct254.seq
 480164754     gbbct255.seq
 497964736     gbbct256.seq
  34247232     gbbct257.seq
 497113805     gbbct258.seq
 499330158     gbbct259.seq
 110364494     gbbct26.seq
 494573507     gbbct260.seq
 495936672     gbbct261.seq
 499278591     gbbct262.seq
 495412846     gbbct263.seq
 499726650     gbbct264.seq
  70912638     gbbct265.seq
 497354988     gbbct266.seq
 497226920     gbbct267.seq
 493674802     gbbct268.seq
 494448498     gbbct269.seq
  21408837     gbbct27.seq
 493534155     gbbct270.seq
 498470559     gbbct271.seq
 498175475     gbbct272.seq
 262213969     gbbct273.seq
 499082130     gbbct274.seq
 492814264     gbbct275.seq
 488139914     gbbct276.seq
 497280072     gbbct277.seq
 483502124     gbbct278.seq
 499711579     gbbct279.seq
  38650654     gbbct28.seq
 133261472     gbbct280.seq
 488097600     gbbct281.seq
 489928610     gbbct282.seq
 492217040     gbbct283.seq
 492569249     gbbct284.seq
 314384163     gbbct285.seq
 498731908     gbbct286.seq
 495863714     gbbct287.seq
 496227091     gbbct288.seq
 496935580     gbbct289.seq
 499395888     gbbct29.seq
 387627611     gbbct290.seq
 494855490     gbbct291.seq
 494740664     gbbct292.seq
 499982432     gbbct293.seq
 489768555     gbbct294.seq
 413162427     gbbct295.seq
 494880101     gbbct296.seq
 493628648     gbbct297.seq
 495584736     gbbct298.seq
 497329828     gbbct299.seq
 301369432     gbbct3.seq
 498625804     gbbct30.seq
 346517273     gbbct300.seq
 491214887     gbbct301.seq
 497115800     gbbct302.seq
 497052456     gbbct303.seq
 494542276     gbbct304.seq
 424901308     gbbct305.seq
 494830265     gbbct306.seq
 498139328     gbbct307.seq
 498094911     gbbct308.seq
 483145079     gbbct309.seq
 493047314     gbbct31.seq
 499398769     gbbct310.seq
 499586565     gbbct311.seq
 498212167     gbbct312.seq
 116435165     gbbct313.seq
 490874381     gbbct314.seq
 499740524     gbbct315.seq
 496455106     gbbct316.seq
 492019123     gbbct317.seq
 494439250     gbbct318.seq
 496484602     gbbct319.seq
 498804282     gbbct32.seq
 498235995     gbbct320.seq
 155166785     gbbct321.seq
 488779310     gbbct322.seq
 499449317     gbbct323.seq
 489004996     gbbct324.seq
 499380134     gbbct325.seq
 494013127     gbbct326.seq
 495447288     gbbct327.seq
  89962991     gbbct328.seq
 493829341     gbbct329.seq
 140148095     gbbct33.seq
 499619330     gbbct330.seq
 488969997     gbbct331.seq
 498666326     gbbct332.seq
 305622900     gbbct333.seq
 497564814     gbbct334.seq
 499825578     gbbct335.seq
 486385015     gbbct336.seq
 499974941     gbbct337.seq
 494467844     gbbct338.seq
 499491672     gbbct339.seq
 495707202     gbbct34.seq
 450211097     gbbct340.seq
 488633025     gbbct341.seq
 495648554     gbbct342.seq
 494535306     gbbct343.seq
 498273738     gbbct344.seq
 493257814     gbbct345.seq
 491762662     gbbct346.seq
 494704156     gbbct347.seq
 335824840     gbbct348.seq
 487514339     gbbct349.seq
 495625633     gbbct35.seq
 492420293     gbbct350.seq
 488763643     gbbct351.seq
 493884603     gbbct352.seq
 497975013     gbbct353.seq
 299635400     gbbct354.seq
 497366928     gbbct355.seq
 491311901     gbbct356.seq
 493115052     gbbct357.seq
 487032490     gbbct358.seq
 492900716     gbbct359.seq
 493145663     gbbct36.seq
 391120414     gbbct360.seq
 496147429     gbbct361.seq
 499458015     gbbct362.seq
 496424524     gbbct363.seq
 494296561     gbbct364.seq
 370223948     gbbct365.seq
 495568979     gbbct366.seq
 498538890     gbbct367.seq
 496009164     gbbct368.seq
 499883171     gbbct369.seq
 488228644     gbbct37.seq
 498891181     gbbct370.seq
  19359649     gbbct371.seq
 494454660     gbbct372.seq
 497262325     gbbct373.seq
 494447335     gbbct374.seq
 498027565     gbbct375.seq
 490476692     gbbct376.seq
 256096676     gbbct377.seq
 497854228     gbbct378.seq
 498940661     gbbct379.seq
 498591614     gbbct38.seq
 499595491     gbbct380.seq
 497465436     gbbct381.seq
 494282949     gbbct382.seq
 496089026     gbbct383.seq
 497186334     gbbct384.seq
  85955499     gbbct385.seq
 494125678     gbbct386.seq
 499656845     gbbct387.seq
 499893685     gbbct388.seq
 463800234     gbbct389.seq
 498295815     gbbct39.seq
 489356479     gbbct390.seq
 492670084     gbbct391.seq
 497977002     gbbct392.seq
 476487488     gbbct393.seq
 494931735     gbbct394.seq
 499544964     gbbct395.seq
 499413448     gbbct396.seq
 494456093     gbbct397.seq
 494847828     gbbct398.seq
 474255490     gbbct399.seq
 394503873     gbbct4.seq
 102627464     gbbct40.seq
 493426836     gbbct400.seq
 489827045     gbbct401.seq
 495344725     gbbct402.seq
 499618642     gbbct403.seq
 299717925     gbbct404.seq
 499497714     gbbct405.seq
 497683392     gbbct406.seq
 494304005     gbbct407.seq
 493609952     gbbct408.seq
 208390034     gbbct409.seq
 498942361     gbbct41.seq
 493101341     gbbct410.seq
 487776363     gbbct411.seq
 499480575     gbbct412.seq
 487446396     gbbct413.seq
 496346531     gbbct414.seq
  13404219     gbbct415.seq
 494893466     gbbct416.seq
 492470523     gbbct417.seq
 495726841     gbbct418.seq
 498587532     gbbct419.seq
 483799871     gbbct42.seq
 490644479     gbbct420.seq
 494649401     gbbct421.seq
 488323919     gbbct422.seq
 497533445     gbbct423.seq
 493548787     gbbct424.seq
 499403246     gbbct425.seq
 490775893     gbbct426.seq
 457647469     gbbct427.seq
 494298014     gbbct428.seq
 493347926     gbbct429.seq
 492232330     gbbct43.seq
 495710628     gbbct430.seq
 497021336     gbbct431.seq
  27991175     gbbct432.seq
 499420139     gbbct433.seq
 494658393     gbbct434.seq
 493906911     gbbct435.seq
 496643362     gbbct436.seq
  72452934     gbbct437.seq
 496330107     gbbct438.seq
 493500842     gbbct439.seq
 498378917     gbbct44.seq
 492283530     gbbct440.seq
 496881535     gbbct441.seq
 130444639     gbbct442.seq
 490327939     gbbct443.seq
 496581187     gbbct444.seq
 497558993     gbbct445.seq
 492255141     gbbct446.seq
 499920021     gbbct447.seq
 113547589     gbbct448.seq
 305794371     gbbct449.seq
 495960857     gbbct45.seq
   6886926     gbbct450.seq
  14159259     gbbct451.seq
  22777536     gbbct452.seq
  44465308     gbbct453.seq
  86550627     gbbct454.seq
 168410170     gbbct455.seq
 499998479     gbbct456.seq
 492367276     gbbct457.seq
 499469517     gbbct458.seq
 499994017     gbbct459.seq
 487879718     gbbct46.seq
 497903390     gbbct460.seq
 499999777     gbbct461.seq
 492589566     gbbct462.seq
 499997802     gbbct463.seq
 476423489     gbbct464.seq
 499999727     gbbct465.seq
 289899830     gbbct466.seq
 499996915     gbbct467.seq
  84967230     gbbct468.seq
 499802179     gbbct469.seq
 497649661     gbbct47.seq
 124310524     gbbct470.seq
 499998284     gbbct471.seq
  42968470     gbbct472.seq
 145739320     gbbct473.seq
 499986377     gbbct474.seq
 460252321     gbbct475.seq
 497084853     gbbct476.seq
 489910774     gbbct477.seq
 493642987     gbbct478.seq
 496613467     gbbct479.seq
 491269933     gbbct48.seq
 496664926     gbbct480.seq
 491553811     gbbct481.seq
 291905641     gbbct482.seq
 495496488     gbbct483.seq
 498011253     gbbct484.seq
 498959980     gbbct485.seq
 168146271     gbbct486.seq
 483003552     gbbct487.seq
 497981383     gbbct488.seq
 498442006     gbbct489.seq
 495406623     gbbct49.seq
 499108703     gbbct490.seq
 485827478     gbbct491.seq
 495487910     gbbct492.seq
 179209411     gbbct493.seq
 496306952     gbbct494.seq
 497541934     gbbct495.seq
 499030566     gbbct496.seq
 243467681     gbbct497.seq
 492621249     gbbct498.seq
 496920774     gbbct499.seq
 459510088     gbbct5.seq
 497177991     gbbct50.seq
 498725954     gbbct500.seq
 498556272     gbbct501.seq
 105680627     gbbct502.seq
 496366345     gbbct503.seq
 489822965     gbbct504.seq
 498847564     gbbct505.seq
 457156383     gbbct506.seq
  51169602     gbbct507.seq
 107625466     gbbct508.seq
 499998468     gbbct509.seq
 499945960     gbbct51.seq
 499998270     gbbct510.seq
 499998670     gbbct511.seq
 290566922     gbbct512.seq
 493025442     gbbct52.seq
 218993383     gbbct53.seq
 498095953     gbbct54.seq
 499071223     gbbct55.seq
 496563592     gbbct56.seq
 497566393     gbbct57.seq
 499752466     gbbct58.seq
 490382215     gbbct59.seq
 102226952     gbbct6.seq
 257412828     gbbct60.seq
 499969246     gbbct61.seq
 495193552     gbbct62.seq
 486287139     gbbct63.seq
 493006700     gbbct64.seq
 475857505     gbbct65.seq
 490137900     gbbct66.seq
 485837861     gbbct67.seq
 497985685     gbbct68.seq
 491275639     gbbct69.seq
 282430460     gbbct7.seq
 306897153     gbbct70.seq
 491474028     gbbct71.seq
 494313903     gbbct72.seq
 495819854     gbbct73.seq
 498720135     gbbct74.seq
 499103370     gbbct75.seq
 261686755     gbbct76.seq
 498130957     gbbct77.seq
 499517858     gbbct78.seq
 498962272     gbbct79.seq
 493056797     gbbct8.seq
 488107655     gbbct80.seq
 397950576     gbbct81.seq
 498259014     gbbct82.seq
 492795510     gbbct83.seq
 495523467     gbbct84.seq
 300972531     gbbct85.seq
 499885449     gbbct86.seq
 495464406     gbbct87.seq
 496856504     gbbct88.seq
  74937857     gbbct89.seq
 497849236     gbbct9.seq
 489628390     gbbct90.seq
 498992614     gbbct91.seq
 499931721     gbbct92.seq
 389027426     gbbct93.seq
 499874268     gbbct94.seq
 498124187     gbbct95.seq
 499292017     gbbct96.seq
 491407812     gbbct97.seq
  13752575     gbbct98.seq
 493588275     gbbct99.seq
   1470894     gbchg.txt
 499855594     gbcon1.seq
 498645870     gbcon10.seq
 169917526     gbcon100.seq
 499972116     gbcon101.seq
 499736073     gbcon102.seq
 499839387     gbcon103.seq
 499997197     gbcon104.seq
 260691384     gbcon105.seq
 499972783     gbcon106.seq
 499998542     gbcon107.seq
 301831295     gbcon108.seq
 499998730     gbcon109.seq
 496199888     gbcon11.seq
 499999710     gbcon110.seq
 127838029     gbcon111.seq
 499999471     gbcon112.seq
 499999917     gbcon113.seq
 499957520     gbcon114.seq
 293729666     gbcon115.seq
 499999876     gbcon116.seq
 499999395     gbcon117.seq
 222253215     gbcon118.seq
  45836617     gbcon119.seq
 497975708     gbcon12.seq
 499942435     gbcon120.seq
 499999195     gbcon121.seq
 447230290     gbcon122.seq
 499998450     gbcon123.seq
 499999286     gbcon124.seq
 499999662     gbcon125.seq
 196761702     gbcon126.seq
 499995599     gbcon127.seq
 499999259     gbcon128.seq
 238748401     gbcon129.seq
 497470291     gbcon13.seq
 499998427     gbcon130.seq
 466689444     gbcon131.seq
 499999585     gbcon132.seq
 500000159     gbcon133.seq
 268143642     gbcon134.seq
 499999756     gbcon135.seq
 499999390     gbcon136.seq
 497684871     gbcon137.seq
 499998880     gbcon138.seq
 499999384     gbcon139.seq
 496665563     gbcon14.seq
 179138423     gbcon140.seq
 499998502     gbcon141.seq
 499999166     gbcon142.seq
  22645865     gbcon143.seq
 499889958     gbcon144.seq
 500000058     gbcon145.seq
 410613848     gbcon146.seq
 499941967     gbcon147.seq
 499998956     gbcon148.seq
 376844480     gbcon149.seq
 495952578     gbcon15.seq
 499993470     gbcon150.seq
 499945543     gbcon151.seq
 264399591     gbcon152.seq
 499999294     gbcon153.seq
 499998064     gbcon154.seq
  81972538     gbcon155.seq
 499999960     gbcon156.seq
 499952504     gbcon157.seq
 499998699     gbcon158.seq
 140577644     gbcon159.seq
 499999994     gbcon16.seq
 499830763     gbcon160.seq
 499983832     gbcon161.seq
 499968068     gbcon162.seq
 336329725     gbcon163.seq
 499999021     gbcon164.seq
 499995343     gbcon165.seq
 407412908     gbcon166.seq
 499999531     gbcon167.seq
 499999623     gbcon168.seq
 499997752     gbcon169.seq
  74436017     gbcon17.seq
 271450839     gbcon170.seq
 499999711     gbcon171.seq
 500000152     gbcon172.seq
 499495640     gbcon173.seq
 499999570     gbcon174.seq
 162078209     gbcon175.seq
 499999509     gbcon176.seq
 499999454     gbcon177.seq
 134430053     gbcon178.seq
 499997310     gbcon179.seq
 499995886     gbcon18.seq
 499997168     gbcon180.seq
 499997884     gbcon181.seq
 288368224     gbcon182.seq
 499987697     gbcon183.seq
 499993316     gbcon184.seq
 454453261     gbcon185.seq
 499999851     gbcon186.seq
 499993782     gbcon187.seq
 397670739     gbcon188.seq
 499934653     gbcon189.seq
 500000139     gbcon19.seq
 499997706     gbcon190.seq
 499996344     gbcon191.seq
 168062873     gbcon192.seq
 499998392     gbcon193.seq
 499998932     gbcon194.seq
  37638463     gbcon195.seq
 499997011     gbcon196.seq
 499999104     gbcon197.seq
 499999869     gbcon198.seq
 499999470     gbcon199.seq
 499998804     gbcon2.seq
 499999629     gbcon20.seq
 500000141     gbcon200.seq
 229561358     gbcon201.seq
 499999704     gbcon202.seq
 459353155     gbcon203.seq
 499993123     gbcon204.seq
 499997240     gbcon205.seq
 478760001     gbcon206.seq
 499998047     gbcon207.seq
 500000157     gbcon208.seq
 499997497     gbcon209.seq
  81279857     gbcon21.seq
  16796892     gbcon210.seq
 499971876     gbcon211.seq
 499973931     gbcon212.seq
 499998396     gbcon213.seq
 499886725     gbcon214.seq
 498928741     gbcon215.seq
 499908473     gbcon216.seq
 499997687     gbcon217.seq
  13561671     gbcon218.seq
 499998430     gbcon22.seq
 499998644     gbcon23.seq
 499971791     gbcon24.seq
 285557284     gbcon25.seq
 499486394     gbcon26.seq
 125746382     gbcon27.seq
 126436397     gbcon28.seq
 499924680     gbcon29.seq
 499997360     gbcon3.seq
 499992465     gbcon30.seq
  26152220     gbcon31.seq
 499999414     gbcon32.seq
 499998297     gbcon33.seq
 443981789     gbcon34.seq
 499999057     gbcon35.seq
 499998568     gbcon36.seq
 499999100     gbcon37.seq
  41918782     gbcon38.seq
 500000081     gbcon39.seq
 106993415     gbcon4.seq
 499998540     gbcon40.seq
 277009775     gbcon41.seq
 499996336     gbcon42.seq
 499998469     gbcon43.seq
 270612827     gbcon44.seq
 499996532     gbcon45.seq
 499996905     gbcon46.seq
 385374935     gbcon47.seq
 499997390     gbcon48.seq
 499999185     gbcon49.seq
 499901495     gbcon5.seq
 176580283     gbcon50.seq
 499999848     gbcon51.seq
 499997718     gbcon52.seq
 238773972     gbcon53.seq
 499997628     gbcon54.seq
 499995125     gbcon55.seq
 335698760     gbcon56.seq
 499996299     gbcon57.seq
 499999132     gbcon58.seq
 298461041     gbcon59.seq
 494424022     gbcon6.seq
 499995314     gbcon60.seq
 499999014     gbcon61.seq
 259899669     gbcon62.seq
 499996880     gbcon63.seq
 499997062     gbcon64.seq
 187377116     gbcon65.seq
 499996720     gbcon66.seq
 499999826     gbcon67.seq
 364586197     gbcon68.seq
 499993696     gbcon69.seq
 494419276     gbcon7.seq
 499999904     gbcon70.seq
 386119955     gbcon71.seq
 499993762     gbcon72.seq
 472787618     gbcon73.seq
 174082386     gbcon74.seq
 499938371     gbcon75.seq
  23944253     gbcon76.seq
 499983420     gbcon77.seq
 203666963     gbcon78.seq
 199581356     gbcon79.seq
 499926814     gbcon8.seq
 499487632     gbcon80.seq
 499994196     gbcon81.seq
 337148674     gbcon82.seq
 499527910     gbcon83.seq
 495870137     gbcon84.seq
 499840683     gbcon85.seq
 337814226     gbcon86.seq
 499904646     gbcon87.seq
 499998973     gbcon88.seq
 499875137     gbcon89.seq
  69828678     gbcon9.seq
 167922692     gbcon90.seq
 499999301     gbcon91.seq
 500000194     gbcon92.seq
 132406181     gbcon93.seq
 499996791     gbcon94.seq
 499998450     gbcon95.seq
 499997491     gbcon96.seq
 264841722     gbcon97.seq
 499997076     gbcon98.seq
 499995430     gbcon99.seq
   1255347     gbdel.txt
 499998812     gbenv1.seq
 499999514     gbenv10.seq
 499999074     gbenv11.seq
 495463383     gbenv12.seq
 499998942     gbenv13.seq
 499999757     gbenv14.seq
 173623395     gbenv15.seq
 499955312     gbenv16.seq
 499999027     gbenv17.seq
 500000188     gbenv18.seq
  70828082     gbenv19.seq
 499998325     gbenv2.seq
 499998409     gbenv20.seq
 500000227     gbenv21.seq
 177805791     gbenv22.seq
 499999700     gbenv23.seq
 499999780     gbenv24.seq
 499999284     gbenv25.seq
  46299721     gbenv26.seq
 499998505     gbenv27.seq
 499999715     gbenv28.seq
 192710343     gbenv29.seq
 495641170     gbenv3.seq
 499995906     gbenv30.seq
 499999157     gbenv31.seq
 333532102     gbenv32.seq
 499999730     gbenv33.seq
 499999278     gbenv34.seq
 463469231     gbenv35.seq
 499998162     gbenv36.seq
 499999864     gbenv37.seq
 337875266     gbenv38.seq
 499998311     gbenv39.seq
 499998711     gbenv4.seq
 499998097     gbenv40.seq
 394139396     gbenv41.seq
 499998712     gbenv42.seq
 499998985     gbenv43.seq
 345161803     gbenv44.seq
 500000096     gbenv45.seq
 499997970     gbenv46.seq
 237945499     gbenv47.seq
 499999935     gbenv48.seq
 499999020     gbenv49.seq
 419011601     gbenv5.seq
 381490884     gbenv50.seq
 500000245     gbenv51.seq
 499999698     gbenv52.seq
 499997691     gbenv53.seq
  18339855     gbenv54.seq
 499999080     gbenv55.seq
 499998665     gbenv56.seq
 499998582     gbenv57.seq
  32787240     gbenv58.seq
 499996976     gbenv59.seq
 499998742     gbenv6.seq
 499999650     gbenv60.seq
 499952474     gbenv61.seq
 292524513     gbenv62.seq
 499998411     gbenv7.seq
  53781176     gbenv8.seq
 500000091     gbenv9.seq
 499997544     gbest1.seq
 499997880     gbest10.seq
 499999304     gbest100.seq
 499999070     gbest101.seq
 500000242     gbest102.seq
 499998719     gbest103.seq
  24979733     gbest104.seq
 499997691     gbest105.seq
 499999900     gbest106.seq
 499997850     gbest107.seq
 499999093     gbest108.seq
   9359782     gbest109.seq
 499998237     gbest11.seq
 499998587     gbest110.seq
 499997153     gbest111.seq
 499998009     gbest112.seq
 499999725     gbest113.seq
  23587749     gbest114.seq
 499998597     gbest115.seq
 499998248     gbest116.seq
 499998513     gbest117.seq
  11662882     gbest118.seq
 499997809     gbest119.seq
 474178848     gbest12.seq
 499997466     gbest120.seq
 499997861     gbest121.seq
  68177058     gbest122.seq
 499994263     gbest123.seq
 499997786     gbest124.seq
 223701769     gbest125.seq
 499997461     gbest126.seq
 499998633     gbest127.seq
 195307357     gbest128.seq
 499997173     gbest129.seq
 499999215     gbest13.seq
 499998792     gbest130.seq
 499995025     gbest131.seq
 499996839     gbest132.seq
  85321549     gbest133.seq
 499999011     gbest134.seq
 499996210     gbest135.seq
 499999606     gbest136.seq
 499999382     gbest137.seq
  97914961     gbest138.seq
 500000002     gbest139.seq
 249649487     gbest14.seq
 499997872     gbest140.seq
 499998236     gbest141.seq
 500000006     gbest142.seq
  24940537     gbest143.seq
 499997669     gbest144.seq
 499995869     gbest145.seq
 499998833     gbest146.seq
 499998750     gbest147.seq
  30266552     gbest148.seq
 499999670     gbest149.seq
 499998856     gbest15.seq
 500000231     gbest150.seq
 499998961     gbest151.seq
 322213656     gbest152.seq
 499996387     gbest153.seq
 499998038     gbest154.seq
 499995663     gbest155.seq
 499999348     gbest156.seq
  21637850     gbest157.seq
 499999702     gbest158.seq
 499999521     gbest159.seq
 499999798     gbest16.seq
 499996841     gbest160.seq
 499998882     gbest161.seq
   9723108     gbest162.seq
 499999592     gbest163.seq
 499997509     gbest164.seq
 499997253     gbest165.seq
 499997604     gbest166.seq
  82249483     gbest167.seq
 500000180     gbest168.seq
 499996624     gbest169.seq
 420834751     gbest17.seq
 499997982     gbest170.seq
 499996832     gbest171.seq
 120388331     gbest172.seq
 499998796     gbest173.seq
 499999958     gbest174.seq
 499997684     gbest175.seq
 499999843     gbest176.seq
  66106728     gbest177.seq
 499999609     gbest178.seq
 403619645     gbest179.seq
 499998530     gbest18.seq
 500000063     gbest180.seq
 499997966     gbest181.seq
 499997492     gbest182.seq
 499996416     gbest183.seq
  42364344     gbest184.seq
 499998435     gbest185.seq
 499998353     gbest186.seq
 499997964     gbest187.seq
 499998283     gbest188.seq
  40931567     gbest189.seq
 499997415     gbest19.seq
 499998666     gbest190.seq
 499999919     gbest191.seq
 499998357     gbest192.seq
 499998169     gbest193.seq
  12548792     gbest194.seq
 499997536     gbest195.seq
 499998546     gbest196.seq
 499997349     gbest197.seq
 499999753     gbest198.seq
  25567133     gbest199.seq
 499998652     gbest2.seq
 260119709     gbest20.seq
 499999295     gbest200.seq
 499998187     gbest201.seq
 499999397     gbest202.seq
 499999160     gbest203.seq
  30895268     gbest204.seq
  13610371     gbest205.seq
 499998921     gbest206.seq
 499998329     gbest207.seq
 328283837     gbest208.seq
 499997323     gbest209.seq
 499995671     gbest21.seq
 499995929     gbest210.seq
 316764106     gbest211.seq
 499998724     gbest212.seq
 499997386     gbest213.seq
 265240100     gbest214.seq
 500000080     gbest215.seq
 499997417     gbest216.seq
 268148451     gbest217.seq
 499996281     gbest218.seq
 499999091     gbest219.seq
 499999500     gbest22.seq
 499999161     gbest220.seq
 500000225     gbest221.seq
  49187702     gbest222.seq
 499997957     gbest223.seq
 499997688     gbest224.seq
 499998613     gbest225.seq
 499996253     gbest226.seq
  46528201     gbest227.seq
 499997890     gbest228.seq
 499998314     gbest229.seq
 242267336     gbest23.seq
 174944378     gbest230.seq
 499998728     gbest231.seq
 499999681     gbest232.seq
 499999475     gbest233.seq
 478347570     gbest234.seq
 499997785     gbest235.seq
 499999603     gbest236.seq
 499997429     gbest237.seq
 462328784     gbest238.seq
 499999067     gbest239.seq
 499998838     gbest24.seq
 499999466     gbest240.seq
 499997560     gbest241.seq
 494590773     gbest242.seq
 499998531     gbest243.seq
 499998185     gbest244.seq
 499999561     gbest245.seq
 499998790     gbest246.seq
  24180385     gbest247.seq
 499998910     gbest248.seq
 499999250     gbest249.seq
 499997816     gbest25.seq
 490624714     gbest250.seq
 499995571     gbest251.seq
 499998200     gbest252.seq
 499999520     gbest253.seq
 499997474     gbest254.seq
  15354105     gbest255.seq
 499998154     gbest256.seq
 499998789     gbest257.seq
 499994600     gbest258.seq
 499999950     gbest259.seq
 499999429     gbest26.seq
  73119079     gbest260.seq
 499996849     gbest261.seq
 499999349     gbest262.seq
 499997971     gbest263.seq
 499998772     gbest264.seq
  10894371     gbest265.seq
 499996681     gbest266.seq
 499999121     gbest267.seq
 499996916     gbest268.seq
 499998066     gbest269.seq
 499998571     gbest27.seq
  50796450     gbest270.seq
 499999016     gbest271.seq
 499998969     gbest272.seq
 499998846     gbest273.seq
 119014210     gbest274.seq
 499997034     gbest275.seq
 499998984     gbest276.seq
 499998324     gbest277.seq
 499997019     gbest278.seq
  50954452     gbest279.seq
  48265826     gbest28.seq
 499999317     gbest280.seq
 499997412     gbest281.seq
 499999727     gbest282.seq
 499997668     gbest283.seq
  55646414     gbest284.seq
 499998624     gbest285.seq
 499999705     gbest286.seq
 499995920     gbest287.seq
 499996612     gbest288.seq
  11304703     gbest289.seq
 499999995     gbest29.seq
 499997456     gbest290.seq
 499999795     gbest291.seq
 499999462     gbest292.seq
 499999004     gbest293.seq
  25192615     gbest294.seq
 499998596     gbest295.seq
 499999758     gbest296.seq
 485611090     gbest297.seq
 499997480     gbest298.seq
 499999856     gbest299.seq
 499999348     gbest3.seq
 499998086     gbest30.seq
 499999449     gbest300.seq
 499999678     gbest301.seq
   5382046     gbest302.seq
 499999538     gbest303.seq
 499999813     gbest304.seq
 499998715     gbest305.seq
 499997626     gbest306.seq
   7751764     gbest307.seq
 499998952     gbest308.seq
 499998801     gbest309.seq
 499999902     gbest31.seq
 499997247     gbest310.seq
 421290158     gbest311.seq
 499999810     gbest312.seq
 499999610     gbest313.seq
 499997603     gbest314.seq
