U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:105490. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002080.1          1   MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQ   50
XP_001155614.1       1   MARATLSTAPSNPRVLRVALLLLLLVAAGRRAAGAPLATELRCQCLQTLQ   50
XP_001092240.1       1   MASPALSTAPSNLRLLRVALLLLLLVAASRRAAGAPLVTELRCQCLQTLH   50
NP_001039978.1       1   MARAATAAAP---RLLRTAMLLLLLVAAGRRAAGAPVVNELRCHCLQTLQ   47
NP_776724.1          1   MAPAAS-SAP---RLLRAAMLLLLLVAAGRRAAGAPVVNELRCQCLQTLQ   46
NP_783631.1          1   MAPAATAAAP---RLLRAAMLFLLLVAAGRRAAGAPVVNELRCQCLQTLQ   47
NP_032202.1          1   MIPATR-------SLLCAALLLL---ATSRLATGAPIANELRCQCLQTMA   40
NP_110472.1          1   MVSATR-------SLLCAALPVL---ATSRQATGAPVANELRCQCLQTVA   40


NP_002080.1         51   GIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM   100
XP_001155614.1      51   GIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPTSPMVKKIIEKM   100
XP_001092240.1      51   GIHPKNIQSVNVKAPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIGKM   100
NP_001039978.1      48   GIHLKNIQSVKVTPPGPHCGQTEVIATLKNGQEACLNPEAPMVKKIINKM   97
NP_776724.1         47   GIHLKNIQSVKVTTPGPHCDQTEVIATLKTGQEVCLNPAAPMVKKIIDKM   96
NP_783631.1         48   GIHLKNIQSVKVTTPGPHCDQTEVIASLKTGQEVCLNPTAPMVKKIIDKM   97
NP_032202.1         41   GIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKM   90
NP_110472.1         41   GIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKM   90


NP_002080.1        101   LKNGKSN   107
XP_001155614.1     101   LKNGKSN   107
XP_001092240.1     101   LNNGKSN   107
NP_001039978.1      98   LNKGSTN   104
NP_776724.1         97   LN-----   98
NP_783631.1         98   LNKASAN   104
NP_032202.1         91   LK-GVPK   96
NP_110472.1         91   LK-GVPK   96


Protein Acc. Gene Organism
NP_002080.1 CXCL2 H.sapiens
XP_001155614.1 CXCL2 P.troglodytes
XP_001092240.1 CXCL2 M.mulatta
NP_001039978.1 CXCL3 B.taurus
NP_776724.1 CXCL2 B.taurus
NP_783631.1 GRO1 B.taurus
NP_032202.1 Cxcl1 M.musculus
NP_110472.1 Cxcl1 R.norvegicus


Support Center