 495919364     gbest315.seq
 499997885     gbest316.seq
 499997415     gbest317.seq
 467912070     gbest318.seq
 499999035     gbest319.seq
 486427399     gbest32.seq
 499999258     gbest320.seq
 499999978     gbest321.seq
 499999435     gbest322.seq
  39514259     gbest323.seq
 500000256     gbest324.seq
 499998824     gbest325.seq
 499998053     gbest326.seq
 493104551     gbest327.seq
 499998749     gbest328.seq
 499997759     gbest329.seq
 499995486     gbest33.seq
 499999540     gbest330.seq
 499997875     gbest331.seq
  54900833     gbest332.seq
 499999943     gbest333.seq
 499999960     gbest334.seq
 499998379     gbest335.seq
 469183035     gbest336.seq
 499998299     gbest337.seq
 500000013     gbest338.seq
 499999184     gbest339.seq
 499998228     gbest34.seq
 499996505     gbest340.seq
  18186152     gbest341.seq
 499999080     gbest342.seq
 491105999     gbest343.seq
 499998133     gbest344.seq
 499999973     gbest345.seq
 499997585     gbest346.seq
 499998101     gbest347.seq
   5414791     gbest348.seq
 499996833     gbest349.seq
 499999753     gbest35.seq
 499998120     gbest350.seq
 499998274     gbest351.seq
 445223218     gbest352.seq
 499998629     gbest353.seq
 500000207     gbest354.seq
 499999612     gbest355.seq
 387609675     gbest356.seq
 499998924     gbest357.seq
 499998310     gbest358.seq
 499997427     gbest359.seq
 464638581     gbest36.seq
 499998071     gbest360.seq
  20572711     gbest361.seq
 499998188     gbest362.seq
 500000152     gbest363.seq
 499997517     gbest364.seq
 499999296     gbest365.seq
  55347028     gbest366.seq
 166258344     gbest367.seq
 499998115     gbest368.seq
 499999211     gbest369.seq
 499998459     gbest37.seq
 499998612     gbest370.seq
 499999327     gbest371.seq
  86045134     gbest372.seq
 499997252     gbest373.seq
 499998940     gbest374.seq
 499998649     gbest375.seq
 499999486     gbest376.seq
 164833678     gbest377.seq
 499996775     gbest378.seq
 499996558     gbest379.seq
 499998008     gbest38.seq
 499998375     gbest380.seq
 499998637     gbest381.seq
 151580674     gbest382.seq
 499997221     gbest383.seq
 499999329     gbest384.seq
 499997189     gbest385.seq
 497166354     gbest386.seq
 499997498     gbest387.seq
 499998709     gbest388.seq
 499998596     gbest389.seq
 499997178     gbest39.seq
  64052070     gbest390.seq
 499998385     gbest391.seq
 499998728     gbest392.seq
 499996496     gbest393.seq
 499997691     gbest394.seq
  83414510     gbest395.seq
 499996944     gbest396.seq
 499997015     gbest397.seq
 499998636     gbest398.seq
 499997858     gbest399.seq
 434600055     gbest4.seq
 499997938     gbest40.seq
  85809127     gbest400.seq
 499997855     gbest401.seq
 499998092     gbest402.seq
 499999582     gbest403.seq
 499998843     gbest404.seq
  50565406     gbest405.seq
 499998820     gbest406.seq
 499997816     gbest407.seq
 499999702     gbest408.seq
 499997206     gbest409.seq
 191357351     gbest41.seq
  90214994     gbest410.seq
 499998673     gbest411.seq
 499998288     gbest412.seq
 499996967     gbest413.seq
 499996677     gbest414.seq
 124589880     gbest415.seq
 499998079     gbest416.seq
 328943837     gbest417.seq
 500000254     gbest418.seq
 499998835     gbest419.seq
 499997364     gbest42.seq
 499999607     gbest420.seq
 500000112     gbest421.seq
  54509541     gbest422.seq
 499999330     gbest423.seq
 499999774     gbest424.seq
 499996219     gbest425.seq
 409977293     gbest426.seq
 499997260     gbest427.seq
 499999283     gbest428.seq
 335979604     gbest429.seq
 499997237     gbest43.seq
 499999961     gbest430.seq
 500000227     gbest431.seq
 261230544     gbest432.seq
 499999633     gbest433.seq
 499998229     gbest434.seq
 458266973     gbest435.seq
 499998830     gbest436.seq
 500000090     gbest437.seq
 307334807     gbest438.seq
 499997288     gbest439.seq
 499997245     gbest44.seq
 499999169     gbest440.seq
 329772669     gbest441.seq
 499997075     gbest442.seq
 499998558     gbest443.seq
 187654716     gbest444.seq
 499999916     gbest445.seq
 499997943     gbest446.seq
 118594788     gbest447.seq
 499998649     gbest448.seq
 500000126     gbest449.seq
 499996431     gbest45.seq
 140963965     gbest450.seq
 500000200     gbest451.seq
 499999541     gbest452.seq
 146594251     gbest453.seq
 499998942     gbest454.seq
 500000199     gbest455.seq
 499997329     gbest456.seq
 487788892     gbest457.seq
 499999035     gbest458.seq
 499997432     gbest459.seq
 189558363     gbest46.seq
 499999676     gbest460.seq
 499999224     gbest461.seq
  19780988     gbest462.seq
 170019681     gbest463.seq
 499998234     gbest464.seq
 499997948     gbest465.seq
 499996964     gbest466.seq
 499998273     gbest467.seq
  23774165     gbest468.seq
 499999458     gbest469.seq
 499999613     gbest47.seq
 499999208     gbest470.seq
 499999233     gbest471.seq
 499999368     gbest472.seq
  59933080     gbest473.seq
 499997118     gbest474.seq
 499996532     gbest475.seq
 499997210     gbest476.seq
 499997282     gbest477.seq
  57556980     gbest478.seq
 499999428     gbest479.seq
 499997256     gbest48.seq
 499998005     gbest480.seq
 499999987     gbest481.seq
 499999584     gbest482.seq
  37400826     gbest483.seq
 499997371     gbest484.seq
 499998672     gbest485.seq
 499999509     gbest486.seq
 499999088     gbest487.seq
  64962335     gbest488.seq
 499997662     gbest489.seq
 499999418     gbest49.seq
 499999130     gbest490.seq
 499999934     gbest491.seq
 206715962     gbest492.seq
 499996334     gbest493.seq
 499998589     gbest494.seq
 499998630     gbest495.seq
 499999095     gbest496.seq
  89176355     gbest497.seq
 499998125     gbest498.seq
 499998609     gbest499.seq
 499998155     gbest5.seq
 474488499     gbest50.seq
 500000133     gbest500.seq
 499999253     gbest501.seq
  52957322     gbest502.seq
 499998717     gbest503.seq
 499997860     gbest504.seq
 499999996     gbest505.seq
 499999277     gbest506.seq
 141956910     gbest507.seq
 499999242     gbest508.seq
 499996708     gbest509.seq
 499998341     gbest51.seq
 499998452     gbest510.seq
 500000146     gbest511.seq
 139192325     gbest512.seq
 499997763     gbest513.seq
 499997891     gbest514.seq
 499999016     gbest515.seq
 500000145     gbest516.seq
  16904523     gbest517.seq
 174254470     gbest518.seq
 500000126     gbest519.seq
 355703064     gbest52.seq
 499998910     gbest520.seq
  83090108     gbest521.seq
 499997944     gbest522.seq
 499998345     gbest523.seq
  75363186     gbest524.seq
 499999291     gbest525.seq
 499999095     gbest526.seq
 499998072     gbest527.seq
 499996371     gbest528.seq
  94416764     gbest529.seq
 499997477     gbest53.seq
 499999382     gbest530.seq
 499998748     gbest531.seq
 499998249     gbest532.seq
 499999707     gbest533.seq
   9311695     gbest534.seq
 499999430     gbest535.seq
 499998660     gbest536.seq
 499998262     gbest537.seq
 477035449     gbest538.seq
 499998584     gbest539.seq
 499999368     gbest54.seq
 499998271     gbest540.seq
 499997596     gbest541.seq
 411964420     gbest542.seq
 499998900     gbest543.seq
 499999161     gbest544.seq
 499999128     gbest545.seq
 477320669     gbest546.seq
 499998997     gbest547.seq
 499998220     gbest548.seq
 499998640     gbest549.seq
 499996905     gbest55.seq
 499997208     gbest550.seq
  33772444     gbest551.seq
 499997037     gbest552.seq
 499997866     gbest553.seq
 499997861     gbest554.seq
 499999777     gbest555.seq
  44009213     gbest556.seq
 499996534     gbest557.seq
 499999210     gbest558.seq
 499997220     gbest559.seq
 483256451     gbest56.seq
 499998286     gbest560.seq
   9393571     gbest561.seq
 499998309     gbest562.seq
 499998494     gbest563.seq
 392782285     gbest564.seq
 499998337     gbest565.seq
 499998160     gbest566.seq
  97495279     gbest567.seq
 499998740     gbest568.seq
 499998391     gbest569.seq
 499998261     gbest57.seq
  50311057     gbest570.seq
 499999914     gbest571.seq
 499997486     gbest572.seq
 499998106     gbest573.seq
 254446979     gbest574.seq
 500000177     gbest58.seq
 499998973     gbest59.seq
 499998099     gbest6.seq
 463542876     gbest60.seq
 499998917     gbest61.seq
 499998696     gbest62.seq
 499998443     gbest63.seq
 499999277     gbest64.seq
   6669616     gbest65.seq
 499999738     gbest66.seq
 499998528     gbest67.seq
 499998605     gbest68.seq
 482591269     gbest69.seq
 499997570     gbest7.seq
 499997911     gbest70.seq
 499999144     gbest71.seq
 499998939     gbest72.seq
 500000212     gbest73.seq
   7311239     gbest74.seq
 123216203     gbest75.seq
 499999005     gbest76.seq
 499998002     gbest77.seq
 499998202     gbest78.seq
 499999285     gbest79.seq
 469256502     gbest8.seq
   5123860     gbest80.seq
 499998041     gbest81.seq
 499995344     gbest82.seq
 499996657     gbest83.seq
 499999945     gbest84.seq
  45616577     gbest85.seq
 499999280     gbest86.seq
 499998745     gbest87.seq
 499999478     gbest88.seq
 499998865     gbest89.seq
 499997802     gbest9.seq
  52673689     gbest90.seq
 499999406     gbest91.seq
 500000250     gbest92.seq
 499998334     gbest93.seq
 471729510     gbest94.seq
 499999715     gbest95.seq
 499999749     gbest96.seq
 500000194     gbest97.seq
 498418806     gbest98.seq
  35234983     gbest99.seq
 499999797     gbgss1.seq
  55179126     gbgss10.seq
 499997313     gbgss100.seq
 499996830     gbgss101.seq
 499999909     gbgss102.seq
 468181084     gbgss103.seq
 499997049     gbgss104.seq
 499999629     gbgss105.seq
 500000188     gbgss106.seq
 499999848     gbgss107.seq
  40292488     gbgss108.seq
 499997736     gbgss109.seq
 499999314     gbgss11.seq
 500000122     gbgss110.seq
 500000164     gbgss111.seq
 316319608     gbgss112.seq
 499998282     gbgss113.seq
 499998924     gbgss114.seq
 499998333     gbgss115.seq
 499997840     gbgss116.seq
 103720750     gbgss117.seq
 499998525     gbgss118.seq
 499998144     gbgss119.seq
 500000242     gbgss12.seq
 499998256     gbgss120.seq
 499999634     gbgss121.seq
   5770896     gbgss122.seq
 499999867     gbgss123.seq
 499999676     gbgss124.seq
 499999794     gbgss125.seq
 449066275     gbgss126.seq
 499997882     gbgss127.seq
 499997140     gbgss128.seq
 499999220     gbgss129.seq
 499999094     gbgss13.seq
 499996616     gbgss130.seq
  29590310     gbgss131.seq
 499997877     gbgss132.seq
 209679641     gbgss133.seq
 500000110     gbgss134.seq
 499999602     gbgss135.seq
 499997969     gbgss136.seq
 500000125     gbgss137.seq
  14831686     gbgss138.seq
 499996726     gbgss139.seq
 498622083     gbgss14.seq
 499997951     gbgss140.seq
 499999528     gbgss141.seq
 499997001     gbgss142.seq
  16786266     gbgss143.seq
 499997786     gbgss144.seq
 499996974     gbgss145.seq
 499999546     gbgss146.seq
 499996547     gbgss147.seq
   2045398     gbgss148.seq
 499997382     gbgss149.seq
 499997425     gbgss15.seq
 499998165     gbgss150.seq
 499998480     gbgss151.seq
 499997367     gbgss152.seq
   6835799     gbgss153.seq
 373635168     gbgss154.seq
 499999264     gbgss155.seq
 499998740     gbgss156.seq
 499999488     gbgss157.seq
 450187084     gbgss158.seq
 499999895     gbgss159.seq
 499997738     gbgss16.seq
 499997663     gbgss160.seq
 499997684     gbgss161.seq
 454199198     gbgss162.seq
 499997998     gbgss163.seq
 499999955     gbgss164.seq
 499997965     gbgss165.seq
 456856217     gbgss166.seq
 499997324     gbgss167.seq
 499998331     gbgss168.seq
 499998722     gbgss169.seq
 499999295     gbgss17.seq
 362069154     gbgss170.seq
 499999614     gbgss171.seq
 499999108     gbgss172.seq
 215505768     gbgss173.seq
 499998125     gbgss174.seq
 499998134     gbgss175.seq
  67002892     gbgss176.seq
 499999079     gbgss177.seq
 499999336     gbgss178.seq
 499998518     gbgss179.seq
 480471944     gbgss18.seq
 499999975     gbgss180.seq
  49671428     gbgss181.seq
 500000156     gbgss182.seq
 499999211     gbgss183.seq
 500000209     gbgss184.seq
 499999501     gbgss185.seq
  39656212     gbgss186.seq
 499999015     gbgss187.seq
 500000221     gbgss188.seq
  23203602     gbgss189.seq
 499999252     gbgss19.seq
 499998791     gbgss190.seq
 499996639     gbgss191.seq
 499998774     gbgss192.seq
 495024971     gbgss193.seq
 499999000     gbgss194.seq
 499999717     gbgss195.seq
 499999860     gbgss196.seq
 499999901     gbgss197.seq
  53998378     gbgss198.seq
 499998820     gbgss199.seq
 499999702     gbgss2.seq
 324867797     gbgss20.seq
 499998733     gbgss200.seq
 499997169     gbgss201.seq
 479851147     gbgss202.seq
 499997737     gbgss203.seq
 499997752     gbgss204.seq
  56421213     gbgss205.seq
 499997703     gbgss206.seq
 500000150     gbgss207.seq
 499999163     gbgss208.seq
 481445530     gbgss209.seq
 499999364     gbgss21.seq
 500000183     gbgss210.seq
 499997933     gbgss211.seq
 499998148     gbgss212.seq
 488124681     gbgss213.seq
 499999175     gbgss214.seq
 499999239     gbgss215.seq
 499999176     gbgss216.seq
 467990953     gbgss217.seq
 499999749     gbgss218.seq
 499999749     gbgss219.seq
 499997480     gbgss22.seq
 499997938     gbgss220.seq
   6989681     gbgss221.seq
 499999723     gbgss222.seq
 499999684     gbgss223.seq
 499998774     gbgss224.seq
 264582471     gbgss225.seq
 499998308     gbgss226.seq
 499997919     gbgss227.seq
 499999010     gbgss228.seq
 429128186     gbgss229.seq
 499997001     gbgss23.seq
 499998680     gbgss230.seq
 499997412     gbgss231.seq
 499999464     gbgss232.seq
 468539336     gbgss233.seq
 499999119     gbgss234.seq
 499999511     gbgss235.seq
 499996654     gbgss236.seq
 418138488     gbgss237.seq
 499998602     gbgss238.seq
 499998785     gbgss239.seq
 499999217     gbgss24.seq
 499999907     gbgss240.seq
 499997646     gbgss241.seq
  16466381     gbgss242.seq
 315572447     gbgss243.seq
 499997744     gbgss244.seq
 499999895     gbgss245.seq
 499998432     gbgss246.seq
 467293763     gbgss247.seq
 499998755     gbgss248.seq
 499999852     gbgss249.seq
  47915040     gbgss25.seq
 499999607     gbgss250.seq
 499998339     gbgss251.seq
  36094621     gbgss252.seq
 499998608     gbgss253.seq
 499997686     gbgss254.seq
 499998198     gbgss255.seq
 499999134     gbgss256.seq
  19020583     gbgss257.seq
 499999905     gbgss258.seq
 499998046     gbgss259.seq
 499998203     gbgss26.seq
 500000045     gbgss260.seq
   1404512     gbgss261.seq
 500000216     gbgss262.seq
 499999092     gbgss263.seq
 499998857     gbgss264.seq
 480378844     gbgss265.seq
 499999638     gbgss266.seq
 499998584     gbgss267.seq
 449883145     gbgss268.seq
 499999289     gbgss27.seq
 499997752     gbgss28.seq
 499998293     gbgss29.seq
 500000154     gbgss3.seq
  28371252     gbgss30.seq
 499999620     gbgss31.seq
 499999369     gbgss32.seq
 499997936     gbgss33.seq
 474348213     gbgss34.seq
 499997672     gbgss35.seq
 499999711     gbgss36.seq
 499998458     gbgss37.seq
 499998787     gbgss38.seq
  10244239     gbgss39.seq
 499997022     gbgss4.seq
 499998043     gbgss40.seq
 500000104     gbgss41.seq
 168816398     gbgss42.seq
 499998215     gbgss43.seq
 499997776     gbgss44.seq
 499997935     gbgss45.seq
 487170352     gbgss46.seq
 500000097     gbgss47.seq
 499997504     gbgss48.seq
 499999771     gbgss49.seq
  37746558     gbgss5.seq
 444022212     gbgss50.seq
 499998446     gbgss51.seq
 500000163     gbgss52.seq
 499998853     gbgss53.seq
 420972611     gbgss54.seq
 499999264     gbgss55.seq
 499999392     gbgss56.seq
 499998883     gbgss57.seq
 427742687     gbgss58.seq
  67685650     gbgss59.seq
 499999011     gbgss6.seq
 500000215     gbgss60.seq
 499997984     gbgss61.seq
 500000021     gbgss62.seq
 493796988     gbgss63.seq
 499998150     gbgss64.seq
 500000146     gbgss65.seq
 500000101     gbgss66.seq
 499520338     gbgss67.seq
 499998492     gbgss68.seq
 499999132     gbgss69.seq
 499998902     gbgss7.seq
 499999264     gbgss70.seq
 419358340     gbgss71.seq
 499999747     gbgss72.seq
 499998402     gbgss73.seq
 499998080     gbgss74.seq
  33896316     gbgss75.seq
 499997046     gbgss76.seq
 499999706     gbgss77.seq
 499999836     gbgss78.seq
 490829495     gbgss79.seq
 499997604     gbgss8.seq
 499997550     gbgss80.seq
 499997981     gbgss81.seq
 499998952     gbgss82.seq
 499999735     gbgss83.seq
   6075051     gbgss84.seq
 499999170     gbgss85.seq
 500000077     gbgss86.seq
 499997276     gbgss87.seq
 499999314     gbgss88.seq
  23821801     gbgss89.seq
 499999203     gbgss9.seq
 500000224     gbgss90.seq
 499999829     gbgss91.seq
 499999704     gbgss92.seq
 462802247     gbgss93.seq
 244248654     gbgss94.seq
 499999492     gbgss95.seq
 499998457     gbgss96.seq
 500000176     gbgss97.seq
 499997669     gbgss98.seq
  45206073     gbgss99.seq
 499991077     gbhtc1.seq
 499994049     gbhtc2.seq
 499986002     gbhtc3.seq
 330777725     gbhtc4.seq
 499999497     gbhtc5.seq
 437685656     gbhtc6.seq
 499999534     gbhtc7.seq
 193501056     gbhtc8.seq
 499943248     gbhtg1.seq
 499980365     gbhtg10.seq
 485099546     gbhtg11.seq
 499977093     gbhtg12.seq
 499847932     gbhtg13.seq
 499963690     gbhtg14.seq
 499701413     gbhtg15.seq
 474637756     gbhtg16.seq
 499709315     gbhtg17.seq
 499810411     gbhtg18.seq
 499965524     gbhtg19.seq
 499844091     gbhtg2.seq
 499990220     gbhtg20.seq
 473197896     gbhtg21.seq
 499917621     gbhtg22.seq
 499967580     gbhtg23.seq
 499096681     gbhtg24.seq
 499958752     gbhtg25.seq
 484455994     gbhtg26.seq
 499961339     gbhtg27.seq
 499870274     gbhtg28.seq
 268060905     gbhtg29.seq
 499869147     gbhtg3.seq
 499926139     gbhtg30.seq
 499802500     gbhtg31.seq
 224936220     gbhtg32.seq
 499948244     gbhtg33.seq
 499915502     gbhtg34.seq
 265459787     gbhtg35.seq
 499837354     gbhtg36.seq
 499950524     gbhtg37.seq
 223150728     gbhtg38.seq
 499802417     gbhtg39.seq
 499846457     gbhtg4.seq
 499973211     gbhtg40.seq
 234952769     gbhtg41.seq
 499824978     gbhtg42.seq
 499885923     gbhtg43.seq
 202125536     gbhtg44.seq
 499784538     gbhtg45.seq
 499925762     gbhtg46.seq
 205797151     gbhtg47.seq
 499975842     gbhtg48.seq
 499928510     gbhtg49.seq
 499934497     gbhtg5.seq
 193864742     gbhtg50.seq
 499926539     gbhtg51.seq
 499937036     gbhtg52.seq
 161358152     gbhtg53.seq
 499996909     gbhtg54.seq
 499996869     gbhtg55.seq
 252726149     gbhtg56.seq
 499940485     gbhtg57.seq
 499966376     gbhtg58.seq
 499997341     gbhtg59.seq
    507366     gbhtg6.seq
 167065947     gbhtg60.seq
 499929457     gbhtg61.seq
 499926029     gbhtg62.seq
 499877376     gbhtg63.seq
 468570824     gbhtg64.seq
 499882387     gbhtg65.seq
 499975194     gbhtg66.seq
 499983596     gbhtg67.seq
 499743038     gbhtg68.seq
 499817351     gbhtg69.seq
 499821285     gbhtg7.seq
 410730530     gbhtg70.seq
 499651145     gbhtg71.seq
 499807545     gbhtg72.seq
 385409481     gbhtg73.seq
 499951671     gbhtg74.seq
 499970875     gbhtg75.seq
 383567862     gbhtg76.seq
 499964642     gbhtg77.seq
 499988260     gbhtg78.seq
 499994475     gbhtg79.seq
 499933798     gbhtg8.seq
 499991153     gbhtg80.seq
 499926087     gbhtg81.seq
 270655294     gbhtg82.seq
 499899409     gbhtg9.seq
 499825461     gbinv1.seq
 490451253     gbinv10.seq
 491062219     gbinv11.seq
 495976109     gbinv12.seq
 497930277     gbinv13.seq
 101726247     gbinv14.seq
 486730544     gbinv15.seq
 498986257     gbinv16.seq
 499998749     gbinv17.seq
 369418332     gbinv18.seq
 499998669     gbinv19.seq
 455402651     gbinv2.seq
 404399836     gbinv20.seq
 497205455     gbinv21.seq
 499999663     gbinv22.seq
 321219904     gbinv23.seq
 492348752     gbinv24.seq
 499999934     gbinv25.seq
 485308054     gbinv26.seq
 499999899     gbinv27.seq
 499998771     gbinv28.seq
 393902017     gbinv29.seq
 499999055     gbinv3.seq
 499996838     gbinv30.seq
 499997367     gbinv31.seq
 175086920     gbinv32.seq
 499999364     gbinv33.seq
 500000223     gbinv34.seq
 116656910     gbinv35.seq
 499998506     gbinv36.seq
 500000054     gbinv37.seq
 147828206     gbinv38.seq
 499997096     gbinv39.seq
 499045124     gbinv4.seq
 499999709     gbinv40.seq
 156154165     gbinv41.seq
 499998078     gbinv42.seq
 499999525     gbinv43.seq
 190800930     gbinv44.seq
 499997804     gbinv45.seq
 499998977     gbinv46.seq
 244927010     gbinv47.seq
 499998394     gbinv48.seq
 499998598     gbinv49.seq
 185011139     gbinv5.seq
 499998402     gbinv50.seq
 456594264     gbinv51.seq
 499998874     gbinv52.seq
 445991558     gbinv53.seq
 288064994     gbinv54.seq
  54947886     gbinv55.seq
  52917686     gbinv56.seq
 156789431     gbinv57.seq
 499989559     gbinv58.seq
 266436255     gbinv59.seq
 496487454     gbinv6.seq
 499998556     gbinv60.seq
 499997693     gbinv61.seq
 172341791     gbinv62.seq
 499362201     gbinv63.seq
 498125774     gbinv64.seq
 499648429     gbinv65.seq
 128966683     gbinv66.seq
 495476141     gbinv67.seq
  51960556     gbinv68.seq
 466429156     gbinv69.seq
 476450800     gbinv7.seq
 479577317     gbinv70.seq
 450265331     gbinv71.seq
 482002954     gbinv72.seq
 121049416     gbinv73.seq
 494585019     gbinv74.seq
 252407751     gbinv75.seq
 683172135     gbinv76.seq
 872662072     gbinv77.seq
 815663158     gbinv78.seq
 813528096     gbinv79.seq
 422530809     gbinv8.seq
 780491773     gbinv80.seq
 734904722     gbinv81.seq
 816941877     gbinv82.seq
 471464576     gbinv83.seq
 499377178     gbinv84.seq
 498842880     gbinv85.seq
 130069770     gbinv86.seq
 499999014     gbinv87.seq
 499997478     gbinv88.seq
 259660306     gbinv89.seq
 173964300     gbinv9.seq
 499999172     gbinv90.seq
 499999308     gbinv91.seq
 185180899     gbinv92.seq
 499997257     gbinv93.seq
 499999053     gbinv94.seq
 499999075     gbinv95.seq
 499999318     gbinv96.seq
 320827036     gbinv97.seq
 499999347     gbmam1.seq
  82810211     gbmam10.seq
  71296598     gbmam11.seq
  22570876     gbmam12.seq
   1268606     gbmam13.seq
 378312073     gbmam14.seq
 338653931     gbmam15.seq
 477859990     gbmam16.seq
 445458574     gbmam17.seq
 122412955     gbmam18.seq
 451114203     gbmam19.seq
 393647421     gbmam2.seq
 418062948     gbmam20.seq
 499818197     gbmam21.seq
 462376363     gbmam22.seq
 370510653     gbmam23.seq
 446296425     gbmam24.seq
 431104447     gbmam25.seq
 480602957     gbmam26.seq
 479109873     gbmam27.seq
 483903297     gbmam28.seq
 483307008     gbmam29.seq
 400559326     gbmam3.seq
  48405032     gbmam30.seq
 363174382     gbmam31.seq
 437246747     gbmam32.seq
 470828962     gbmam33.seq
 402408906     gbmam34.seq
 304109928     gbmam35.seq
 452443739     gbmam36.seq
 451303958     gbmam37.seq
 495648598     gbmam38.seq
 405636626     gbmam39.seq
 477148353     gbmam4.seq
 410457734     gbmam40.seq
 441553748     gbmam41.seq
 367146984     gbmam42.seq
 478421809     gbmam43.seq
 317555084     gbmam44.seq
   9943517     gbmam45.seq
  43989127     gbmam46.seq
  91322474     gbmam47.seq
  88811460     gbmam48.seq
   6364660     gbmam49.seq
 374653134     gbmam5.seq
  20917987     gbmam50.seq
 449539879     gbmam51.seq
 499997279     gbmam52.seq
 499996240     gbmam53.seq
  78431523     gbmam54.seq
 907465328     gbmam55.seq
 839494897     gbmam56.seq
 774395849     gbmam57.seq
 588873740     gbmam58.seq
 364960392     gbmam59.seq
 487713568     gbmam6.seq
 428298067     gbmam60.seq
 283039896     gbmam61.seq
 266822121     gbmam62.seq
 255007049     gbmam63.seq
 250435254     gbmam64.seq
 405637142     gbmam65.seq
 372091504     gbmam66.seq
 465555603     gbmam67.seq
 444923782     gbmam68.seq
 341578443     gbmam69.seq
 401181424     gbmam7.seq
 257946240     gbmam70.seq
 485829704     gbmam71.seq
 486026993     gbmam72.seq
 483298905     gbmam73.seq
 499998555     gbmam74.seq
 499980784     gbmam75.seq
 136075509     gbmam76.seq
 435129139     gbmam8.seq
 275779026     gbmam9.seq
   6979373     gbnew.txt
 500000163     gbpat1.seq
 499999421     gbpat10.seq
 499999036     gbpat100.seq
 499999497     gbpat101.seq
 499997525     gbpat102.seq
 228719622     gbpat103.seq
 500000251     gbpat104.seq
 500000174     gbpat105.seq
 499999692     gbpat106.seq
 335320592     gbpat107.seq
 499997809     gbpat108.seq
 499998913     gbpat109.seq
 499998507     gbpat11.seq
 208319113     gbpat110.seq
 499890218     gbpat111.seq
 499995364     gbpat112.seq
 174084213     gbpat113.seq
 499999806     gbpat114.seq
 499998187     gbpat115.seq
 499995445     gbpat116.seq
   8602764     gbpat117.seq
 499705486     gbpat118.seq
 382783273     gbpat119.seq
 179117947     gbpat12.seq
 499994920     gbpat120.seq
 499992282     gbpat121.seq
 499992660     gbpat122.seq
 499999524     gbpat123.seq
  56299930     gbpat124.seq
 499968107     gbpat125.seq
 499998027     gbpat126.seq
 208432510     gbpat127.seq
 499999817     gbpat128.seq
 499999339     gbpat129.seq
 499863783     gbpat13.seq
  57363317     gbpat130.seq
 499999894     gbpat131.seq
 499997744     gbpat132.seq
 487345742     gbpat133.seq
 499995949     gbpat134.seq
 499999626     gbpat135.seq
  25914728     gbpat136.seq
 499984320     gbpat137.seq
 385133459     gbpat138.seq
 499999737     gbpat139.seq
 499999896     gbpat14.seq
 500000185     gbpat140.seq
 148486009     gbpat141.seq
 499998112     gbpat142.seq
 314453605     gbpat143.seq
 499988381     gbpat144.seq
 499980283     gbpat145.seq
 409538104     gbpat146.seq
 500000154     gbpat147.seq
 499997954     gbpat148.seq
 125941966     gbpat149.seq
  62620941     gbpat15.seq
 499989559     gbpat150.seq
 499999607     gbpat151.seq
 499998591     gbpat152.seq
 500000091     gbpat153.seq
 169803601     gbpat154.seq
 499999344     gbpat155.seq
 425309485     gbpat156.seq
 499998740     gbpat157.seq
 499999437     gbpat158.seq
 499871808     gbpat159.seq
 499999182     gbpat16.seq
 353501749     gbpat160.seq
 499996900     gbpat161.seq
 499999751     gbpat162.seq
 289575444     gbpat163.seq
 499999273     gbpat164.seq
 499999814     gbpat165.seq
 499999582     gbpat166.seq
 100308917     gbpat167.seq
 499991586     gbpat168.seq
 499997500     gbpat169.seq
 499999715     gbpat17.seq
 499998487     gbpat170.seq
 499998725     gbpat171.seq
 301680889     gbpat172.seq
 499992585     gbpat173.seq
 499998757     gbpat174.seq
 443851696     gbpat175.seq
 499602055     gbpat176.seq
 499999999     gbpat177.seq
 499999721     gbpat178.seq
  13191753     gbpat179.seq
 421856038     gbpat18.seq
 497266419     gbpat180.seq
 499996814     gbpat181.seq
 499997056     gbpat182.seq
  86829414     gbpat183.seq
 499920610     gbpat184.seq
 499999973     gbpat185.seq
 499995685     gbpat186.seq
  39745949     gbpat187.seq
 499252903     gbpat188.seq
 500000137     gbpat189.seq
 499829299     gbpat19.seq
 499999607     gbpat190.seq
 499999795     gbpat191.seq
  96543512     gbpat192.seq
 499878652     gbpat193.seq
 499997947     gbpat194.seq
 499999338     gbpat195.seq
 499997942     gbpat196.seq
 132030886     gbpat197.seq
 500000054     gbpat198.seq
 499999577     gbpat199.seq
 500000184     gbpat2.seq
 499998521     gbpat20.seq
 321705067     gbpat200.seq
 499991396     gbpat201.seq
 499963719     gbpat202.seq
 350635988     gbpat203.seq
 497506292     gbpat204.seq
 499869540     gbpat205.seq
 421452571     gbpat206.seq
 499425936     gbpat207.seq
 499999361     gbpat208.seq
 336263474     gbpat209.seq
 499989507     gbpat21.seq
 499998549     gbpat210.seq
 499998599     gbpat211.seq
 499269263     gbpat212.seq
 213482936     gbpat213.seq
 347551546     gbpat22.seq
 499995607     gbpat23.seq
 499998652     gbpat24.seq
 499996081     gbpat25.seq
 499979530     gbpat26.seq
 165690566     gbpat27.seq
 500000249     gbpat28.seq
 499999901     gbpat29.seq
  61191360     gbpat3.seq
 213211253     gbpat30.seq
 499999775     gbpat31.seq
 405870641     gbpat32.seq
 500000051     gbpat33.seq
 499999961     gbpat34.seq
 125402940     gbpat35.seq
 499998965     gbpat36.seq
 499999218     gbpat37.seq
 499999594     gbpat38.seq
 140141151     gbpat39.seq
 500000209     gbpat4.seq
 500000233     gbpat40.seq
 493970373     gbpat41.seq
 494766586     gbpat42.seq
 499998800     gbpat43.seq
 149226143     gbpat44.seq
 499999126     gbpat45.seq
 499999712     gbpat46.seq
 499998550     gbpat47.seq
  87768933     gbpat48.seq
 499999687     gbpat49.seq
 500000158     gbpat5.seq
 499999998     gbpat50.seq
 499999650     gbpat51.seq
 130932243     gbpat52.seq
 499999613     gbpat53.seq
 499999084     gbpat54.seq
 184981098     gbpat55.seq
 499999726     gbpat56.seq
 499999154     gbpat57.seq
 137265710     gbpat58.seq
 499998902     gbpat59.seq
 418696316     gbpat6.seq
 499638184     gbpat60.seq
 429848972     gbpat61.seq
 499999897     gbpat62.seq
 320951787     gbpat63.seq
 500000154     gbpat64.seq
 499999708     gbpat65.seq
 305979387     gbpat66.seq
 499999595     gbpat67.seq
 499997159     gbpat68.seq
 144919043     gbpat69.seq
 499999213     gbpat7.seq
 499999495     gbpat70.seq
 226235202     gbpat71.seq
 499942763     gbpat72.seq
 500000257     gbpat73.seq
 309555677     gbpat74.seq
 499990988     gbpat75.seq
 499996904     gbpat76.seq
 259606120     gbpat77.seq
 499998418     gbpat78.seq
 499997914     gbpat79.seq
 499999392     gbpat8.seq
  36785301     gbpat80.seq
 500000256     gbpat81.seq
 474123180     gbpat82.seq
 499999508     gbpat83.seq
 331586952     gbpat84.seq
 499999542     gbpat85.seq
 312101413     gbpat86.seq
 499997831     gbpat87.seq
 499999787     gbpat88.seq
 499999069     gbpat89.seq
 317057723     gbpat9.seq
 203402207     gbpat90.seq
 499999444     gbpat91.seq
 455869832     gbpat92.seq
 499983604     gbpat93.seq
 252132639     gbpat94.seq
 500000009     gbpat95.seq
 499998421     gbpat96.seq
  82014149     gbpat97.seq
 499999689     gbpat98.seq
 498236426     gbpat99.seq
 499820099     gbphg1.seq
 499903845     gbphg2.seq
 499736342     gbphg3.seq
 363158860     gbphg4.seq
 499996428     gbpln1.seq
 268695070     gbpln10.seq
   9770433     gbpln100.seq
     84605     gbpln101.seq
    354450     gbpln102.seq
 164936594     gbpln103.seq
  40081561     gbpln104.seq
  74904960     gbpln105.seq
 499999084     gbpln106.seq
 356711078     gbpln107.seq
 500000113     gbpln108.seq
 499930947     gbpln109.seq
 499919206     gbpln11.seq
 139922940     gbpln110.seq
 499912119     gbpln111.seq
 499778392     gbpln112.seq
 499997325     gbpln113.seq
 285076974     gbpln114.seq
 298313579     gbpln115.seq
 211231817     gbpln116.seq
 248438685     gbpln117.seq
 185623799     gbpln118.seq
 997331398     gbpln119.seq
 497830477     gbpln12.seq
  56501057     gbpln120.seq
 487347148     gbpln121.seq
 473525516     gbpln122.seq
 473209377     gbpln123.seq
 467870557     gbpln124.seq
 357046324     gbpln125.seq
 499998589     gbpln126.seq
  63314308     gbpln127.seq
 500000113     gbpln128.seq
 499997994     gbpln129.seq
 469735020     gbpln13.seq
 267524127     gbpln130.seq
 499674155     gbpln131.seq
 499997681     gbpln132.seq
  85159232     gbpln133.seq
 499998305     gbpln134.seq
 466521693     gbpln135.seq
 499997614     gbpln136.seq
 417445013     gbpln137.seq
 499989724     gbpln138.seq
 384580529     gbpln139.seq
 170594776     gbpln14.seq
 499998323     gbpln140.seq
 499998265     gbpln141.seq
 499996720     gbpln142.seq
  64471422     gbpln143.seq
 499998929     gbpln144.seq
 499997146     gbpln145.seq
 414886032     gbpln146.seq
 499997663     gbpln147.seq
 498831917     gbpln148.seq
 493607401     gbpln149.seq
 496172088     gbpln15.seq
 176561420     gbpln150.seq
 499793535     gbpln151.seq
 491531547     gbpln152.seq
 402785639     gbpln153.seq
 445924319     gbpln154.seq
 499999986     gbpln155.seq
   3419550     gbpln156.seq
 489479325     gbpln157.seq
 226945063     gbpln158.seq
 314220009     gbpln159.seq
 478226023     gbpln16.seq
 665291577     gbpln160.seq
 860028189     gbpln161.seq
 800605872     gbpln162.seq
 794469115     gbpln163.seq
 762933697     gbpln164.seq
 729969959     gbpln165.seq
 808217924     gbpln166.seq
 499450976     gbpln167.seq
 492823891     gbpln168.seq
 324547157     gbpln169.seq
 335223965     gbpln17.seq
 462675485     gbpln170.seq
 480396420     gbpln171.seq
 494737040     gbpln172.seq
 446232653     gbpln173.seq
 417743779     gbpln174.seq
 250838119     gbpln175.seq
 364689197     gbpln176.seq
 339196729     gbpln177.seq
 386320509     gbpln178.seq
 311828079     gbpln179.seq
 418823303     gbpln18.seq
 213907446     gbpln180.seq
 547058897     gbpln181.seq
 117073241     gbpln182.seq
 485280656     gbpln183.seq
 153146564     gbpln184.seq
 689933987     gbpln185.seq
 887561680     gbpln186.seq
 834970472     gbpln187.seq
 826391913     gbpln188.seq
 792513917     gbpln189.seq
 350136927     gbpln19.seq
 743209872     gbpln190.seq
 833073712     gbpln191.seq
    495424     gbpln192.seq
 665291577     gbpln193.seq
 860028189     gbpln194.seq
 800605872     gbpln195.seq
 794469115     gbpln196.seq
 762933697     gbpln197.seq
 729969959     gbpln198.seq
 808217924     gbpln199.seq
 499999616     gbpln2.seq
 345719920     gbpln20.seq
 202960582     gbpln200.seq
 663098252     gbpln201.seq
 855592604     gbpln202.seq
 807031053     gbpln203.seq
 793905039     gbpln204.seq
 773303164     gbpln205.seq
 718153248     gbpln206.seq
 804870210     gbpln207.seq
 661762125     gbpln208.seq
 840180304     gbpln209.seq
 384293271     gbpln21.seq
 796430245     gbpln210.seq
 779180715     gbpln211.seq
 761224530     gbpln212.seq
 725380245     gbpln213.seq
 792983451     gbpln214.seq
 652402241     gbpln215.seq
 831209396     gbpln216.seq
 783682955     gbpln217.seq
 775938782     gbpln218.seq
 741958804     gbpln219.seq
 203983960     gbpln22.seq
 700440901     gbpln220.seq
 788705159     gbpln221.seq
 665885380     gbpln222.seq
 854365289     gbpln223.seq
 802776370     gbpln224.seq
 793295936     gbpln225.seq
 769246264     gbpln226.seq
 710912943     gbpln227.seq
 799876839     gbpln228.seq
 635039454     gbpln229.seq
  84497167     gbpln23.seq
 824184474     gbpln230.seq
 768070182     gbpln231.seq
 758956882     gbpln232.seq
 732189331     gbpln233.seq
 706311232     gbpln234.seq
 766293442     gbpln235.seq
 651415133     gbpln236.seq
 830082304     gbpln237.seq
 783385752     gbpln238.seq
 770520351     gbpln239.seq
 477735094     gbpln24.seq
 753421970     gbpln240.seq
 699441547     gbpln241.seq
 784443196     gbpln242.seq
 702337808     gbpln243.seq
 906907390     gbpln244.seq
 844110716     gbpln245.seq
 841780855     gbpln246.seq
 805270043     gbpln247.seq
 764396863     gbpln248.seq
 841492595     gbpln249.seq
 499901688     gbpln25.seq
 714482811     gbpln250.seq
 916127997     gbpln251.seq
 858459407     gbpln252.seq
 848936990     gbpln253.seq
 813129213     gbpln254.seq
 765593150     gbpln255.seq
 862731158     gbpln256.seq
 629668050     gbpln257.seq
 814320946     gbpln258.seq
 759349720     gbpln259.seq
 498817745     gbpln26.seq
 762512207     gbpln260.seq
 724647884     gbpln261.seq
 679679449     gbpln262.seq
 784312844     gbpln263.seq
 684180819     gbpln264.seq
 873292213     gbpln265.seq
 827422505     gbpln266.seq
 815925825     gbpln267.seq
 779009585     gbpln268.seq
 739747654     gbpln269.seq
 323729344     gbpln27.seq
 834950434     gbpln270.seq
 663096073     gbpln271.seq
 849628701     gbpln272.seq
 803882830     gbpln273.seq
 794420470     gbpln274.seq
 760127459     gbpln275.seq
 714663802     gbpln276.seq
 801095950     gbpln277.seq
 668869887     gbpln278.seq
 854770002     gbpln279.seq
 499081327     gbpln28.seq
 805931576     gbpln280.seq
 798923954     gbpln281.seq
 766411223     gbpln282.seq
 723133936     gbpln283.seq
 803351408     gbpln284.seq
 664176987     gbpln285.seq
 854339916     gbpln286.seq
 803900400     gbpln287.seq
 791449620     gbpln288.seq
 761145205     gbpln289.seq
 497392106     gbpln29.seq
 715062603     gbpln290.seq
 806379176     gbpln291.seq
 668964953     gbpln292.seq
 870939392     gbpln293.seq
 809408813     gbpln294.seq
 801514137     gbpln295.seq
 768794024     gbpln296.seq
 723644689     gbpln297.seq
 815153418     gbpln298.seq
 661177159     gbpln299.seq
 499928950     gbpln3.seq
 499424594     gbpln30.seq
 846934671     gbpln300.seq
 794708793     gbpln301.seq
 789781753     gbpln302.seq
 764576068     gbpln303.seq
 711115451     gbpln304.seq
 797517245     gbpln305.seq
 691953899     gbpln306.seq
 888406351     gbpln307.seq
 835271741     gbpln308.seq
 823533989     gbpln309.seq
 103293547     gbpln31.seq
 787819193     gbpln310.seq
 748786657     gbpln311.seq
 838184652     gbpln312.seq
 488175424     gbpln313.seq
 439661491     gbpln314.seq
 155704371     gbpln315.seq
 758806100     gbpln316.seq
 898446949     gbpln317.seq
 628489896     gbpln318.seq
1024113089     gbpln319.seq
 496565850     gbpln32.seq
1032878661     gbpln320.seq
 858694781     gbpln321.seq
 960391204     gbpln322.seq
1090094606     gbpln323.seq
 781959143     gbpln324.seq
 946995961     gbpln325.seq
 857542781     gbpln326.seq
 656405285     gbpln327.seq
 907889097     gbpln328.seq
 896386890     gbpln329.seq
 498203430     gbpln33.seq
 726432335     gbpln330.seq
 798296822     gbpln331.seq
 918393750     gbpln332.seq
 584961784     gbpln333.seq
 948865971     gbpln334.seq
 954536271     gbpln335.seq
 819735731     gbpln336.seq
 756588093     gbpln337.seq
 876067119     gbpln338.seq
 625446321     gbpln339.seq
 349197988     gbpln34.seq
 977801494     gbpln340.seq
 854357980     gbpln341.seq
 807732556     gbpln342.seq
 947696453     gbpln343.seq
1067629605     gbpln344.seq
 822222048     gbpln345.seq
 950272996     gbpln346.seq
 845138843     gbpln347.seq
 643846993     gbpln348.seq
 894745096     gbpln349.seq
 488667009     gbpln35.seq
 893352134     gbpln350.seq
 722578984     gbpln351.seq
 776227316     gbpln352.seq
 899750467     gbpln353.seq
 592059964     gbpln354.seq
 933986451     gbpln355.seq
 939527664     gbpln356.seq
 810117922     gbpln357.seq
 765938558     gbpln358.seq
 886537018     gbpln359.seq
 497060599     gbpln36.seq
 623519964     gbpln360.seq
 996940649     gbpln361.seq
1030190034     gbpln362.seq
 832828033     gbpln363.seq
 956342979     gbpln364.seq
1134286144     gbpln365.seq
 790513299     gbpln366.seq
 944161893     gbpln367.seq
 860035788     gbpln368.seq
 647268685     gbpln369.seq
 332336790     gbpln37.seq
 902239623     gbpln370.seq
 611029440     gbpln371.seq
 734907577     gbpln372.seq
 787834228     gbpln373.seq
 910724363     gbpln374.seq
 606016896     gbpln375.seq
 961485234     gbpln376.seq
1242775191     gbpln377.seq
 816670128     gbpln378.seq
 636658925     gbpln379.seq
 496457212     gbpln38.seq
 818591771     gbpln380.seq
 766580884     gbpln381.seq
 752100829     gbpln382.seq
 724519993     gbpln383.seq
 690955648     gbpln384.seq
 769738288     gbpln385.seq
 750738544     gbpln386.seq
 872184389     gbpln387.seq
 624480879     gbpln388.seq
 995069022     gbpln389.seq
 487441358     gbpln39.seq
1012956234     gbpln390.seq
 827074347     gbpln391.seq
 940621783     gbpln392.seq
1079418810     gbpln393.seq
 776922106     gbpln394.seq
 938380968     gbpln395.seq
 848757671     gbpln396.seq
 643572913     gbpln397.seq
 891714442     gbpln398.seq
 878638403     gbpln399.seq
 499894364     gbpln4.seq
 477280628     gbpln40.seq
 721632671     gbpln400.seq
 779156122     gbpln401.seq
 895553446     gbpln402.seq
 604678568     gbpln403.seq
 931006295     gbpln404.seq
 933660027     gbpln405.seq
 810459540     gbpln406.seq
 761872100     gbpln407.seq
 878702815     gbpln408.seq
 627081460     gbpln409.seq
 433198965     gbpln41.seq
 994320235     gbpln410.seq
 999434327     gbpln411.seq
 823789349     gbpln412.seq
 945629782     gbpln413.seq
1062113821     gbpln414.seq
 792298939     gbpln415.seq
 941851700     gbpln416.seq
 850142413     gbpln417.seq
 656955691     gbpln418.seq
 904094753     gbpln419.seq
 317392296     gbpln42.seq
 900193903     gbpln420.seq
 728906821     gbpln421.seq
 741172650     gbpln422.seq
 898719079     gbpln423.seq
 599002526     gbpln424.seq
 937117048     gbpln425.seq
 936021119     gbpln426.seq
 812696702     gbpln427.seq
 746628212     gbpln428.seq
 897168807     gbpln429.seq
 494333229     gbpln43.seq
 626698501     gbpln430.seq
1007072101     gbpln431.seq
1000831797     gbpln432.seq
 841918855     gbpln433.seq
 963426816     gbpln434.seq
1093654114     gbpln435.seq
 791118382     gbpln436.seq
 959940756     gbpln437.seq
 853263842     gbpln438.seq
 648051398     gbpln439.seq
 475206592     gbpln44.seq
 901282075     gbpln440.seq
 923491092     gbpln441.seq
 732477869     gbpln442.seq
 789987733     gbpln443.seq
 926022053     gbpln444.seq
 610840579     gbpln445.seq
 949759032     gbpln446.seq
 955444559     gbpln447.seq
 818480442     gbpln448.seq
 752251380     gbpln449.seq
 468207974     gbpln45.seq
 897893149     gbpln450.seq
 631111272     gbpln451.seq
1022032953     gbpln452.seq
1006306956     gbpln453.seq
 837035085     gbpln454.seq
 966140819     gbpln455.seq
1090560006     gbpln456.seq
 800164754     gbpln457.seq
 959884028     gbpln458.seq
 886916735     gbpln459.seq
 477377265     gbpln46.seq
 641540050     gbpln460.seq
 910168783     gbpln461.seq
 908785549     gbpln462.seq
 729527181     gbpln463.seq
 797552105     gbpln464.seq
 910975470     gbpln465.seq
 616026199     gbpln466.seq
 945685366     gbpln467.seq
 953145956     gbpln468.seq
 820081609     gbpln469.seq
 272302955     gbpln47.seq
 763165947     gbpln470.seq
 870898266     gbpln471.seq
 618200825     gbpln472.seq
1009123187     gbpln473.seq
1016689515     gbpln474.seq
 832912303     gbpln475.seq
 952656374     gbpln476.seq
1065835283     gbpln477.seq
 776075044     gbpln478.seq
 935940025     gbpln479.seq
 172902191     gbpln48.seq
 846831932     gbpln480.seq
 641399988     gbpln481.seq
 892709705     gbpln482.seq
 594848385     gbpln483.seq
 720169483     gbpln484.seq
 780564861     gbpln485.seq
 888344689     gbpln486.seq
 610800072     gbpln487.seq
 934713391     gbpln488.seq
1233388213     gbpln489.seq
 471233536     gbpln49.seq
 807523234     gbpln490.seq
     19542     gbpln491.seq
 757881986     gbpln492.seq
 889760627     gbpln493.seq
 635890046     gbpln494.seq
1007873898     gbpln495.seq
1015524558     gbpln496.seq
 836625022     gbpln497.seq
 959076059     gbpln498.seq
1077416379     gbpln499.seq
 464665499     gbpln5.seq
 455042321     gbpln50.seq
 789416089     gbpln500.seq
 958430056     gbpln501.seq
 877922843     gbpln502.seq
 648665455     gbpln503.seq
 907513209     gbpln504.seq
 904978028     gbpln505.seq
 727024880     gbpln506.seq
 789120540     gbpln507.seq
 898507915     gbpln508.seq
 617229811     gbpln509.seq
 488809223     gbpln51.seq
 942711764     gbpln510.seq
 964780021     gbpln511.seq
 818917331     gbpln512.seq
 755294557     gbpln513.seq
 882064051     gbpln514.seq
 627203691     gbpln515.seq
 993595919     gbpln516.seq
1021497440     gbpln517.seq
 827286497     gbpln518.seq
 962451301     gbpln519.seq
 355272263     gbpln52.seq
1082256067     gbpln520.seq
 781463827     gbpln521.seq
 919665368     gbpln522.seq
 852133929     gbpln523.seq
 645388382     gbpln524.seq
 905574854     gbpln525.seq
 906714977     gbpln526.seq
 718743537     gbpln527.seq
 787529633     gbpln528.seq
 910251919     gbpln529.seq
 200538454     gbpln53.seq
 608518276     gbpln530.seq
 934541265     gbpln531.seq
 954054955     gbpln532.seq
 806443717     gbpln533.seq
 271158249     gbpln534.seq
   9838016     gbpln535.seq
  10182293     gbpln536.seq
 766528189     gbpln537.seq
  10567626     gbpln538.seq
 756143249     gbpln539.seq
 377219536     gbpln54.seq
 878426054     gbpln540.seq
 631056251     gbpln541.seq
 993852367     gbpln542.seq
1020132695     gbpln543.seq
 830166807     gbpln544.seq
 955723315     gbpln545.seq
1057964328     gbpln546.seq
 784007552     gbpln547.seq
 947940191     gbpln548.seq
 857511193     gbpln549.seq
 375192640     gbpln55.seq
 649137171     gbpln550.seq
 903393879     gbpln551.seq
 908180396     gbpln552.seq
 721135945     gbpln553.seq
 786739709     gbpln554.seq
 918070756     gbpln555.seq
 603192844     gbpln556.seq
 938102555     gbpln557.seq
 955978436     gbpln558.seq
 813787878     gbpln559.seq
 386441749     gbpln56.seq
 639701128     gbpln560.seq
 468393329     gbpln561.seq
 499432094     gbpln562.seq
 498557075     gbpln563.seq
  20746959     gbpln564.seq
 768129678     gbpln565.seq
 891209633     gbpln566.seq
1017177961     gbpln567.seq
1036708108     gbpln568.seq
 980496603     gbpln569.seq
 472726092     gbpln57.seq
1096870510     gbpln570.seq
 964601805     gbpln571.seq
 883690282     gbpln572.seq
 879367269     gbpln573.seq
 922136688     gbpln574.seq
 805432021     gbpln575.seq
 912345991     gbpln576.seq
 954500353     gbpln577.seq
 944560088     gbpln578.seq
  29467767     gbpln579.seq
 473293925     gbpln58.seq
 395831925     gbpln580.seq
 499999267     gbpln581.seq
 499997885     gbpln582.seq
 456318797     gbpln583.seq
 499998571     gbpln584.seq
 499997994     gbpln585.seq
 499958080     gbpln586.seq
   4593250     gbpln587.seq
 499999408     gbpln588.seq
 499832869     gbpln589.seq
 476593700     gbpln59.seq
 448128429     gbpln590.seq
 499713256     gbpln591.seq
 499887129     gbpln592.seq
 499997550     gbpln593.seq
 104124843     gbpln594.seq
 499992043     gbpln6.seq
 434249982     gbpln60.seq
 440487400     gbpln61.seq
 444203819     gbpln62.seq
 189178941     gbpln63.seq
 460468033     gbpln64.seq
 440542307     gbpln65.seq
 452992006     gbpln66.seq
 497916786     gbpln67.seq
 480376128     gbpln68.seq
  71745252     gbpln69.seq
 499959124     gbpln7.seq
 450090635     gbpln70.seq
 472129613     gbpln71.seq
 477884160     gbpln72.seq
 460004048     gbpln73.seq
 430418757     gbpln74.seq
 441540696     gbpln75.seq
 433637010     gbpln76.seq
 498225038     gbpln77.seq
 107501131     gbpln78.seq
 449964742     gbpln79.seq
 225235379     gbpln8.seq
 422837725     gbpln80.seq
 383453843     gbpln81.seq
 376172115     gbpln82.seq
 326317072     gbpln83.seq
 320571252     gbpln84.seq
 286199716     gbpln85.seq
 277716231     gbpln86.seq
 499733063     gbpln87.seq
  63743689     gbpln88.seq
 391026515     gbpln89.seq
 499990067     gbpln9.seq
 362500946     gbpln90.seq
 390024684     gbpln91.seq
 341773034     gbpln92.seq
 199854530     gbpln93.seq
 486884285     gbpln94.seq
 461536811     gbpln95.seq
 497242619     gbpln96.seq
 493116300     gbpln97.seq
 498250537     gbpln98.seq
 497689986     gbpln99.seq
 148365360     gbpri1.seq
 499825450     gbpri10.seq
 499978638     gbpri11.seq
 248926180     gbpri12.seq
 499853606     gbpri13.seq
 318530964     gbpri14.seq
 162642332     gbpri15.seq
 494709737     gbpri16.seq
 499956353     gbpri17.seq
 499952905     gbpri18.seq
 499962101     gbpri19.seq
 499830358     gbpri2.seq
 254317986     gbpri20.seq
 317623183     gbpri21.seq
 301998886     gbpri22.seq
 491209604     gbpri23.seq
 445784104     gbpri24.seq
 381563743     gbpri25.seq
 343179555     gbpri26.seq
 476586505     gbpri27.seq
 474070691     gbpri28.seq
 368091958     gbpri29.seq
 499891257     gbpri3.seq
 499999739     gbpri30.seq
  73658683     gbpri31.seq
 499987105     gbpri32.seq
 499998293     gbpri33.seq
 430418935     gbpri34.seq
 499993635     gbpri35.seq
 499998952     gbpri36.seq
 316316671     gbpri37.seq
 499973504     gbpri38.seq
 463552831     gbpri39.seq
 499855390     gbpri4.seq
 314294173     gbpri40.seq
 258775295     gbpri41.seq
 499999774     gbpri42.seq
 499998780     gbpri43.seq
 499884976     gbpri44.seq
  35026735     gbpri45.seq
 499729136     gbpri5.seq
 393528728     gbpri6.seq
 499802910     gbpri7.seq
 499984764     gbpri8.seq
 499967010     gbpri9.seq
    509174     gbrel.txt
 499906814     gbrod1.seq
 499996171     gbrod10.seq
   6029138     gbrod11.seq
 499812135     gbrod12.seq
 203924668     gbrod13.seq
 499994095     gbrod14.seq
 499997569     gbrod15.seq
 499997059     gbrod16.seq
 294126346     gbrod17.seq
 397289802     gbrod18.seq
 485622431     gbrod19.seq
 499802341     gbrod2.seq
 447177606     gbrod20.seq
 401874104     gbrod21.seq
 366906621     gbrod22.seq
 178573599     gbrod23.seq
 488460696     gbrod24.seq
 424418862     gbrod25.seq
 451727059     gbrod26.seq
 499112036     gbrod27.seq
 467946548     gbrod28.seq
 425428799     gbrod29.seq
 499880319     gbrod3.seq
 380509124     gbrod30.seq
 359291146     gbrod31.seq
 441031541     gbrod32.seq
 489661762     gbrod33.seq
 301144399     gbrod34.seq
 245696648     gbrod35.seq
 444533022     gbrod36.seq
 404900421     gbrod37.seq
 350078681     gbrod38.seq
 484303056     gbrod39.seq
 499702715     gbrod4.seq
 399105451     gbrod40.seq
 311442060     gbrod41.seq
 441713729     gbrod42.seq
 398906813     gbrod43.seq
 493373336     gbrod44.seq
 407105696     gbrod45.seq
 117842878     gbrod46.seq
 488265022     gbrod47.seq
 434197329     gbrod48.seq
 412800312     gbrod49.seq
 499960342     gbrod5.seq
 454365663     gbrod50.seq
 382748472     gbrod51.seq
 428038719     gbrod52.seq
 487918369     gbrod53.seq
 440586747     gbrod54.seq
 359290553     gbrod55.seq
 423648241     gbrod56.seq
  80291490     gbrod6.seq
 499846851     gbrod7.seq
 499742719     gbrod8.seq
 499945822     gbrod9.seq
 500000046     gbsts1.seq
 499998618     gbsts10.seq
 433284460     gbsts11.seq
 499996680     gbsts2.seq
  38061494     gbsts3.seq
 499998792     gbsts4.seq
 499996883     gbsts5.seq
 456729482     gbsts6.seq
 499998288     gbsts7.seq
 499997752     gbsts8.seq
  21526219     gbsts9.seq
 300830890     gbsyn1.seq
 484840372     gbsyn10.seq
 420813753     gbsyn11.seq
 490139440     gbsyn12.seq
 343340422     gbsyn13.seq
 372527348     gbsyn14.seq
 417861289     gbsyn15.seq
 448312981     gbsyn16.seq
 416378132     gbsyn17.seq
 453065790     gbsyn18.seq
 263307032     gbsyn19.seq
 343340424     gbsyn2.seq
 484840366     gbsyn20.seq
 420813747     gbsyn21.seq
 500000171     gbsyn22.seq
 456181573     gbsyn23.seq
 499993129     gbsyn24.seq
 500000172     gbsyn25.seq
 499994801     gbsyn26.seq
 499922919     gbsyn27.seq
  23024220     gbsyn28.seq
 372527353     gbsyn3.seq
 417861297     gbsyn4.seq
 448312992     gbsyn5.seq
  81377357     gbsyn6.seq
 470781602     gbsyn7.seq
 317285242     gbsyn8.seq
 263307034     gbsyn9.seq
 499999287     gbtsa1.seq
 500000000     gbtsa10.seq
 499997439     gbtsa100.seq
 499999811     gbtsa101.seq
 499996108     gbtsa102.seq
 404671505     gbtsa103.seq
 499996434     gbtsa104.seq
 499998444     gbtsa105.seq
 499998535     gbtsa106.seq
 473627173     gbtsa107.seq
 499999949     gbtsa108.seq
 499997426     gbtsa109.seq
 499997424     gbtsa11.seq
 236376146     gbtsa110.seq
 499999916     gbtsa111.seq
 499999178     gbtsa112.seq
 499998485     gbtsa113.seq
 499999039     gbtsa114.seq
  32605644     gbtsa115.seq
 500000071     gbtsa116.seq
 499996732     gbtsa117.seq
 499998477     gbtsa118.seq
 469116011     gbtsa119.seq
 280130073     gbtsa12.seq
 499999748     gbtsa120.seq
 499999037     gbtsa121.seq
 499998875     gbtsa122.seq
 278733702     gbtsa123.seq
 499999266     gbtsa124.seq
 499999256     gbtsa125.seq
 499998286     gbtsa126.seq
 421530147     gbtsa127.seq
 499996235     gbtsa13.seq
 499999964     gbtsa14.seq
 151618535     gbtsa15.seq
 499999603     gbtsa16.seq
 499996688     gbtsa17.seq
 258373800     gbtsa18.seq
 499997252     gbtsa19.seq
 499998984     gbtsa2.seq
 499998175     gbtsa20.seq
 499998955     gbtsa21.seq
  66356608     gbtsa22.seq
 499999053     gbtsa23.seq
 499997273     gbtsa24.seq
 499999492     gbtsa25.seq
 275956906     gbtsa26.seq
 499999635     gbtsa27.seq
 499999791     gbtsa28.seq
  71311344     gbtsa29.seq
 146878920     gbtsa3.seq
 499998196     gbtsa30.seq
 499999529     gbtsa31.seq
 153218059     gbtsa32.seq
 499998095     gbtsa33.seq
 499996730     gbtsa34.seq
 499999647     gbtsa35.seq
 488666701     gbtsa36.seq
 499999485     gbtsa37.seq
 499997575     gbtsa38.seq
 499998617     gbtsa39.seq
 499998567     gbtsa4.seq
 225919334     gbtsa40.seq
 499999675     gbtsa41.seq
 499991892     gbtsa42.seq
 499998590     gbtsa43.seq
 174944914     gbtsa44.seq
 499998997     gbtsa45.seq
 499999560     gbtsa46.seq
 354820490     gbtsa47.seq
 499999373     gbtsa48.seq
 499997080     gbtsa49.seq
 499999940     gbtsa5.seq
 290846118     gbtsa50.seq
 499999724     gbtsa51.seq
 499999766     gbtsa52.seq
 394617331     gbtsa53.seq
 499998483     gbtsa54.seq
 499998629     gbtsa55.seq
 499998068     gbtsa56.seq
 350275966     gbtsa57.seq
 499999428     gbtsa58.seq
 499999306     gbtsa59.seq
  50314135     gbtsa6.seq
 499998097     gbtsa60.seq
 221419020     gbtsa61.seq
 499999964     gbtsa62.seq
 499999918     gbtsa63.seq
 259941502     gbtsa64.seq
 499999212     gbtsa65.seq
 465402653     gbtsa66.seq
 499998493     gbtsa67.seq
 499998356     gbtsa68.seq
 499996902     gbtsa69.seq
 499998877     gbtsa7.seq
 165103829     gbtsa70.seq
 499997567     gbtsa71.seq
 500000162     gbtsa72.seq
 499998185     gbtsa73.seq
   2512297     gbtsa74.seq
 499997981     gbtsa75.seq
 499998780     gbtsa76.seq
 131354879     gbtsa77.seq
 499998723     gbtsa78.seq
 499997516     gbtsa79.seq
 499999768     gbtsa8.seq
  30973467     gbtsa80.seq
 499999375     gbtsa81.seq
 499998969     gbtsa82.seq
 499999731     gbtsa83.seq
 499998462     gbtsa84.seq
  45716037     gbtsa85.seq
 499997106     gbtsa86.seq
 499998546     gbtsa87.seq
 499998812     gbtsa88.seq
  81423881     gbtsa89.seq
 266838890     gbtsa9.seq
 499999824     gbtsa90.seq
 389215892     gbtsa91.seq
 499998191     gbtsa92.seq
 499994249     gbtsa93.seq
 499998640     gbtsa94.seq
 208350764     gbtsa95.seq
 499995192     gbtsa96.seq
 499998487     gbtsa97.seq
 499999226     gbtsa98.seq
 230571289     gbtsa99.seq
   2179762     gbuna1.seq
 499998369     gbvrl1.seq
 499996339     gbvrl10.seq
 217921918     gbvrl11.seq
 499997040     gbvrl12.seq
 499998122     gbvrl13.seq
 133884777     gbvrl14.seq
 499996949     gbvrl15.seq
 499999385     gbvrl16.seq
 315066989     gbvrl17.seq
 499997430     gbvrl18.seq
 499998033     gbvrl19.seq
 499998773     gbvrl2.seq
 345124948     gbvrl20.seq
 499992601     gbvrl21.seq
 499999444     gbvrl22.seq
 367511581     gbvrl23.seq
 499999320     gbvrl24.seq
 499996295     gbvrl25.seq
 312833807     gbvrl26.seq
 499998432     gbvrl27.seq
 499997867     gbvrl28.seq
 499997930     gbvrl29.seq
 370474989     gbvrl3.seq
  46313767     gbvrl30.seq
 499998286     gbvrl31.seq
 499998926     gbvrl32.seq
 409436911     gbvrl33.seq
 500000076     gbvrl34.seq
 499997634     gbvrl35.seq
 384413793     gbvrl36.seq
 499998709     gbvrl37.seq
 499982737     gbvrl38.seq
 499967935     gbvrl39.seq
 499997372     gbvrl4.seq
  16701636     gbvrl40.seq
 499990739     gbvrl41.seq
 499982060     gbvrl42.seq
 499991759     gbvrl43.seq
 167984277     gbvrl44.seq
 499998494     gbvrl5.seq
 499998999     gbvrl6.seq
 499998032     gbvrl7.seq
 301323105     gbvrl8.seq
 499983194     gbvrl9.seq
 499793149     gbvrt1.seq
 289935612     gbvrt10.seq
 339881206     gbvrt100.seq
 404715122     gbvrt101.seq
 489464189     gbvrt102.seq
 499106075     gbvrt103.seq
 486716913     gbvrt104.seq
  58362214     gbvrt105.seq
 436487263     gbvrt106.seq
 486733599     gbvrt107.seq
 492783918     gbvrt108.seq
 423399209     gbvrt109.seq
  87348323     gbvrt11.seq
 280513212     gbvrt110.seq
 475547766     gbvrt111.seq
 480350778     gbvrt112.seq
 495762194     gbvrt113.seq
  63704590     gbvrt114.seq
 979124861     gbvrt115.seq
 838606404     gbvrt116.seq
 678361887     gbvrt117.seq
 476489691     gbvrt118.seq
 461392781     gbvrt119.seq
 499776413     gbvrt12.seq
 438813789     gbvrt120.seq
 394333916     gbvrt121.seq
 313817861     gbvrt122.seq
 288999337     gbvrt123.seq
 280185755     gbvrt124.seq
 407764323     gbvrt125.seq
 421854186     gbvrt126.seq
 478932645     gbvrt127.seq
 480028007     gbvrt128.seq
 438022009     gbvrt129.seq
 284656236     gbvrt13.seq
 174441466     gbvrt130.seq
 487902327     gbvrt131.seq
 456814552     gbvrt132.seq
 462308829     gbvrt133.seq
 168813991     gbvrt134.seq
 455914575     gbvrt135.seq
 469538684     gbvrt136.seq
 479142159     gbvrt137.seq
 211433853     gbvrt138.seq
 481251522     gbvrt139.seq
  15637437     gbvrt14.seq
 475910668     gbvrt140.seq
 366784880     gbvrt141.seq
 464881586     gbvrt142.seq
 697335097     gbvrt143.seq
 670835450     gbvrt144.seq
 524090200     gbvrt145.seq
 413419773     gbvrt146.seq
 345316791     gbvrt147.seq
 329840736     gbvrt148.seq
 250750064     gbvrt149.seq
  36032850     gbvrt15.seq
 486599684     gbvrt150.seq
 364885005     gbvrt151.seq
 448394467     gbvrt152.seq
 471786712     gbvrt153.seq
 393642536     gbvrt154.seq
 355134416     gbvrt155.seq
 470602746     gbvrt156.seq
 448657488     gbvrt157.seq
 384724558     gbvrt158.seq
 432320923     gbvrt159.seq
  18507952     gbvrt16.seq
 470227786     gbvrt160.seq
 497676594     gbvrt161.seq
 441894493     gbvrt162.seq
 496133395     gbvrt163.seq
 382102573     gbvrt164.seq
 431425246     gbvrt165.seq
 474666330     gbvrt166.seq
 479195821     gbvrt167.seq
 352850318     gbvrt168.seq
 479851070     gbvrt169.seq
 497676663     gbvrt17.seq
 497038176     gbvrt170.seq
 432276498     gbvrt171.seq
 439843808     gbvrt172.seq
 469531790     gbvrt173.seq
 496015817     gbvrt174.seq
 488626307     gbvrt175.seq
 432135676     gbvrt176.seq
  70119528     gbvrt177.seq
 491056051     gbvrt178.seq
 457305144     gbvrt179.seq
 497173924     gbvrt18.seq
 478791561     gbvrt180.seq
 450956856     gbvrt181.seq
  68350586     gbvrt182.seq
 490842556     gbvrt183.seq
 463385772     gbvrt184.seq
 446788975     gbvrt185.seq
 438416202     gbvrt186.seq
 170595769     gbvrt187.seq
 451342688     gbvrt188.seq
 474563355     gbvrt189.seq
 481350583     gbvrt19.seq
 461335548     gbvrt190.seq
 436658187     gbvrt191.seq
 154682616     gbvrt192.seq
 456837606     gbvrt193.seq
 488930196     gbvrt194.seq
 466502331     gbvrt195.seq
 455725140     gbvrt196.seq
 453475816     gbvrt197.seq
 462276007     gbvrt198.seq
 497473221     gbvrt199.seq
 499893915     gbvrt2.seq
 400795564     gbvrt20.seq
 499283767     gbvrt200.seq
 481742871     gbvrt201.seq
  54779872     gbvrt202.seq
 477319411     gbvrt203.seq
 495274870     gbvrt204.seq
 486008997     gbvrt205.seq
 333884650     gbvrt206.seq
 450550965     gbvrt207.seq
 494368803     gbvrt208.seq
 470694583     gbvrt209.seq
 488197715     gbvrt21.seq
 470514883     gbvrt210.seq
 229544114     gbvrt211.seq
 499993364     gbvrt212.seq
 499999776     gbvrt213.seq
 439480840     gbvrt214.seq
 479291185     gbvrt22.seq
 480798341     gbvrt23.seq
 499274554     gbvrt24.seq
 483255170     gbvrt25.seq
 484153821     gbvrt26.seq
  65325604     gbvrt27.seq
   4698304     gbvrt28.seq
  14151693     gbvrt29.seq
 465065833     gbvrt3.seq
  21383246     gbvrt30.seq
  90967413     gbvrt31.seq
 499908979     gbvrt32.seq
 500000156     gbvrt33.seq
 499998090     gbvrt34.seq
  55607827     gbvrt35.seq
 499998205     gbvrt36.seq
 499998591     gbvrt37.seq
 364499078     gbvrt38.seq
 499998580     gbvrt39.seq
 179100370     gbvrt4.seq
 444342293     gbvrt40.seq
 500000045     gbvrt41.seq
  28361622     gbvrt42.seq
 443905568     gbvrt43.seq
 499998047     gbvrt44.seq
 386453992     gbvrt45.seq
 499999476     gbvrt46.seq
 278517986     gbvrt47.seq
 499998458     gbvrt48.seq
 493717779     gbvrt49.seq
 448778544     gbvrt5.seq
 499741976     gbvrt50.seq
 487895233     gbvrt51.seq
 497527342     gbvrt52.seq
 396367123     gbvrt53.seq
 202128841     gbvrt54.seq
 123737443     gbvrt55.seq
 483323044     gbvrt56.seq
 481925504     gbvrt57.seq
 499999199     gbvrt58.seq
 499926681     gbvrt59.seq
 490703641     gbvrt6.seq
 296494910     gbvrt60.seq
 491037842     gbvrt61.seq
 492375887     gbvrt62.seq
 479677491     gbvrt63.seq
 480814553     gbvrt64.seq
 362168611     gbvrt65.seq
 490950275     gbvrt66.seq
 475400582     gbvrt67.seq
 489403698     gbvrt68.seq
 352369869     gbvrt69.seq
 499120716     gbvrt7.seq
 465368608     gbvrt70.seq
 488761954     gbvrt71.seq
 189335727     gbvrt72.seq
 443535502     gbvrt73.seq
 421190409     gbvrt74.seq
 391875588     gbvrt75.seq
 372304558     gbvrt76.seq
 293994257     gbvrt77.seq
 265964554     gbvrt78.seq
 252405654     gbvrt79.seq
 483655698     gbvrt8.seq
 496924908     gbvrt80.seq
 428777944     gbvrt81.seq
 385782563     gbvrt82.seq
 401943336     gbvrt83.seq
 480032615     gbvrt84.seq
 474823439     gbvrt85.seq
 480706138     gbvrt86.seq
  89575236     gbvrt87.seq
 435875138     gbvrt88.seq
 487966705     gbvrt89.seq
 263651192     gbvrt9.seq
 497561523     gbvrt90.seq
 468903694     gbvrt91.seq
1063697024     gbvrt92.seq
1045817107     gbvrt93.seq
 754876349     gbvrt94.seq
 616753639     gbvrt95.seq
 490283567     gbvrt96.seq
 470650802     gbvrt97.seq
 397152541     gbvrt98.seq
 351566465     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         101593     185853961
BCT10        102        242799654
BCT100       104        221252195
BCT101       100        224644129
BCT102       83         222703364
BCT103       21         86233168
BCT104       68         221578114
BCT105       87         219795379
BCT106       87         223588406
BCT107       80         226287962
BCT108       20         45564131
BCT109       124        217933644
BCT11        149        243367132
BCT110       53         217706139
BCT111       90         227492926
BCT112       57         149506400
BCT113       93         227745457
BCT114       73         219469130
BCT115       112        221134503
BCT116       78         197436829
BCT117       155        218036729
BCT118       84         220629983
BCT119       79         216070642
BCT12        161        256952125
BCT120       128        225808884
BCT121       103        220700622
BCT122       83         220906248
BCT123       87         188328214
BCT124       115        225967887
BCT125       92         220409897
BCT126       158        214217907
BCT127       88         207032597
BCT128       140        220978157
BCT129       63         217844098
BCT13        170        237845538
BCT130       90         214900948
BCT131       125        217101319
BCT132       88         223616604
BCT133       21         65066945
BCT134       174        220602790
BCT135       125        222941413
BCT136       123        219745957
BCT137       166        221868080
BCT138       48         154061987
BCT139       104        218683705
BCT14        161        246345908
BCT140       113        217389079
BCT141       138        222247056
BCT142       109        220993944
BCT143       101        223667628
BCT144       118        156232056
BCT145       95         229134325
BCT146       104        222093509
BCT147       97         225368543
BCT148       116        220401677
BCT149       94         219188969
BCT15        293        254177829
BCT150       134        220654115
BCT151       36         70525291
BCT152       169        220902023
BCT153       100        223727909
BCT154       94         222167747
BCT155       94         214484227
BCT156       71         223304376
BCT157       123        228310888
BCT158       150        228808455
BCT159       80         212882661
BCT16        79         174372895
BCT160       100        225798024
BCT161       96         228319556
BCT162       139        223679571
BCT163       77         220323988
BCT164       20         67790727
BCT165       119        222290855
BCT166       153        228109371
BCT167       69         216057546
BCT168       80         115502557
BCT169       111        216184725
BCT17        135        236293491
BCT170       156        227708035
BCT171       111        220250972
BCT172       89         136614524
BCT173       133        229717687
BCT174       111        208992481
BCT175       102        218457632
BCT176       80         222971175
BCT177       12         14664608
BCT178       98         220152536
BCT179       133        227333368
BCT18        108        230497239
BCT180       125        230906352
BCT181       117        242580388
BCT182       116        233244770
BCT183       29         81157459
BCT184       138        219191771
BCT185       86         222769161
BCT186       108        224413134
BCT187       118        222428501
BCT188       67         117928221
BCT189       127        226982633
BCT19        195        220196232
BCT190       135        255022614
BCT191       119        228641891
BCT192       153        217483726
BCT193       42         78130485
BCT194       119        217568478
BCT195       116        219209582
BCT196       90         220191961
BCT197       103        232290071
BCT198       97         179603936
BCT199       97         234475408
BCT2         106        226909535
BCT20        150        176838183
BCT200       102        220656832
BCT201       100        218053674
BCT202       94         224743372
BCT203       104        226992367
BCT204       107        231904945
BCT205       65         141233235
BCT206       104        221661048
BCT207       111        222476358
BCT208       99         224960460
BCT209       71         266229652
BCT21        186        219760235
BCT210       75         254647899
BCT211       106        225376718
BCT212       176        219971681
BCT213       137        226750080
BCT214       52         97375579
BCT215       324        275336670
BCT216       116        218712797
BCT217       118        218047051
BCT218       42         70660921
BCT219       89         220099828
BCT22        135        220664640
BCT220       85         224231671
BCT221       85         236035678
BCT222       102        223628599
BCT223       20         45849980
BCT224       60         216868170
BCT225       120        221119124
BCT226       87         227479657
BCT227       89         224272827
BCT228       23         48157116
BCT229       160        280339359
BCT23        46         222199974
BCT230       86         231776776
BCT231       96         219765338
BCT232       135        191926241
BCT233       109        262921422
BCT234       72         217635148
BCT235       100        214909619
BCT236       76         205489624
BCT237       139        302417525
BCT238       68         237086992
BCT239       95         218513066
BCT24        127        231293031
BCT240       151        222468975
BCT241       141        300447308
BCT242       4          6239871
BCT243       146        273570514
BCT244       107        257324711
BCT245       36         236041377
BCT246       54         195940579
BCT247       117        221820560
BCT248       126        219675710
BCT249       87         248035010
BCT25        142        238997778
BCT250       79         196634423
BCT251       125        215030391
BCT252       113        223212915
BCT253       136        232444902
BCT254       115        228305978
BCT255       111        223873976
BCT256       115        233153048
BCT257       6          14805699
BCT258       107        221082397
BCT259       82         220703210
BCT26        414        50606421
BCT260       96         230101903
BCT261       124        223965738
BCT262       81         239732070
BCT263       105        230643389
BCT264       104        228392338
BCT265       17         30138887
BCT266       130        229051582
BCT267       160        213628166
BCT268       163        210208459
BCT269       124        243343666
BCT27        5200       7533877
BCT270       106        225910629
BCT271       142        234057254
BCT272       140        252093168
BCT273       47         125593949
BCT274       138        226796021
BCT275       98         213337155
BCT276       102        224525735
BCT277       115        223369574
BCT278       149        218019638
BCT279       159        223395140
BCT28        10402      13141863
BCT280       31         62919786
BCT281       110        224329738
BCT282       109        219771943
BCT283       75         217285522
BCT284       83         214997985
BCT285       96         149111017
BCT286       88         244048892
BCT287       107        228886299
BCT288       83         221517737
BCT289       61         216100377
BCT29        53918      202021542
BCT290       75         170693762
BCT291       115        219540003
BCT292       101        218974130
BCT293       124        216924787
BCT294       90         217527347
BCT295       140        185056878
BCT296       121        249554866
BCT297       108        218674125
BCT298       79         227677553
BCT299       67         223677267
BCT3         37537      123328135
BCT30        189        216139113
BCT300       78         158102491
BCT301       128        238885544
BCT302       197        234044756
BCT303       149        219659340
BCT304       120        215711231
BCT305       118        186704652
BCT306       146        245523582
BCT307       123        240564041
BCT308       73         228705510
BCT309       71         222846364
BCT31        103        228704622
BCT310       126        244109969
BCT311       1237       226681786
BCT312       93         233632417
BCT313       22         50091985
BCT314       101        222185425
BCT315       126        217279454
BCT316       105        213801865
BCT317       131        221253768
BCT318       227        223095757
BCT319       175        223250801
BCT32        118        231551515
BCT320       113        218791351
BCT321       34         66282371
BCT322       123        216507866
BCT323       147        222325943
BCT324       144        216203064
BCT325       121        229010250
BCT326       151        237086539
BCT327       95         235511971
BCT328       17         38499600
BCT329       111        224832352
BCT33        25         63062813
BCT330       159        237328168
BCT331       114        218095822
BCT332       132        231047558
BCT333       56         137043274
BCT334       125        234008897
BCT335       122        226223828
BCT336       75         218630771
BCT337       87         225273389
BCT338       50         216750093
BCT339       50         220934502
BCT34        103        220877412
BCT340       166        204948722
BCT341       201        229360438
BCT342       118        254074995
BCT343       150        224522605
BCT344       142        236668035
BCT345       87         245122065
BCT346       77         224757778
BCT347       50         214982686
BCT348       37         145198422
BCT349       94         211413078
BCT35        131        225261716
BCT350       96         230778806
BCT351       139        245208171
BCT352       160        227874104
BCT353       109        221193945
BCT354       73         146408460
BCT355       167        264757753
BCT356       516        230646004
BCT357       147        234864527
BCT358       139        236948879
BCT359       139        224495994
BCT36        119        219809790
BCT360       72         178690402
BCT361       99         232093085
BCT362       93         219905522
BCT363       95         219851127
BCT364       150        234847733
BCT365       89         161260614
BCT366       83         219224172
BCT367       118        228705279
BCT368       150        340422718
BCT369       93         251909721
BCT37        125        219253793
BCT370       93         260647663
BCT371       7          8479031
BCT372       113        226716554
BCT373       138        223311320
BCT374       101        227951695
BCT375       123        219549252
BCT376       104        227275609
BCT377       92         110869282
BCT378       109        226436819
BCT379       94         230580298
BCT38        128        223087901
BCT380       174        223328708
BCT381       105        237866018
BCT382       142        219239323
BCT383       143        220686522
BCT384       88         221299000
BCT385       9          37311691
BCT386       116        220114769
BCT387       128        270523621
BCT388       89         279939486
BCT389       108        205344840
BCT39        195        224497881
BCT390       124        219589104
BCT391       134        213384687
BCT392       78         247172078
BCT393       85         227254437
BCT394       96         225469340
BCT395       113        218704721
BCT396       142        223315757
BCT397       103        250920122
BCT398       165        212047839
BCT399       154        201210930
BCT4         41293      139254430
BCT40        26         45760778
BCT400       238        214458452
BCT401       127        212981778
BCT402       86         220619549
BCT403       117        259981063
BCT404       78         181887444
BCT405       94         239272402
BCT406       141        231041047
BCT407       110        228669676
BCT408       115        215227823
BCT409       41         91773209
BCT41        255        228290103
BCT410       172        214313849
BCT411       97         222552335
BCT412       174        226571543
BCT413       114        215684288
BCT414       293        216311419
BCT415       11         5702473
BCT416       364        210657095
BCT417       105        213987405
BCT418       150        211743935
BCT419       171        217617270
BCT42        96         216108910
BCT420       155        217038415
BCT421       175        211972095
BCT422       161        208257957
BCT423       162        212193463
BCT424       114        210605338
BCT425       157        213126972
BCT426       132        209356669
BCT427       131        195243107
BCT428       183        210687290
BCT429       116        210811583
BCT43        102        220149568
BCT430       136        211510245
BCT431       168        219243138
BCT432       10         13800077
BCT433       107        230402984
BCT434       116        222340607
BCT435       136        231584497
BCT436       166        231465291
BCT437       72         33644203
BCT438       116        233490149
BCT439       115        227590956
BCT44        139        223015436
BCT440       80         242529953
BCT441       102        267101632
BCT442       39         58152042
BCT443       116        236314531
BCT444       140        217861884
BCT445       187        222856792
BCT446       146        238537842
BCT447       104        269394657
BCT448       70         49050146
BCT449       528        115589384
BCT45        106        222031667
BCT450       1589       2511957
BCT451       3172       5268484
BCT452       6338       7796395
BCT453       12613      14997690
BCT454       25523      27672494
BCT455       50567      54073229
BCT456       148971     156770281
BCT457       14112      193462894
BCT458       3297       203942569
BCT459       2512       213432676
BCT46        161        220965710
BCT460       47128      187481929
BCT461       75133      183088802
BCT462       11026      200061396
BCT463       24928      203168958
BCT464       142325     153143577
BCT465       149291     156947722
BCT466       84408      88048177
BCT467       144648     151178788
BCT468       25821      25453682
BCT469       132664     167652707
BCT47        133        221316823
BCT470       31354      43379422
BCT471       116328     178811220
BCT472       7406       16820599
BCT473       32913      52992737
BCT474       24876      265388408
BCT475       6084       260771471
BCT476       5035       225442726
BCT477       3847       224092509
BCT478       1446       272628098
BCT479       105        221757820
BCT48        113        217939824
BCT480       55         216742189
BCT481       70         215321341
BCT482       33         131631016
BCT483       69         224394912
BCT484       364        238323955
BCT485       814        290174005
BCT486       275        85760068
BCT487       1274       200945958
BCT488       525        242585986
BCT489       314        384809369
BCT49        121        223996906
BCT490       930        306161313
BCT491       2252       254173897
BCT492       2217       231254215
BCT493       40         79665847
BCT494       86         222746849
BCT495       78         227354684
BCT496       3023       245927078
BCT497       1230       124242115
BCT498       1412       261424764
BCT499       47         241352896
BCT5         20648      169648440
BCT50        131        218725866
BCT500       45         243003094
BCT501       2180       269716913
BCT502       945        54278114
BCT503       2274       268989543
BCT504       83         274582043
BCT505       422        283036369
BCT506       3015       248690235
BCT507       11931      19896835
BCT508       25176      41978637
BCT509       118512     189030931
BCT51        108        235209053
BCT510       116982     189967329
BCT511       117471     200327478
BCT512       55701      112194706
BCT52        128        222344558
BCT53        66         100806997
BCT54        95         230912422
BCT55        117        227983621
BCT56        160        232898310
BCT57        154        221704284
BCT58        128        238275556
BCT59        114        230664549
BCT6         2600       37759883
BCT60        54         123393656
BCT61        300        239582260
BCT62        142        231562727
BCT63        354        225466658
BCT64        111        222896198
BCT65        121        213352666
BCT66        120        227473574
BCT67        98         224926366
BCT68        90         224039666
BCT69        98         222023332
BCT7         1310       133308362
BCT70        58         138528232
BCT71        53         211054879
BCT72        45         210584326
BCT73        45         210864282
BCT74        45         212727898
BCT75        76         222861078
BCT76        40         115080869
BCT77        112        227959956
BCT78        129        231316827
BCT79        99         245428056
BCT8         191        234251938
BCT80        87         223381451
BCT81        59         181990919
BCT82        93         237302287
BCT83        103        223843089
BCT84        62         225168570
BCT85        64         140507059
BCT86        97         233623581
BCT87        82         229505918
BCT88        100        238937572
BCT89        24         34605217
BCT9         134        239086592
BCT90        94         226656782
BCT91        118        229172918
BCT92        127        232212861
BCT93        90         178403076
BCT94        114        212138354
BCT95        75         222053892
BCT96        112        225347102
BCT97        124        217786851
BCT98        3          5977905
BCT99        246        222256023
ENV1         189981     141874014
ENV10        186256     146038716
ENV11        209753     130994983
ENV12        177054     144862769
ENV13        155459     156526671
ENV14        250295     68810895
ENV15        87156      20071142
ENV16        220965     118700470
ENV17        255780     108833770
ENV18        202930     127147683
ENV19        22333      22042243
ENV2         163115     154108713
ENV20        152294     158746707
ENV21        201148     103384208
ENV22        68252      51339840
ENV23        213342     108929449
ENV24        170946     153801403
ENV25        135008     163682432
ENV26        11518      15692640
ENV27        179957     128306357
ENV28        218066     118482218
ENV29        78466      41725138
ENV3         51890      226867051
ENV30        143993     98017210
ENV31        100659     112292261
ENV32        130020     79921199
ENV33        173945     138872013
ENV34        165401     138569080
ENV35        177094     112198251
ENV36        200966     107312873
ENV37        196348     109592996
ENV38        111366     97690266
ENV39        158076     134832496
ENV4         73116      200256503
ENV40        145109     136793572
ENV41        169000     47751037
ENV42        172206     133132061
ENV43        211030     100432858
ENV44        142288     62174042
ENV45        216478     84259840
ENV46        212756     92644974
ENV47        108060     43424295
ENV48        224555     98849841
ENV49        224552     91869138
ENV5         165889     121849491
ENV50        141109     91005462
ENV51        198727     110751303
ENV52        179663     90408574
ENV53        204511     108930535
ENV54        8176       3984428
ENV55        132791     184160134
ENV56        232714     110991755
ENV57        226346     97409592
ENV58        13937      6137081
ENV59        194803     112110932
ENV6         218987     102585490
ENV60        125978     173106002
ENV61        60528      234072476
ENV62        54188      99175911
ENV7         176387     159893490
ENV8         19543      17055080
ENV9         204710     124203913
EST1         152690     59075604
EST10        155848     67145433
EST100       152900     76533879
EST101       145310     99404929
EST102       145327     85609978
EST103       149133     92918372
EST104       6678       3969414
EST105       149700     109472275
EST106       135201     99323583
EST107       136256     97451505
EST108       136283     94853558
EST109       2281       1508086
EST11        163604     69204453
EST110       137039     77376129
EST111       176769     106148584
EST112       193813     119045227
EST113       235878     141017018
EST114       7153       4398563
EST115       228229     127103651
EST116       183114     103694875
EST117       191632     94586043
EST118       3390       2617463
EST119       148776     100418839
EST12        150663     64729921
EST120       154737     119075941
EST121       166401     98014596
EST122       21716      15235645
EST123       130041     82536108
EST124       83544      30919585
EST125       36755      12481213
EST126       84106      31034635
EST127       84264      34515269
EST128       33711      11378339
EST129       85031      32709177
EST13        186795     83522118
EST130       82017      34968192
EST131       83454      35266094
EST132       84118      32965334
EST133       14468      5903340
EST134       83460      51063090
EST135       173736     87642690
EST136       170524     77715429
EST137       146469     92469833
EST138       28299      17873426
EST139       141402     87644345
EST14        104646     47789359
EST140       149169     98038750
EST141       157781     78491749
EST142       180949     92632171
EST143       7807       4567592
EST144       141653     76089811
EST145       151601     73212586
EST146       148400     87046777
EST147       155941     83671468
EST148       11479      6769132
EST149       166189     102138931
EST15        197356     111644310
EST150       202212     107328947
EST151       158884     93297129
EST152       102213     51068199
EST153       156473     79478757
EST154       135464     80316582
EST155       141411     87993125
EST156       166643     86165156
EST157       7537       4352491
EST158       179043     104198048
EST159       218733     94430895
EST16        147207     104729580
EST160       145774     85841747
EST161       161649     87789494
EST162       2683       1273073
EST163       141208     82864856
EST164       133292     84275790
EST165       147172     88147413
EST166       146199     80311563
EST167       19658      9971321
EST168       117769     61073260
EST169       115690     61941713
EST17        156552     83419127
EST170       122419     54128062
EST171       121107     48630686
EST172       29423      11431564
EST173       122215     48678047
EST174       125704     48478849
EST175       165762     83297359
EST176       172200     75566895
EST177       24700      15540223
EST178       147743     104364925
EST179       163429     99358064
EST18        191244     116974070
EST180       205284     116217156
EST181       167204     93396394
EST182       154084     103356716
EST183       134246     92945359
EST184       10653      5946360
EST185       146778     94225559
EST186       155073     81015985
EST187       131997     71132556
EST188       160937     90625260
EST189       12973      8196510
EST19        177593     113222957
EST190       148391     87401995
EST191       153611     95444734
EST192       175584     99196287
EST193       140448     77038260
EST194       5542       4509600
EST195       124098     64355359
EST196       163129     91083402
EST197       172923     99397463
EST198       149966     93107453
EST199       5575       3516018
EST2         157296     60515696
EST20        70514      55347428
EST200       165648     79426994
EST201       122447     84557335
EST202       163883     96574839
EST203       163910     95924410
EST204       12958      6236595
EST205       5847       2580354
EST206       111214     63111892
EST207       151296     87160332
EST208       107004     63421283
EST209       164716     101071760
EST21        194718     109379150
EST210       168459     124870746
EST211       82054      66695266
EST212       186353     95082816
EST213       145812     90577718
EST214       86904      65310717
EST215       142201     85383081
EST216       138332     75186486
EST217       94883      30485372
EST218       146949     86297456
EST219       149236     82715857
EST22        180131     92525151
EST220       141193     94333672
EST221       156025     90299220
EST222       8570       6132529
EST223       162128     99670103
EST224       153937     93688513
EST225       123359     88331804
EST226       145974     90182708
EST227       6794       4112514
EST228       129109     82213321
EST229       127974     89760637
EST23        106728     50178019
EST230       44066      31667399
EST231       156430     83332027
EST232       167399     92029681
EST233       166930     92691512
EST234       158124     88082424
EST235       163896     91508682
EST236       163228     92242200
EST237       166033     91294921
EST238       154891     85088026
EST239       168030     90687163
EST24        191052     61413874
EST240       187909     98489047
EST241       191640     107206156
EST242       168052     100159582
EST243       180324     103395206
EST244       190067     112774100
EST245       186313     113300888
EST246       177976     115378463
EST247       6774       5366330
EST248       140681     86100991
EST249       212269     139255055
EST25        136493     39205181
EST250       224139     109445086
EST251       164077     113921229
EST252       183152     95755613
EST253       198082     98538516
EST254       122211     89202303
EST255       5592       3806885
EST256       140265     82389799
EST257       206490     112904568
EST258       162417     106268822
EST259       94108      93119220
EST26        102352     27613958
EST260       14631      19056566
EST261       147747     99274549
EST262       151103     89971001
EST263       139494     102032068
EST264       217388     99711626
EST265       2734       1874907
EST266       134214     96874320
EST267       131014     91582085
EST268       135743     98224674
EST269       113667     81487104
EST27        201622     85286892
EST270       14870      9390607
EST271       136074     84237789
EST272       126197     86196946
EST273       128323     97050498
EST274       35670      25454263
EST275       126754     89472101
EST276       116718     79174411
EST277       139495     84170357
EST278       145826     114776899
EST279       14813      10436163
EST28        19493      8764926
EST280       125388     117381359
EST281       132659     98909184
EST282       162562     97730338
EST283       165651     104454173
EST284       18826      11791989
EST285       142295     92460345
EST286       169036     115171128
EST287       151612     103866108
EST288       136563     103388843
EST289       3122       2012582
EST29        204108     100212775
EST290       159550     97230714
EST291       222471     90724791
EST292       152859     111337310
EST293       160411     71793266
EST294       10529      1190647
EST295       208923     37984366
EST296       212167     83253891
EST297       150191     115332672
EST298       168072     97738207
EST299       154877     103184165
EST3         156029     54736569
EST30        216063     108845959
EST300       169072     109984637
EST301       149584     109939896
EST302       1975       1335588
EST303       180875     102305456
EST304       178791     93163079
EST305       168899     109550180
EST306       158882     104101268
EST307       2135       1704887
EST308       226903     106725089
EST309       267202     116187840
EST31        153987     67134151
EST310       184609     111769181
EST311       149924     28237311
EST312       230065     100576835
EST313       174888     100151227
EST314       156386     99990555
EST315       158540     94407905
EST316       166394     114093378
EST317       179942     95197248
EST318       143687     97189386
EST319       188156     110324042
EST32        149541     63744943
EST320       187345     49208208
EST321       201870     33894008
EST322       174443     95509500
EST323       14472      9105625
EST324       158346     113326097
EST325       184784     110470367
EST326       167586     97771795
EST327       165650     109621452
EST328       165922     71417216
EST329       127843     80161184
EST33        165218     65709042
EST330       121728     80853125
EST331       146606     101299104
EST332       21746      7720907
EST333       250640     26635193
EST334       254708     23392102
EST335       151991     94206454
EST336       152235     98594976
EST337       151209     99840551
EST338       145954     92203211
EST339       237889     43423093
EST34        147099     64547696
EST340       185433     81237254
EST341       3685       4554017
EST342       169321     100001066
EST343       163485     100908119
EST344       145649     92756666
EST345       189916     103387744
EST346       155962     109693704
EST347       153571     101545456
EST348       1864       707553
EST349       184471     108452053
EST35        162713     70911147
EST350       169894     94651816
EST351       169250     105165467
EST352       178308     59602870
EST353       195038     71941256
EST354       194528     75305704
EST355       197065     74426894
EST356       135405     70508640
EST357       174836     127386098
EST358       148407     85117807
EST359       150566     86648213
EST36        160500     65842690
EST360       122052     95387840
EST361       5228       4156832
EST362       143577     94945899
EST363       155634     94558686
EST364       162062     90080072
EST365       157801     100316004
EST366       21621      9602251
EST367       45656      24624838
EST368       155318     104549016
EST369       137850     97037511
EST37        107955     33687683
EST370       158528     102036132
EST371       153057     110091631
EST372       29680      25288248
EST373       173564     146756127
EST374       163573     85433530
EST375       128159     81338884
EST376       137895     94127120
EST377       50612      35397347
EST378       131619     88276056
EST379       137447     89871154
EST38        99514      30487965
EST380       139754     97233001
EST381       147706     97347466
EST382       49930      40332362
EST383       164182     86552371
EST384       143622     81415127
EST385       144915     86073821
EST386       144157     103713157
EST387       155646     93181756
EST388       138127     87591810
EST389       133463     84875714
EST39        99152      31401585
EST390       19252      11819086
EST391       196902     107235645
EST392       137014     75086496
EST393       92962      54579752
EST394       120675     80303449
EST395       23099      14175362
EST396       131518     83245448
EST397       119611     76575368
EST398       147508     80760259
EST399       210532     82594640
EST4         142933     56343102
EST40        98817      29785816
EST400       29791      12543861
EST401       163649     84380495
EST402       163929     99177970
EST403       159177     95841266
EST404       125633     81071284
EST405       12450      8163608
EST406       129141     86476992
EST407       137033     89905278
EST408       178976     112236854
EST409       154128     93135231
EST41        39222      11595646
EST410       28333      12277799
EST411       166745     92047209
EST412       168862     124889078
EST413       87364      56108523
EST414       69679      41103486
EST415       34092      16783013
EST416       137530     79965946
EST417       82413      49409226
EST418       139766     56852944
EST419       148868     30145933
EST42        101326     31351096
EST420       148732     30447498
EST421       163273     80663592
EST422       26173      14136342
EST423       201222     115845880
EST424       237755     108748183
EST425       220202     107509766
EST426       127047     74475061
EST427       128057     85803248
EST428       131704     80409324
EST429       93228      56881081
EST43        102633     36243427
EST430       173975     110008863
EST431       213501     84775693
EST432       106339     28485828
EST433       184754     112765379
EST434       204073     111451758
EST435       178856     105573885
EST436       197595     116862339
EST437       134477     63096462
EST438       110830     60475088
EST439       163287     109043698
EST44        95475      48218258
EST440       182140     116752022
EST441       106403     84554937
EST442       177181     139826371
EST443       150386     90557227
EST444       53982      34345685
EST445       166520     107182981
EST446       178543     101235231
EST447       42175      24141500
EST448       195798     106768392
EST449       185317     95089728
EST45        121121     52335541
EST450       50433      37888207
EST451       189934     115836172
EST452       180026     118008074
EST453       54535      33956141
EST454       196677     133946397
EST455       218252     122876729
EST456       191464     127720063
EST457       184004     144689626
EST458       204243     156003038
EST459       192710     115536227
EST46        55810      33167886
EST460       161445     96690107
EST461       181214     94252913
EST462       6221       516980
EST463       53496      4381716
EST464       158232     12239421
EST465       144975     12987161
EST466       148608     30079541
EST467       149063     29643665
EST468       7062       1471579
EST469       148744     30417064
EST47        177065     89170482
EST470       141959     81858084
EST471       172662     101047129
EST472       161391     110665996
EST473       16965      12150641
EST474       160968     92911974
EST475       150622     104098642
EST476       133699     93222175
EST477       141788     98123147
EST478       16075      8262115
EST479       157380     103682725
EST48        158217     65104402
EST480       146153     105108584
EST481       162010     97565605
EST482       165902     51041233
EST483       12075      1898567
EST484       160517     40369185
EST485       151959     102983430
EST486       149516     98088273
EST487       170713     111736796
EST488       17955      10002926
EST489       132815     75920561
EST49        162352     92229006
EST490       189716     107933724
EST491       149564     109198403
EST492       53155      36073998
EST493       126855     87064282
EST494       145709     90286473
EST495       148633     89486839
EST496       163483     89070769
EST497       35259      17962765
EST498       151814     92135788
EST499       156231     92108182
EST5         162094     62614875
EST50        154203     80120373
EST500       168660     102139232
EST501       136390     85619035
EST502       15232      8453667
EST503       100274     71184924
EST504       78633      60626261
EST505       97623      64860807
EST506       143664     80553208
EST507       36770      20999127
EST508       120992     73607850
EST509       133540     87501363
EST51        156506     74874317
EST510       135574     79506177
EST511       152825     93053797
EST512       44831      24810594
EST513       155676     85797389
EST514       184807     110595728
EST515       121358     79430510
EST516       178199     94655647
EST517       4663       1735339
EST518       52576      18674859
EST519       183566     101186007
EST52        108103     61120240
EST520       152045     81312605
EST521       22159      13415636
EST522       162316     94446797
EST523       211757     123975299
EST524       29664      19024876
EST525       147952     99622109
EST526       158950     98067836
EST527       134310     87388255
EST528       129803     88585688
EST529       24481      15268552
EST53        153908     88947693
EST530       179560     74468277
EST531       179108     79600547
EST532       198743     83525940
EST533       194777     80469363
EST534       3399       1184710
EST535       178841     95307232
EST536       174444     102485197
EST537       180225     107869574
EST538       171856     103650134
EST539       197056     126802532
EST54        154293     84993684
EST540       186220     103229406
EST541       178860     82786794
EST542       146160     93442201
EST543       206771     125126638
EST544       205624     126733200
EST545       194291     113936766
EST546       197936     113918089
EST547       154091     96436815
EST548       187948     117407713
EST549       166670     98999925
EST55        152223     92300142
EST550       133843     98243253
EST551       8876       7222302
EST552       157285     92184364
EST553       170556     85010427
EST554       149107     85057056
EST555       151186     81955618
EST556       11762      7024253
EST557       156517     79983850
EST558       181361     106397624
EST559       162545     103085348
EST56        149911     69862704
EST560       175369     108186389
EST561       3227       2163095
EST562       170744     117107232
EST563       183920     113640835
EST564       129040     83662465
EST565       169422     97775191
EST566       184662     110539461
EST567       35066      22896435
EST568       204465     119127975
EST569       269542     91763948
EST57        142238     76745964
EST570       25664      9425377
EST571       262943     83717893
EST572       157489     57559566
EST573       162301     59144283
EST574       80397      30735293
EST58        151729     83212808
EST59        161295     65822492
EST6         166275     65040988
EST60        144394     70073562
EST61        160487     90001957
EST62        150493     92644578
EST63        150083     99330860
EST64        157769     94520045
EST65        2307       970564
EST66        154957     103559420
EST67        163155     82983914
EST68        166584     84965551
EST69        141947     77582568
EST7         163878     67751506
EST70        148486     82582643
EST71        149152     86202189
EST72        148770     92334607
EST73        150782     87652607
EST74        2420       1413132
EST75        29919      18235506
EST76        186810     102879363
EST77        170462     90743046
EST78        212601     115726606
EST79        179452     103378064
EST8         160911     67789464
EST80        2020       1372932
EST81        196745     121640362
EST82        167627     93384513
EST83        136175     63354978
EST84        128096     62641861
EST85        10912      5586839
EST86        150434     92651323
EST87        154703     97020497
EST88        130185     66307353
EST89        140318     89371875
EST9         169422     69381975
EST90        14221      7368767
EST91        183554     91946533
EST92        204555     119869140
EST93        201962     107955235
EST94        191956     90364467
EST95        204075     87104446
EST96        145909     86980407
EST97        137871     84933955
EST98        158560     76393126
EST99        9280       6073374
GSS1         172834     126576577
GSS10        14910      14401612
GSS100       169261     144380017
GSS101       157745     108933470
GSS102       155986     106345499
GSS103       152475     105542661
GSS104       168005     122783070
GSS105       149829     126592844
GSS106       162068     125197053
GSS107       186640     116036674
GSS108       16014      9794559
GSS109       185786     119804494
GSS11        146507     107094841
GSS110       201450     104020421
GSS111       219926     124042541
GSS112       87280      56947051
GSS113       152300     114320098
GSS114       155174     118808877
GSS115       155139     118868834
GSS116       163490     106671356
GSS117       36986      21467879
GSS118       179848     132289982
GSS119       189894     117148040
GSS12        200839     104097643
GSS120       166036     55080797
GSS121       170071     76702837
GSS122       2028       1303403
GSS123       161778     105245778
GSS124       189210     124956394
GSS125       200987     81591982
GSS126       166850     79919427
GSS127       137307     94457298
GSS128       129872     104613764
GSS129       132040     108783227
GSS13        192061     84602304
GSS130       132451     106046726
GSS131       8003       5920029
GSS132       135214     112032054
GSS133       56598      47104660
GSS134       132584     107786768
GSS135       139149     116140565
GSS136       140043     114408742
GSS137       138251     109584898
GSS138       4155       2820771
GSS139       134784     106426486
GSS14        173249     89238431
GSS140       134049     108003847
GSS141       134400     111531585
GSS142       138188     116474348
GSS143       4675       3643453
GSS144       139468     108106612
GSS145       136810     113648547
GSS146       136898     113473892
GSS147       137299     112649085
GSS148       559        466085
GSS149       137155     110923756
GSS15        167983     83930679
GSS150       134480     106278327
GSS151       133002     107665198
GSS152       138659     116136290
GSS153       1985       1674795
GSS154       127182     92203837
GSS155       174275     105162567
GSS156       184914     110237552
GSS157       162345     108755150
GSS158       176892     102083573
GSS159       197105     129369627
GSS16        160060     81615096
GSS160       201456     133367764
GSS161       200727     134041970
GSS162       179380     125427766
GSS163       198341     136948587
GSS164       196713     139067120
GSS165       196065     138672070
GSS166       174298     134353538
GSS167       144791     97546246
GSS168       138200     80523134
GSS169       165330     73398615
GSS17        156174     85673627
GSS170       129814     57820242
GSS171       163014     141019316
GSS172       170950     113527672
GSS173       80812      52920567
GSS174       191881     129015715
GSS175       196554     117983862
GSS176       28456      14940540
GSS177       180225     98140530
GSS178       181302     123365801
GSS179       178800     126906476
GSS18        152981     95677320
GSS180       181098     127179984
GSS181       19114      12799890
GSS182       165902     130533276
GSS183       170977     155597399
GSS184       219919     123799690
GSS185       216581     103401654
GSS186       17290      8049466
GSS187       210015     95106166
GSS188       156579     134385514
GSS189       6807       6749646
GSS19        153777     72780066
GSS190       125540     102753347
GSS191       122235     93469471
GSS192       156847     154495780
GSS193       167720     158232911
GSS194       131396     104305071
GSS195       149360     107958474
GSS196       170325     141788280
GSS197       174263     119970230
GSS198       20136      11688868
GSS199       181316     133971324
GSS2         173590     107820141
GSS20        106476     59071274
GSS200       184911     120117379
GSS201       180126     93029105
GSS202       172829     121726073
GSS203       189216     117024741
GSS204       189414     116726891
GSS205       21729      12651457
GSS206       200615     129990067
GSS207       215712     142629172
GSS208       217635     140382802
GSS209       166429     136402995
GSS21        132536     64638951
GSS210       152471     108703336
GSS211       160065     120654204
GSS212       160039     145460383
GSS213       158365     140331734
GSS214       160859     145750229
GSS215       162431     144534355
GSS216       163049     142910892
GSS217       159417     122903915
GSS218       168345     139695448
GSS219       161743     115993986
GSS22        125191     56725897
GSS220       180530     88689585
GSS221       2575       1768585
GSS222       251369     52150506
GSS223       262481     40466091
GSS224       262523     40408947
GSS225       122800     38229504
GSS226       253355     52912344
GSS227       182565     86129448
GSS228       189053     56109501
GSS229       154111     118306719
GSS23        134196     73094577
GSS230       177033     144334259
GSS231       160568     145787944
GSS232       159531     147010793
GSS233       174549     109955224
GSS234       238210     57319690
GSS235       198151     101373468
GSS236       229425     39759432
GSS237       119092     74589582
GSS238       174029     112048984
GSS239       147879     90055083
GSS24        143035     74371292
GSS240       140666     84082420
GSS241       159798     149653267
GSS242       5874       5001697
GSS243       112668     95722541
GSS244       180351     149222837
GSS245       172954     122407496
GSS246       201906     127716652
GSS247       188210     120275961
GSS248       166175     94403497
GSS249       159875     84508026
GSS25        12092      5172754
GSS250       156434     119873333
GSS251       203514     148104231
GSS252       14295      9396358
GSS253       171523     67875770
GSS254       176683     96454754
GSS255       195475     152072364
GSS256       199776     154504000
GSS257       7495       6183699
GSS258       197814     157230621
GSS259       197524     124135449
GSS26        140902     65659537
GSS260       194960     142651188
GSS261       609        420698
GSS262       214911     131530338
GSS263       189958     57638710
GSS264       218598     111928830
GSS265       170488     153872948
GSS266       163848     150141940
GSS267       234900     132469628
GSS268       220564     118386800
GSS27        159863     79841194
GSS28        156780     92817384
GSS29        165484     85429638
GSS3         138093     115755794
GSS30        9311       4809210
GSS31        171978     102877480
GSS32        182794     109078835
GSS33        182358     87083745
GSS34        172892     102148238
GSS35        191042     104301903
GSS36        162180     112295088
GSS37        160410     98257518
GSS38        173347     108755067
GSS39        3659       2625600
GSS4         140176     112446194
GSS40        183985     122974505
GSS41        181701     117299100
GSS42        52326      27358639
GSS43        177832     102911728
GSS44        164530     141989063
GSS45        179635     148565674
GSS46        139660     92477151
GSS47        182857     132009511
GSS48        181604     114543954
GSS49        204426     116967818
GSS5         11597      8660962
GSS50        185612     99477863
GSS51        211954     108037045
GSS52        211747     108318359
GSS53        197315     132797049
GSS54        158211     124808059
GSS55        185589     139410158
GSS56        196775     63134337
GSS57        171826     96464104
GSS58        157611     106106204
GSS59        23373      13575160
GSS6         152749     116375726
GSS60        166616     156645100
GSS61        177157     98801574
GSS62        161196     115202462
GSS63        172331     112351434
GSS64        173858     117792409
GSS65        184258     127655843
GSS66        205711     128748730
GSS67        189998     113287440
GSS68        200686     134224634
GSS69        215702     158336970
GSS7         170888     120025042
GSS70        189038     138024221
GSS71        173742     107642623
GSS72        198219     111980277
GSS73        140725     76414851
GSS74        163079     95884017
GSS75        10697      6814502
GSS76        159270     97756741
GSS77        159481     96970229
GSS78        172285     114351414
GSS79        170749     109399099
GSS8         177211     109005139
GSS80        174370     122402741
GSS81        188944     105262393
GSS82        174817     125816528
GSS83        164286     106564471
GSS84        1704       1352882
GSS85        189623     108718187
GSS86        182037     114287366
GSS87        167146     118346285
GSS88        193343     106201902
GSS89        7220       4213495
GSS9         141891     118699622
GSS90        213933     107583686
GSS91        227285     89235627
GSS92        213465     139505605
GSS93        182539     91847418
GSS94        94686      37020965
GSS95        193805     75823638
GSS96        201086     123394316
GSS97        191020     122180795
GSS98        156116     139401502
GSS99        16660      10968419
HTC1         41206      63404125
HTC2         32318      72275691
HTC3         32080      77890442
HTC4         84836      50647832
HTC5         129901     161568308
HTC6         124887     122728899
HTC7         137625     130767271
HTC8         63000      54832546
HTG1         3784       374870703
HTG10        2848       363016285
HTG11        1976       365940103
HTG12        1714       382089084
HTG13        1718       381796340
HTG14        1659       383118453
HTG15        1835       380424998
HTG16        1750       361896240
HTG17        1843       380599315
HTG18        1752       382301790
HTG19        1775       381824019
HTG2         5068       373604329
HTG20        1891       380883515
HTG21        2135       355865123
HTG22        2426       376351102
HTG23        2269       379507879
HTG24        2442       381163865
HTG25        2175       382733656
HTG26        2070       368006459
HTG27        2074       380458182
HTG28        2061       380108509
HTG29        1047       202962639
HTG3         2556       370662362
HTG30        2040       379446758
HTG31        2203       375546591
HTG32        986        170706729
HTG33        2152       379221269
HTG34        2348       376393195
HTG35        1372       195850538
HTG36        2462       370234045
HTG37        2428       372528369
HTG38        1015       169191937
HTG39        2235       381490266
HTG4         2735       369989641
HTG40        2336       385145188
HTG41        1069       180930974
HTG42        2312       384776536
HTG43        2363       384490832
HTG44        906        155597869
HTG45        2500       379735659
HTG46        2319       385244375
HTG47        927        158722850
HTG48        2315       385567657
HTG49        2293       386023883
HTG5         2500       373389217
HTG50        900        149450476
HTG51        2237       385154833
HTG52        2106       380011723
HTG53        657        122585305
HTG54        2010       379525743
HTG55        1981       378955508
HTG56        1184       193581815
HTG57        2144       380658486
HTG58        2686       383430148
HTG59        2973       383248998
HTG6         2          386956
HTG60        884        128257683
HTG61        2959       380503057
HTG62        3012       366231486
HTG63        2990       372824610
HTG64        2953       336850403
HTG65        3178       359117111
HTG66        3179       359260560
HTG67        3185       360470245
HTG68        3128       367751420
HTG69        2919       377752869
HTG7         2327       375791086
HTG70        1809       307037327
HTG71        3415       365492036
HTG72        2071       381329139
HTG73        1668       298160154
HTG74        2088       382520375
HTG75        2244       384445864
HTG76        1669       296247510
HTG77        2201       385233869
HTG78        2249       384504439
HTG79        3219       384192102
HTG8         1500       384347777
HTG80        2166       384708164
HTG81        3033       373087380
HTG82        1961       204926295
HTG9         1582       384062276
INV1         154219     140990453
INV10        14         359428768
INV11        9          363281720
INV12        45         381339161
INV13        17         391129107
INV14        74         80002370
INV15        6          384224499
INV16        16         393880512
INV17        37180      335059817
INV18        115924     94098409
INV19        167315     134470578
INV2         2286       315524754
INV20        126672     112172697
INV21        37136      273256295
INV22        131132     159754974
INV23        93683      76216819
INV24        28889      325575169
INV25        102828     206003565
INV26        147895     102548684
INV27        148928     103585572
INV28        153115     117054644
INV29        118278     81167339
INV3         104931     182074097
INV30        155144     113575640
INV31        153763     120425565
INV32        53090      35484652
INV33        152915     109446741
INV34        153563     115642389
INV35        36903      31846439
INV36        141599     88524971
INV37        147887     93719707
INV38        43615      33300703
INV39        148215     97299682
INV4         59057      272781737
INV40        139035     81416337
INV41        43007      25494699
INV42        138453     82788298
INV43        138177     82838190
INV44        53389      35294208
INV45        139131     83450459
INV46        135506     99043746
INV47        74492      58298691
INV48        142230     108270676
INV49        151531     120251081
INV5         37248      75696691
INV50        156111     118683615
INV51        94043      223752040
INV52        183035     236941459
INV53        216228     165877386
INV54        38629      187147326
INV55        800        42674647
INV56        566        40635863
INV57        8037       115580217
INV58        23329      332915377
INV59        23255      171962006
INV6         129081     165754653
INV60        68041      305365919
INV61        123287     266863020
INV62        64375      76908791
INV63        180571     237306452
INV64        41592      302727004
INV65        311        394019569
INV66        1008       100305774
INV67        1566       383240491
INV68        2          41011863
INV69        544        361596269
INV7         207        346774014
INV70        8          378508614
INV71        845        354182410
INV72        6          380479040
INV73        2          95552909
INV74        22         390382246
INV75        13718      160169129
INV76        1          536602846
INV77        1          685423969
INV78        1          640667275
INV79        1          639123876
INV8         85         322154899
INV80        1          612949391
INV81        1          577192767
INV82        1          641629864
INV83        2030       338253667
INV84        8890       307681826
INV85        12392      311915789
INV86        28478      45759536
INV87        149119     105521070
INV88        153075     93977334
INV89        79401      46152434
INV9         3          136766944
INV90        151514     93740491
INV91        151734     110148220
INV92        54545      47005605
INV93        152162     123807900
INV94        150903     119755544
INV95        151621     114060867
INV96        147835     118498798
INV97        67582      134200038
MAM1         34277      321560254
MAM10        26813      24993452
MAM11        13731      20581276
MAM12        3445       7368868
MAM13        107        699953
MAM14        20         277696380
MAM15        1          249270926
MAM16        2          343930246
MAM17        3          325384739
MAM18        1          90795278
MAM19        4          322903327
MAM2         20336      275468904
MAM20        4          298795355
MAM21        6          353843759
MAM22        5          329700903
MAM23        2          289079565
MAM24        3          348530310
MAM25        4          336581445
MAM26        5          375256260
MAM27        6          373952570
MAM28        8          377813420
MAM29        5          379300313
MAM3         2          316219032
MAM30        1          38035513
MAM31        5          285741626
MAM32        5          342804543
MAM33        8          370485433
MAM34        6          316655225
MAM35        4          238884849
MAM36        4          355768297
MAM37        6          355037276
MAM38        7          389945117
MAM39        6          319172640
MAM4         2          376685399
MAM40        5          323047396
MAM41        4          347221982
MAM42        5          288444151
MAM43        5          375232988
MAM44        13         249854952
MAM45        54         7614329
MAM46        215        34073042
MAM47        431        71272130
MAM48        861        68509101
MAM49        1706       2411269
MAM5         2          295769989
MAM50        6836       6159435
MAM51        110526     193401624
MAM52        146745     135845720
MAM53        118704     168093684
MAM54        22012      23416316
MAM55        1          716413629
MAM56        1          662751787
MAM57        1          611347268
MAM58        1          464895054
MAM59        1          288121652
MAM6         2          385026516
MAM60        3          338107697
MAM61        1          223449203
MAM62        1          210645437
MAM63        1          201318998
MAM64        1          197708286
MAM65        2          320231256
MAM66        2          293750401
MAM67        3          367535284
MAM68        4          351244600
MAM69        367        269065793
MAM7         3          316699161
MAM70        1          203623556
MAM71        2          383513587
MAM72        4          383666147
MAM73        5          381503248
MAM74        1697       391939678
MAM75        67489      270161247
MAM76        32818      42505637
MAM8         5          343489620
MAM9         933        216317382
PAT1         420092     157379621
PAT10        304145     130867951
PAT100       352852     189327041
PAT101       310862     206556098
PAT102       261889     226571161
PAT103       130469     96637053
PAT104       304402     217824161
PAT105       276793     236021165
PAT106       255575     243191966
PAT107       219302     91982645
PAT108       185527     168151315
PAT109       194778     145579485
PAT11        235972     217033990
PAT110       98093      55999755
PAT111       244010     110313663
PAT112       143102     226374942
PAT113       78461      27196701
PAT114       88280      271848690
PAT115       224871     124891536
PAT116       225583     104856368
PAT117       1414       4459822
PAT118       247765     75673289
PAT119       230776     33741646
PAT12        83502      75729157
PAT120       94886      123403652
PAT121       98574      119749391
PAT122       81936      115812708
PAT123       203208     107726817
PAT124       26044      9049668
PAT125       203753     100524714
PAT126       183498     80758866
PAT127       117398     19496465
PAT128       249636     208803904
PAT129       386159     114654001
PAT13        242994     211781414
PAT130       52434      7531888
PAT131       283993     180139483
PAT132       123568     298383749
PAT133       110178     303200389
PAT134       393178     122403578
PAT135       291008     159033659
PAT136       12315      8289391
PAT137       287141     182646284
PAT138       409360     14039521
PAT139       496812     33315384
PAT14        328333     148441963
PAT140       525210     7878150
PAT141       153458     3896573
PAT142       377421     123804728
PAT143       245701     106298543
PAT144       259895     238802744
PAT145       4634       392128968
PAT146       190899     207809354
PAT147       308470     120437803
PAT148       140528     153756176
PAT149       6430       91690961
PAT15        63673      1591825
PAT150       177885     181303248
PAT151       71549      185117590
PAT152       75797      115785873
PAT153       75754      115777597
PAT154       46228      38672101
PAT155       245587     68642890
PAT156       201626     63081611
PAT157       264571     57807538
PAT158       309594     83974442
PAT159       458716     54677521
PAT16        197494     165327046
PAT160       227775     118065838
PAT161       360562     132720074
PAT162       287901     50205964
PAT163       154028     4621518
PAT164       229296     77215858
PAT165       228262     72764716
PAT166       281032     19059194
PAT167       63881      6660379
PAT168       153383     170227500
PAT169       73417      134980723
PAT17        217877     141825891
PAT170       74139      123431457
PAT171       137229     84274353
PAT172       175192     2627880
PAT173       234159     99508566
PAT174       198451     145145451
PAT175       132741     122396997
PAT176       80124      122466507
PAT177       260804     46024585
PAT178       294811     4422165
PAT179       7778       116670
PAT18        217763     104542668
PAT180       278538     10765362
PAT181       99590      135915739
PAT182       220910     105875731
PAT183       23917      35278529
PAT184       143999     206566501
PAT185       173285     186742155
PAT186       70129      243259642
PAT187       6542       8869371
PAT188       137168     133366031
PAT189       136595     204924448
PAT19        238917     105580979
PAT190       208585     98959262
PAT191       284110     31395222
PAT192       26263      42269273
PAT193       264589     66935450
PAT194       227269     82111943
PAT195       179588     5746816
PAT196       196792     136568410
PAT197       94263      49215587
PAT198       268658     230373189
PAT199       282624     222310160
PAT2         329706     203014025
PAT20        217529     131791429
PAT200       192664     139614235
PAT201       276098     235021090
PAT202       188385     291326630
PAT203       137484     196232251
PAT204       247191     246690030
PAT205       11728      387687504
PAT206       313354     152356909
PAT207       244602     252477336
PAT208       160029     300870611
PAT209       215545     135077252
PAT21        295510     53592209
PAT210       172971     290885692
PAT211       266026     215706347
PAT212       388069     123029180
PAT213       208476     41955373
PAT22        146922     94654137
PAT23        196052     155778288
PAT24        279899     73148400
PAT25        228135     147576905
PAT26        209293     140264044
PAT27        62574      53738469
PAT28        304663     206977404
PAT29        321047     202868622
PAT3         50139      20256441
PAT30        69606      127456844
PAT31        217213     274043600
PAT32        399532     38379558
PAT33        255768     169059120
PAT34        232489     137932251
PAT35        62178      29243053
PAT36        159610     193120910
PAT37        187244     152014323
PAT38        212002     134509422
PAT39        97873      9820208
PAT4         329563     180389506
PAT40        349668     21562100
PAT41        269131     102155190
PAT42        166        390395449
PAT43        7285       386170321
PAT44        91553      5256860
PAT45        304606     19422510
PAT46        304621     19407682
PAT47        188193     183531482
PAT48        31102      33389962
PAT49        100023     274297096
PAT5         261970     200081780
PAT50        347921     22045153
PAT51        356635     6776065
PAT52        92422      1756018
PAT53        351488     15876269
PAT54        360979     6858601
PAT55        133551     2537469
PAT56        360626     6851894
PAT57        359974     6839506
PAT58        125418     2711844
PAT59        535700     100616524
PAT6         217552     164400590
PAT60        111356     330233433
PAT61        289774     158820679
PAT62        481511     50384210
PAT63        225627     89296915
PAT64        254625     194678847
PAT65        328400     204068563
PAT66        171629     140650621
PAT67        349862     190728733
PAT68        612603     75778089
PAT69        132887     40797313
PAT7         247430     122525314
PAT70        484033     127126269
PAT71        126354     109119371
PAT72        150168     307250321
PAT73        318626     211710240
PAT74        51881      214846609
PAT75        189165     289007376
PAT76        317843     207880789
PAT77        123868     129694058
PAT78        342751     192409991
PAT79        362616     180214431
PAT8         224341     103164015
PAT80        20467      17346132
PAT81        311143     212599739
PAT82        414691     138165335
PAT83        481329     57361173
PAT84        327289     49350302
PAT85        456882     82651653
PAT86        157572     115867974
PAT87        167229     186393240
PAT88        316358     151157163
PAT89        224140     179687051
PAT9         153247     77997283
PAT90        160745     40020544
PAT91        548289     10417491
PAT92        499577     9491963
PAT93        509422     32511534
PAT94        211221     45759082
PAT95        257694     203241576
PAT96        388324     141427300
PAT97        39430      44100894
PAT98        361773     186862184
PAT99        415062     154422395
PHG1         8919       215885820
PHG2         4441       220955942
PHG3         5228       216120452
PHG4         2916       162956891
PLN1         135234     172334502
PLN10        18921      157294990
PLN100       17         7689286
PLN101       37         16871
PLN102       149        79314
PLN103       2469       93786416
PLN104       7181       18795412
PLN105       14346      29953091
PLN106       97799      209444397
PLN107       129343     89968204
PLN108       159100     148385247
PLN109       162950     146593730
PLN11        29377      278503063
PLN110       57342      31268760
PLN111       181662     125850093
PLN112       49813      255589519
PLN113       41703      287605797
PLN114       71487      107634459
PLN115       98644      85504678
PLN116       49729      72847341
PLN117       25061      110565816
PLN118       13561      89764040
PLN119       1          774434471
PLN12        2656       333968465
PLN120       8305       28494037
PLN121       1861       361385154
PLN122       5          372618381
PLN123       6          372447772
PLN124       6          368295254
PLN125       12434      261982605
PLN126       175433     124268641
PLN127       23476      15739848
PLN128       148563     156361640
PLN129       149809     145574870
PLN13        37         329935405
PLN130       85863      71374371
PLN131       154511     132764397
PLN132       164234     118594447
PLN133       22432      25537732
PLN134       146798     135184774
PLN135       121881     152302624
PLN136       167349     121827523
PLN137       115337     120253530
PLN138       133954     150284064
PLN139       101629     120104955
PLN14        46         124218893
PLN140       135978     150015694
PLN141       126643     163335172
PLN142       120646     166386981
PLN143       19355      17611515
PLN144       124592     164369766
PLN145       113037     173153073
PLN146       84057      156904399
PLN147       119120     172426236
PLN148       93874      190043592
PLN149       11204      347132808
PLN15        9          366014477
PLN150       18853      110400703
PLN151       19737      363518883
PLN152       10232      333664247
PLN153       302        288936846
PLN154       5          324373291
PLN155       1370       370269377
PLN156       1382       1231196
PLN157       342        386037290
PLN158       8          179149947
PLN159       889        232043199
PLN16        2395       340580897
PLN160       1          522466905
PLN161       1          675310294
PLN162       1          628753756
PLN163       1          624247919
PLN164       1          599018945
PLN165       1          573247234
PLN166       1          634667502
PLN167       8999       347988340
PLN168       3495       373169953
PLN169       8          255456585
PLN17        1949       233857567
PLN170       127        363424368
PLN171       380        366560925
PLN172       9          335385998
PLN173       27         308914810
PLN174       2          317663561
PLN175       1          192140685
PLN176       1          279860179
PLN177       1          259520967
PLN178       2          294703259
PLN179       1          238633233
PLN18        3          330514248
PLN180       1          162496318
PLN181       1          420743833
PLN182       204        92199407
PLN183       16         383095167
PLN184       11         120799895
PLN185       1          541700351
PLN186       1          696809892
PLN187       1          655542733
PLN188       1          648987779
PLN189       1          622068216
PLN19        19710      239328876
PLN190       1          583456046
PLN191       1          654005093
PLN192       98         274330
PLN193       1          522466905
PLN194       1          675310294
PLN195       1          628753756
PLN196       1          624247919
PLN197       1          599018945
PLN198       1          573247234
PLN199       1          634667502
PLN2         39262      283374948
PLN20        96587      101384517
PLN200       286        94778124
PLN201       1          521073757
PLN202       1          672273650
PLN203       1          634137895
PLN204       1          624121443
PLN205       1          607506942
PLN206       1          564293627
PLN207       1          632401812
PLN208       1          520603772
PLN209       1          661076038
PLN21        113433     117616199
PLN210       1          626572591
PLN211       1          612852138
PLN212       1          598896166
PLN213       1          570629545
PLN214       1          623813090
PLN215       1          513014082
PLN216       1          653624577
PLN217       1          616219606
PLN218       1          610044819
PLN219       1          583417444
PLN22        57311      72144580
PLN220       1          550735148
PLN221       1          620104558
PLN222       1          523168208
PLN223       1          671211297
PLN224       1          630677708
PLN225       1          623428415
PLN226       1          604298040
PLN227       1          558526623
PLN228       1          628419988
PLN229       1          500012378
PLN23        28689      28922869
PLN230       1          648922534
PLN231       1          604770208
PLN232       1          597403059
PLN233       1          576456374
PLN234       1          556080982
PLN235       1          603311816
PLN236       1          512023576
PLN237       1          652551272
PLN238       1          615767531
PLN239       1          605571303
PLN24        2648       194594881
PLN240       1          592249714
PLN241       1          549757368
PLN242       1          616509610
PLN243       1          550024188
PLN244       1          710194481
PLN245       1          661081403
PLN246       1          659460550
PLN247       1          630572514
PLN248       1          598618390
PLN249       1          658974642
PLN25        344        254550430
PLN250       1          559656399
PLN251       1          717517502
PLN252       1          672450454
PLN253       1          665297378
PLN254       1          636785599
PLN255       1          599706080
PLN256       1          675658265
PLN257       1          495661851
PLN258       1          640830439
PLN259       1          597781253
PLN26        400        261235914
PLN260       1          600363860
PLN261       1          570178053
PLN262       1          534998810
PLN263       1          616598997
PLN264       1          537457279
PLN265       1          685947972
PLN266       1          649921694
PLN267       1          641099225
PLN268       1          611845738
PLN269       1          581041262
PLN27        198        168828441
PLN270       1          655783664
PLN271       1          521174834
PLN272       1          667717957
PLN273       1          631819663
PLN274       1          624692602
PLN275       1          597351075
PLN276       1          561737938
PLN277       1          629651422
PLN278       1          524514255
PLN279       1          670202054
PLN28        298        258873545
PLN280       1          631946783
PLN281       1          626743494
PLN282       1          600801835
PLN283       1          566971015
PLN284       1          629827058
PLN285       1          522114480
PLN286       1          671530377
PLN287       1          631910401
PLN288       1          622474059
PLN289       1          598240357
PLN29        339        265493888
PLN290       1          562137082
PLN291       1          633805855
PLN292       1          525723083
PLN293       1          684336246
PLN294       1          636053469
PLN295       1          629969872
PLN296       1          604087610
PLN297       1          568600391
PLN298       1          640498578
PLN299       1          519546829
PLN3         3695       380536593
PLN30        485        350911896
PLN300       1          665715246
PLN301       1          624683667
PLN302       1          621078253
PLN303       1          600910593
PLN304       1          558953701
PLN305       1          626840912
PLN306       1          543344542
PLN307       1          697540743
PLN308       1          655862368
PLN309       1          646765634
PLN31        112        80604200
PLN310       1          618540729
PLN311       1          587963859
PLN312       1          658085510
PLN313       282        378454633
PLN314       15         312691008
PLN315       8          111507617
PLN316       1          596211899
PLN317       1          705338699
PLN318       1          493450010
PLN319       1          804285258
PLN32        455        379563194
PLN320       1          810734643
PLN321       1          673981989
PLN322       1          754496630
PLN323       1          855759449
PLN324       1          614042580
PLN325       1          743847818
PLN326       1          673340788
PLN327       1          515668560
PLN328       1          713320806
PLN329       1          703598484
PLN33        127        379253996
PLN330       1          570159854
PLN331       1          625793224
PLN332       1          721110502
PLN333       1          459355444
PLN334       1          745201001
PLN335       1          749284433
PLN336       1          643344672
PLN337       1          595297365
PLN338       1          688905267
PLN339       1          491807393
PLN34        91         241350431
PLN340       1          769338634
PLN341       1          671568023
PLN342       1          635285330
PLN343       1          745618965
PLN344       1          839470345
PLN345       1          646400022
PLN346       1          747589525
PLN347       1          665179885
PLN348       1          506585010
PLN349       1          703962928
PLN35        107        353068716
PLN350       1          702438406
PLN351       1          568126671
PLN352       1          610851963
PLN353       1          707596419
PLN354       1          465558328
PLN355       1          734536914
PLN356       1          738743901
PLN357       1          636778132
PLN358       1          602900890
PLN359       1          697493198
PLN36        21         391404607
PLN360       1          490518203
PLN361       1          784661008
PLN362       1          810500911
PLN363       1          655314739
PLN364       1          752710991
PLN365       1          890847171
PLN366       1          621781073
PLN367       1          743084022
PLN368       1          676741658
PLN369       1          509452426
PLN37        229        244592824
PLN370       1          710124532
PLN371       1          480767623
PLN372       1          578021311
PLN373       1          620140791
PLN374       1          716573881
PLN375       1          476726550
PLN376       1          756324664
PLN377       1          977471539
PLN378       1          642207261
PLN379       1          502612092
PLN38        181        340210184
PLN380       1          646234737
PLN381       1          605172934
PLN382       1          593744788
PLN383       1          571972453
PLN384       1          545472572
PLN385       1          607667504
PLN386       1          590561804
PLN387       1          685720839
PLN388       1          490910922
PLN389       1          782694893
PLN39        12         380640183
PLN390       1          796420183
PLN391       1          650274702
PLN392       1          739889549
PLN393       1          848590828
PLN394       1          610626473
PLN395       1          738023571
PLN396       1          667607564
PLN397       1          506274898
PLN398       1          701434008
PLN399       1          690770133
PLN4         3520       387672190
PLN40        26         364323699
PLN400       1          567265955
PLN401       1          612987783
PLN402       1          704156067
PLN403       1          475327881
PLN404       1          732118298
PLN405       1          733931846
PLN406       1          636796232
PLN407       1          599764323
PLN408       1          691313424
PLN409       1          493357854
PLN41        6          339659276
PLN410       1          782685093
PLN411       1          786410271
PLN412       1          648139033
PLN413       1          744407562
PLN414       1          835583350
PLN415       1          623221719
PLN416       1          741299132
PLN417       1          669032550
PLN418       1          517040482
PLN419       1          711661679
PLN42        4          249554057
PLN420       1          708205786
PLN421       1          573398137
PLN422       1          583494258
PLN423       1          707105489
PLN424       1          471251328
PLN425       1          737453356
PLN426       1          736349413
PLN427       1          639162162
PLN428       1          586755746
PLN429       1          704478343
PLN43        93         388494695
PLN430       1          492109999
PLN431       1          791475352
PLN432       1          785940626
PLN433       1          661246824
PLN434       1          756990402
PLN435       1          858776195
PLN436       1          621195942
PLN437       1          754256086
PLN438       1          670301833
PLN439       1          509263899
PLN44        15         373888800
PLN440       1          708234589
PLN441       1          725120110
PLN442       1          575129590
PLN443       1          620883766
PLN444       1          727285804
PLN445       1          479660269
PLN446       1          745978486
PLN447       1          750160716
PLN448       1          642428577
PLN449       1          591313643
PLN45        9          363551984
PLN450       1          705330581
PLN451       1          495656580
PLN452       1          803232604
PLN453       1          790745243
PLN454       1          657494025
PLN455       1          759305888
PLN456       1          856542542
PLN457       1          628321883
PLN458       1          754364263
PLN459       1          697113365
PLN46        60         374148929
PLN460       1          504254270
PLN461       1          715354979
PLN462       1          713929667
PLN463       1          572943128
PLN464       1          626959190
PLN465       1          715714221
PLN466       1          483823121
PLN467       1          742917797
PLN468       1          748536659
PLN469       1          643784981
PLN47        14         212654302
PLN470       1          600654286
PLN471       1          685083685
PLN472       1          486317123
PLN473       1          794150360
PLN474       1          799857935
PLN475       1          655329108
PLN476       1          749763888
PLN477       1          838116175
PLN478       1          610468321
PLN479       1          736551279
PLN48        74         124609184
PLN480       1          666328382
PLN481       1          504826275
PLN482       1          702606209
PLN483       1          467876140
PLN484       1          566465558
PLN485       1          614421429
PLN486       1          698878671
PLN487       1          480431564
PLN488       1          735408736
PLN489       1          969998116
PLN49        8          358353307
PLN490       1          635024734
PLN491       10         3368
PLN492       1          595339094
PLN493       1          698605642
PLN494       1          499102108
PLN495       1          791748890
PLN496       1          797311483
PLN497       1          656817438
PLN498       1          753360318
PLN499       1          845838138
PLN5         97732      200907168
PLN50        3          347496433
PLN500       1          619661694
PLN501       1          752772853
PLN502       1          689709469
PLN503       1          509595892
PLN504       1          712797596
PLN505       1          710493282
PLN506       1          570643040
PLN507       1          619886155
PLN508       1          705533140
PLN509       1          484551304
PLN51        4          370651368
PLN510       1          740148362
PLN511       1          757233630
PLN512       1          642499559
PLN513       1          594006513
PLN514       1          693261537
PLN515       1          492948387
PLN516       1          781462734
PLN517       1          802944975
PLN518       1          650275864
PLN519       1          756841830
PLN52        2          271593360
PLN520       1          850623622
PLN521       1          614136911
PLN522       1          723255126
PLN523       1          669876730
PLN524       1          507533340
PLN525       1          712168462
PLN526       1          712339524
PLN527       1          564869106
PLN528       1          619418949
PLN529       1          715454519
PLN53        1          150766190
PLN530       1          478264344
PLN531       1          734693445
PLN532       1          749685439
PLN533       1          633598967
PLN534       16379      137515423
PLN535       5636       1862075
PLN536       5224       2478918
PLN537       1          563502314
PLN538       2014       4567060
PLN539       1          594102056
PLN54        2          288204953
PLN540       1          689851870
PLN541       1          495453186
PLN542       1          780798557
PLN543       1          801256715
PLN544       1          651852609
PLN545       1          750843639
PLN546       1          830829764
PLN547       1          615552423
PLN548       1          744588157
PLN549       1          673617499
PLN55        2          286787940
PLN550       1          509857067
PLN551       1          709773743
PLN552       1          713149757
PLN553       1          566080677
PLN554       1          618079260
PLN555       1          720988478
PLN556       1          473592718
PLN557       1          736706236
PLN558       1          750620385
PLN559       1          638686055
PLN56        2          295931502
PLN560       1          480980714
PLN561       6629       330538619
PLN562       3760       370633860
PLN563       10097      326490424
PLN564       1739       12306627
PLN565       1          585266722
PLN566       1          681112512
PLN567       1          775448786
PLN568       1          790338525
PLN569       1          746673839
PLN57        50         360868274
PLN570       1          836514780
PLN571       1          736872137
PLN572       1          676292951
PLN573       1          669155517
PLN574       1          701372996
PLN575       1          615672275
PLN576       1          698614761
PLN577       1          728031845
PLN578       1          722970987
PLN579       12266      8463745
PLN58        8          373615720
PLN580       94358      139661081
PLN581       109422     181080286
PLN582       91521      195261307
PLN583       77726      190226667
PLN584       99284      191015754
PLN585       103278     187632311
PLN586       100443     192505048
PLN587       359        2972683
PLN588       89297      204412208
PLN589       104431     188011748
PLN59        7          376229618
PLN590       67960      194729497
PLN591       72781      220148853
PLN592       74389      217670409
PLN593       85149      219594932
PLN594       18978      39498411
PLN6         111716     128158776
PLN60        6          342806685
PLN61        6          347730275
PLN62        6          350661716
PLN63        43         144640005
PLN64        144        326417895
PLN65        7          298887356
PLN66        6          332369654
PLN67        50         340388796
PLN68        34         333743749
PLN69        1          48961553
PLN7         64133      184834120
PLN70        195        309200124
PLN71        6          336790634
PLN72        5          336035871
PLN73        6          326965702
PLN74        5          304407451
PLN75        13         303962775
PLN76        5          284426683
PLN77        8          327303441
PLN78        61         76849044
PLN79        2          355063454
PLN8         21748      106778457
PLN80        1          333667882
PLN81        1          302574826
PLN82        1          296818136
PLN83        1          257455782
PLN84        1          252943167
PLN85        1          225803546
PLN86        1          219123305
PLN87        2          394302667
PLN88        38         30696039
PLN89        15         305289289
PLN9         35233      291274408
PLN90        2          286029496
PLN91        2          307738366
PLN92        2          269669619
PLN93        1          157681923
PLN94        8          372679169
PLN95        14         358536578
PLN96        50         392296317
PLN97        84         363119416
PLN98        114        351240259
PLN99        119        358826539
PRI1         23045      60050475
PRI10        2265       387936439
PRI11        4375       381729455
PRI12        2069       191983096
PRI13        2459       391020768
PRI14        17196      218813426
PRI15        27929      79132073
PRI16        96050      166265556
PRI17        11025      363947920
PRI18        3741       383223079
PRI19        15303      353911286
PRI2         23838      319338979
PRI20        2239       172855211
PRI21        1          250749103
PRI22        1          238414537
PRI23        2          387789264
PRI24        2          351926207
PRI25        2          301224727
PRI26        2          270924633
PRI27        3          376243325
PRI28        4          374251276
PRI29        5          290585290
PRI3         2613       370370379
PRI30        42411      314483445
PRI31        18910      23568395
PRI32        53142      193855733
PRI33        87999      233147013
PRI34        90506      166078696
PRI35        74330      199952244
PRI36        54430      215567543
PRI37        34621      144331188
PRI38        69722      214218466
PRI39        93745      172339785
PRI4         2409       360399901
PRI40        1          229594237
PRI41        1          190673448
PRI42        9369       358514136
PRI43        48786      210995334
PRI44        102681     186991225
PRI45        2785       23305994
PRI5         2593       353874487
PRI6         2112       282951291
PRI7         2729       356953890
PRI8         3181       362167571
PRI9         2423       385530941
ROD1         38434      309739779
ROD10        15052      352244932
ROD11        1335       2450684
ROD12        22214      347968493
ROD13        1002       157743814
ROD14        53466      238707384
ROD15        21658      310382782
ROD16        228387     97434634
ROD17        96802      64970926
ROD18        37573      244623097
ROD19        2          383374219
ROD2         1810       346957759
ROD20        2          353017828
ROD21        2          317259772
ROD22        2          289653994
ROD23        1          140975125
ROD24        3          385591618
ROD25        4          335044383
ROD26        5          356599364
ROD27        2          394024503
ROD28        2          369416674
ROD29        2          335852806
ROD3         1885       352024250
ROD30        2          300392300
ROD31        2          283621167
ROD32        3          348161973
ROD33        5          386542915
ROD34        5          237722395
ROD35        1          193958709
ROD36        2          350925653
ROD37        2          319641744
ROD38        2          276360533
ROD39        3          382322699
ROD4         1943       360884621
ROD40        3          315064326
ROD41        5          245850117
ROD42        2          348668775
ROD43        2          314889876
ROD44        3          389462371
ROD45        3          321351180
ROD46        1          93020901
ROD47        5          385423505
ROD48        6          342729329
ROD49        3          325864489
ROD5         1990       363733749
ROD50        4          358685719
ROD51        4          302148481
ROD52        5          337904903
ROD53        6          385168143
ROD54        6          347801590
ROD55        6          283624907
ROD56        70166      204262948
ROD6         306        57843793
ROD7         1975       368354297
ROD8         1990       369693686
ROD9         1959       368016559
STS1         170465     86854641
STS10        202214     61354897
STS11        167033     59462982
STS2         143549     63344935
STS3         8241       4837486
STS4         108725     63673512
STS5         110379     70040590
STS6         106166     81423611
STS7         122523     86626565
STS8         198745     60874215
STS9         8948       2429703
SYN1         54442      100617525
SYN10        2          382762979
SYN11        2          332214168
SYN12        4          386933112
SYN13        1          271050050
SYN14        2          294093621
SYN15        3          329883353
SYN16        4          353920981
SYN17        2          328712085
SYN18        4          357672913
SYN19        1          207870274
SYN2         1          271050050
SYN20        2          382762979
SYN21        2          332214168
SYN22        550        392407673
SYN23        65804      185101409
SYN24        9183       352928592
SYN25        17219      334476572
SYN26        109244     160418732
SYN27        32614      299250698
SYN28        2018       12847171
SYN3         2          294093621
SYN4         3          329883353
SYN5         4          353920981
SYN6         1          64242768
SYN7         3          371658272
SYN8         2          250483958
SYN9         1          207870274
TSA1         233380     79653983
TSA10        168620     151882439
TSA100       63252      114802277
TSA101       79841      41351312
TSA102       82721      28609319
TSA103       67721      19747702
TSA104       84021      22863253
TSA105       84236      21912832
TSA106       84446      20981295
TSA107       134042     46621688
TSA108       155667     149676184
TSA109       183762     101150200
TSA11        157833     129928381
TSA110       47316      107437033
TSA111       136931     166476864
TSA112       166663     125028887
TSA113       97439      238063556
TSA114       99621      234258577
TSA115       12096      5797980
TSA116       134299     172499287
TSA117       127822     180391048
TSA118       129653     177320123
TSA119       120977     167690794
TSA12        96970      81223522
TSA120       161752     123773928
TSA121       122463     187577773
TSA122       148092     145309800
TSA123       94145      61033986
TSA124       136345     168539405
TSA125       159333     125157880
TSA126       156667     125822948
TSA127       123052     121148961
TSA13        144445     166877725
TSA14        183430     128404479
TSA15        63704      19333264
TSA16        207559     109270376
TSA17        186915     104023410
TSA18        49380      65170400
TSA19        154786     149639718
TSA2         222501     88764704
TSA20        217000     100217335
TSA21        206229     104285391
TSA22        22275      12385671
TSA23        159463     127641062
TSA24        173240     148979716
TSA25        215107     83751466
TSA26        105264     74950797
TSA27        172910     71716168
TSA28        221930     89798997
TSA29        26888      19147632
TSA3         74593      22546411
TSA30        206110     106021139
TSA31        179811     146674399
TSA32        67801      29056436
TSA33        188249     126080028
TSA34        147266     171548953
TSA35        162994     142851570
TSA36        149877     161586478
TSA37        167355     152088001
TSA38        141407     134166635
TSA39        170803     157995856
TSA4         200107     117397278
TSA40        68091      94849454
TSA41        171892     122248327
TSA42        190077     128883583
TSA43        179568     129766485
TSA44        74709      42505780
TSA45        179837     148961559
TSA46        157618     110427650
TSA47        134614     95382384
TSA48        185173     132793697
TSA49        208467     104145310
TSA5         215390     134315100
TSA50        79060      109863998
TSA51        193326     109684073
TSA52        179856     119164458
TSA53        111895     116975633
TSA54        155188     135994981
TSA55        161488     91817715
TSA56        130888     143857547
TSA57        137093     81293196
TSA58        155281     162331143
TSA59        162871     156980202
TSA6         15756      19456676
TSA60        194209     122378904
TSA61        57557      94587557
TSA62        173905     118336916
TSA63        151865     162169607
TSA64        60980      124236262
TSA65        201109     152115772
TSA66        185638     143700395
TSA67        163423     121712708
TSA68        182114     137377481
TSA69        170731     97712914
TSA7         194553     54897033
TSA70        40637      38146354
TSA71        119065     123313318
TSA72        131964     141438855
TSA73        151655     115933671
TSA74        830        251943
TSA75        152989     102336522
TSA76        156503     143538644
TSA77        40595      33645981
TSA78        177556     139010934
TSA79        162022     159228390
TSA8         158334     121004747
TSA80        10510      8595284
TSA81        185669     115791752
TSA82        143419     147913350
TSA83        177759     145455461
TSA84        159235     177039745
TSA85        17013      11869134
TSA86        168307     128893220
TSA87        156344     150391937
TSA88        195418     125564755
TSA89        31945      22564229
TSA9         98089      68621619
TSA90        196286     138439609
TSA91        112986     113189975
TSA92        98986      206634893
TSA93        87112      229168164
TSA94        77344      247719367
TSA95        30093      107285833
TSA96        141044     144633048
TSA97        106079     76616395
TSA98        74427      65411867
TSA99        33717      32835466
UNA1         678        679302
VRL1         132457     138756015
VRL10        120584     138870513
VRL11        50912      63696318
VRL12        114077     144988388
VRL13        112617     147926378
VRL14        26301      44241863
VRL15        91095      158471437
VRL16        96744      150174995
VRL17        60882      99598942
VRL18        92389      166035674
VRL19        91141      163950396
VRL2         127481     150673566
VRL20        53913      120840746
VRL21        83255      172640467
VRL22        86091      167227705
VRL23        69099      118606470
VRL24        82985      167615773
VRL25        83268      167399157
VRL26        50120      111545847
VRL27        80490      209453013
VRL28        65267      224236060
VRL29        81509      180934956
VRL3         98668      103261388
VRL30        5540       18832044
VRL31        68007      182013690
VRL32        77130      186429293
VRL33        62412      150353609
VRL34        75212      192344771
VRL35        82651      172710343
VRL36        66058      129411920
VRL37        79906      173519630
VRL38        58502      186700471
VRL39        20334      214784799
VRL4         94614      149040310
VRL40        308        7390561
VRL41        16442      218139043
VRL42        9275       222957947
VRL43        22755      206048008
VRL44        30597      57042624
VRL5         87219      144400290
VRL6         93295      144790073
VRL7         130407     141356554
VRL8         70155      88267538
VRL9         121334     144550574
VRT1         69995      272666280
VRT10        37396      74041240
VRT100       1          268302114
VRT101       3          319484498
VRT102       5          386368861
VRT103       7          393936069
VRT104       7          384166854
VRT105       1          46063367
VRT106       7          344525641
VRT107       6          384186008
VRT108       8          388949147
VRT109       10         334173277
VRT11        18698      27611025
VRT110       1          221441380
VRT111       3          375404155
VRT112       10         379167312
VRT113       34         391313315
VRT114       5          50284038
VRT115       1          772932187
VRT116       1          662004353
VRT117       1          535506559
VRT118       1          376147139
VRT119       1          364230008
VRT12        5986       380511905
VRT120       1          346409914
VRT121       1          311292523
VRT122       1          247732340
VRT123       1          228143320
VRT124       1          221182781
VRT125       2          321892640
VRT126       490        332426844
VRT127       12         378048109
VRT128       9          378909870
VRT129       6          345737823
VRT13        3363       217068541
VRT130       2          137693511
VRT131       7          385107928
VRT132       8          360581972
VRT133       10         364952837
VRT134       4          133261911
VRT135       8          359905961
VRT136       5          370674748
VRT137       9          378247816
VRT138       6          166907986
VRT139       14         379842153
VRT14        4685       4674270
VRT140       15         375595384
VRT141       41         289507176
VRT142       11         366984719
VRT143       1          550518975
VRT144       1          529596002
VRT145       1          413748038
VRT146       1          326378286
VRT147       1          272612222
VRT148       1          260396842
VRT149       1          197956435
VRT15        1171       26255719
VRT150       2          384149701
VRT151       2          288058306
VRT152       4          353983664
VRT153       433        371853020
VRT154       2          310725315
VRT155       2          280326572
VRT156       3          371471404
VRT157       3          354148189
VRT158       3          303679844
VRT159       4          341249946
VRT16        293        13983146
VRT160       18         371172209
VRT161       13         392880011
VRT162       31         343660166
VRT163       6          380232225
VRT164       5          292523491
VRT165       6          330076811
VRT166       7          362796652
VRT167       8          365387335
VRT168       10         273525883
VRT169       9          378695651
VRT17        37         392789976
VRT170       11         392251032
VRT171       6          341206380
VRT172       7          347210350
VRT173       7          370650631
VRT174       8          391548385
VRT175       6          385659507
VRT176       7          341110862
VRT177       1          55350661
VRT178       8          387616857
VRT179       4          361001021
VRT18        13         392458500
VRT180       8          377957950
VRT181       28         355939628
VRT182       1          53950911
VRT183       7          387415360
VRT184       7          365756282
VRT185       6          352657526
VRT186       5          346047628
VRT187       2          134650353
VRT188       5          356250620
VRT189       6          374573269
VRT19        12         379958897
VRT190       6          364137996
VRT191       7          343458516
VRT192       2          121348818
VRT193       7          358240592
VRT194       8          383435354
VRT195       8          365970383
VRT196       6          357597984
VRT197       7          355728138
VRT198       8          362648569
VRT199       7          390172982
VRT2         72837      271754118
VRT20        11         316368323
VRT200       8          391413434
VRT201       8          377681388
VRT202       1          42933508
VRT203       41         376509374
VRT204       14         390979946
VRT205       13         383659375
VRT206       18         263560073
VRT207       2          352563619
VRT208       7          386835620
VRT209       4314       352825248
VRT21        13         385338369
VRT210       19         370712563
VRT211       15971      152779448
VRT212       139462     132436075
VRT213       143804     126507589
VRT214       120652     116818991
VRT22        14         372163844
VRT23        14         352781625
VRT24        19         384683297
VRT25        16         379729070
VRT26        16         381718727
VRT27        2          51507477
VRT28        27         3633251
VRT29        147        10842596
VRT3         8981       333359159
VRT30        586        15797052
VRT31        2343       67436863
VRT32        19198      357652178
VRT33        54166      304801617
VRT34        158685     137229451
VRT35        18076      13367181
VRT36        117709     200755995
VRT37        158070     126698748
VRT38        119806     84215793
VRT39        185768     123628345
VRT4         3          141387178
VRT40        148461     105734485
VRT41        168366     113507788
VRT42        8317       7106746
VRT43        132996     105667475
VRT44        156584     117902359
VRT45        141367     86928175
VRT46        188428     120009593
VRT47        102812     61042132
VRT48        157728     119379169
VRT49        143816     147411263
VRT5         8          354279535
VRT50        136        390164188
VRT51        379        379967583
VRT52        1980       384952821
VRT53        93276      219917117
VRT54        145106     21008965
VRT55        75789      25336814
VRT56        13375      365641119
VRT57        20         379347618
VRT58        270        393447049
VRT59        3067       391133617
VRT6         11         387350249
VRT60        3471       230588304
VRT61        6443       378555114
VRT62        16         388667304
VRT63        16         378559418
VRT64        12         379509384
VRT65        7          285874095
VRT66        12         387522266
VRT67        18         375242791
VRT68        16         386329687
VRT69        229        277860126
VRT7         11         393947221
VRT70        17         367327734
VRT71        15         385834222
VRT72        7          149460915
VRT73        1          350098611
VRT74        1          332461053
VRT75        1          309313702
VRT76        1          293870033
VRT77        1          232056431
VRT78        1          209933285
VRT79        1          199226436
VRT8         30744      333424138
VRT80        2          392231039
VRT81        2          338442208
VRT82        2          304508243
VRT83        3          317261932
VRT84        7          378896727
VRT85        11         374771935
VRT86        13         379441801
VRT87        3          70710155
VRT88        16         344076996
VRT89        10         385210617
VRT9         74944      70627326
VRT90        15         392781064
VRT91        22         370094349
VRT92        1          839681426
VRT93        1          825560060
VRT94        1          595904407
VRT95        1          486875112
VRT96        1          387033265
VRT97        1          371528181
VRT98        1          313513962
VRT99        1          277530821

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 240.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

1940267 157978107922   Triticum aestivum
1347247  88465694129   Hordeum vulgare subsp. vulgare
27186285 23860357108   Homo sapiens
10025758 10448734198   Mus musculus
23016     9981170687   Triticum turgidum subsp. durum
1730064   9551308783   Danio rerio
140008    9409153885   Escherichia coli
2201462   6546961859   Rattus norvegicus
1470346   5773790917   Canis lupus familiaris
2239955   5439613628   Bos taurus
4218506   5261021509   Zea mays
53        5178609725   Rhinatrema bivittatum
3304542   5079309209   Sus scrofa
16        4548061038   Microcaecilia unicolor
8         4333590552   Orchesella sp. BIOUG14422-C09
17482     4115109778   Klebsiella pneumoniae
39        3773645297   Geotrypetes seraphini
68        3468703821   Erpetoichthys calabaricus
851       3086460368   Sarcophilus harrisii
2052      3015538361   Bordetella pertussis

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          October 15 2020

                NCBI-GenBank Flat File Release 240.0

                     Bacterial Sequences (Part 1)

   51396 loci,    92682287 bases, from    51396 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, probably 'LINEAGE' . This might occur sometime in 2009
   or 2010.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA).
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
5. Feature labels.

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, the `/direction' qualifier has only three values `left,'
`right,' or `both.' These are called controlled vocabulary qualifier
values. Controlled qualifier values are not case sensitive; they can
be entered in any combination of upper- and lowercase without changing
their meaning.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

  The `/label=' qualifier takes a feature label as its qualifier.
Although feature labels are optional, they allow unambiguous
references to the feature. The feature label identifies a feature
within an entry; when combined with the accession number and the name
of the data bank from which it came, it is a unique tag for that
feature. Feature labels must be unique within an entry, but can be the
same as a feature label in another entry. Feature labels are not case
sensitive; they can be entered in any combination of upper-and
lowercase without changing their meaning.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers E, Cavanaugh M, Clark K, Ostell J, Pruitt K,
   Karsch-Mizrachi I, "GenBank", Nucleic Acids Research,
   Volume 47, Issue D1, January 2019, pp. D94-D99

   PMID:  30365038
   PMCID: PMC6323954
   DOI:   10.1093/nar/gky989

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, E. et al, Nucleic Acids Res. 47(D1):D94-D99 (2019)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://0-www.ncbi.nlm.nih.gov.brum.beds.ac.uk/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Sequin can be used to submit revisions to previous
submissions.  In addition, suggestions and corrections can be sent by
electronic mail to:  update@ncbi.nlm.nih.gov.  Please be certain to
indicate the GenBank release number (e.g., Release 218.0) and the
primary accession number of the entry to which your comments apply; it
is helpful if you also give the entry name and the current contents of
any data field for which you are recommending a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Larry Chlumsky, Karen Clark, Jianli Dai, Scott Durkin,
	Francescopaolo di Cello, Michel Eschenbrenner, Michael Fetchko,
	Linda Frisse, Andrea Gocke, Anjanette Johnston, Mark Landree, Jason Lowry,
	Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Leigh Riley,
	Susan Schafer, Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Jonathan Kans, Leonid Khotomliansky,
	Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov,
	Alexey Kuznetsov, Frank Ludwig, Anatoly Mnev, Vasuki Palanigobu,
	Anton Perkov, Andriy Petrow, Sergey Petrunin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Elena Starchenko, Hanzhen Sun,
	Andrei Vereshchagin, Jewen Xiao, Eugene Yaschenko, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	Sherri Bailey, William Bocik, David Brodsky, Peter Cooper, Jada Lewis,
	Hanguan Liu, Bonnie Maidak, Wayne Matten, Scott McGinnis, Rana Morris,
	Monica Romiti, Eric Sayers, Tao Tao, Majda Valjavec-Gratian

Project Direction
	Steve Sherry : Acting Director, NCBI
	Kim Pruitt   : Branch Chief, NCBI/IEB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center