Display Settings:

Format

Send to:

Choose Destination
HomoloGene:132326. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001004454.1       1   MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLLIILAI   50
XP_528414.3          1   MERINHTSSVSEFILLGLSSRPEDQKPFFVLFLIVYLVTITGNLLIILAI   50
XP_003435361.2       1   MARVNQTSSVSEFILLGLSSQPEDQKPLFILFLTMYLITIIGNLLIILAI   50
XP_002691591.1       1   MERLNQTSSVSEFILLGLSSQPEDQKPLFILFLIMYLVTITGNLLIILAI   50
XP_002683764.1       1   MERLNQTSRVSEFILLGLSSLPEDQKPLFIIFFIIYLVTITGNLLIILAI   50
XP_002707763.1       1   MERLNQTSSVSEFILLGLSSRPXDQKPLFILFLIIYLVTITGNLLIILAI   50
XP_003586714.1       1   MERLNQTSSVSEFILLGLSSRPEDQKPLFILFLIIYLVTITGNLLIILAI   50
XP_002691592.1       1   MERLNQTSSVSEFILLGLSSRPQDQKPLFILFLIIYLVTITGNLLIVLAI   50
XP_002684027.1       1   MERLNQTSRVSEFILMGLSSLPEDQKPLFIIFFIIYLVTITGNLLIILAI   50
XP_002691594.1       1   MERLNQTSRVSEFILMGLSSLPEDQKPLFIIFFIIYLVTITGNLLIILAI   50
XP_002691593.1       1   MERLNQTSRVSEFILMGLSSLPEDQKPLFIIFFIIYLVTITGNLLIILAI   50
XP_002691590.1       1   MERLNQTSSVTEFILLGLSSRPEDQKPLFILFLIIYLITITGNLLIILAI   50
NP_666836.1          1   MEGVNQTRFVSEFILLGLSPRPEDQKPLFILFLTIYLVTLTGNLLIILAI   50
NP_001000825.1       1   MERDNKTNIVSEFILLGLSTRPEDQKPLFILFLTIYLITLAGNLLIILVI   50


NP_001004454.1      51   RFNPHLQTPMYFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLT   100
XP_528414.3         51   CFNPHLQTPMYFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLT   100
XP_003435361.2      51   HSDPQLQTPMYFFLSFLSFTDICFTTTVVPRMLVSF-LSKKTISYAGCLT   99
XP_002691591.1      51   RSDPQLHTPMYFFLSVLSFTDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_002683764.1      51   HSDSQLQTPMYFFLSFLSFIDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_002707763.1      51   HSDPQLHTPMYFFLSFLSFTDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_003586714.1      51   CSDPQLHTPMYFFLSFLSFTDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_002691592.1      51   CSDPQLHTPMYFFLSVLSFTDICFTTTIVPRMLVNF-LSHKTISYAGCLS   99
XP_002684027.1      51   HSDSQLQTPMYFFLSFLSFIDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_002691594.1      51   HSDSQLQTPMYFFLSFLSFIDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_002691593.1      51   HSDSQLQTPMYFFLSFLSFIDICFTTTIVPRMLVNF-LSHKTISYAGCLT   99
XP_002691590.1      51   HSHPQLHTPMYFFLSVLSFTDIWYTTTIVPKMLVDFLLEKKTISYAGCLT   100
NP_666836.1         51   RSDPHLHTPMYFFLSFLSLTDICFTTTIVPKMLVNFLSEKKTISYAGCLT   100
NP_001000825.1      51   HSDPHLQTPMYFFLSFLSLTDICFTTTIVPKMLVNFLSEKKTISYAGCLT   100


NP_001004454.1     101   QMYFLYALGNSDSCLLAVMAFDRYVAVCDPFHYVTTMSHHHCVLLVAFSC   150
XP_528414.3        101   QMYFLYALGNGDSCLLAVMAFDRYVAVCDPFHYVTTMSHHHGVLLVVFFC   150
XP_003435361.2     100   QMYFIYALGNTDSCLLAVMAFDRYVAICDPFHYVTTMNRRCCVLLVAFSC   149
XP_002691591.1     100   QMYFIYALGNTDSCLLAVMAYDRYVAICDPFHYVTIMSHRRCVLLVAFSC   149
XP_002683764.1     100   QMYFIYALGNTDSWLLVVMAFDRYVAICDPFHYVTIMSHHRCVLLVAFSC   149
XP_002707763.1     100   QMYFIYALGNTDSWLLVVMAFDRYVAICDPFHYVTIMSHHRSVLLVAISC   149
XP_003586714.1     100   QMYFIYALGNTDSWLLVVMAFDRYVAICDPFHYVTIMSHRRCVLLVAFSC   149
XP_002691592.1     100   QMYFIYALGNTDSCLLAVMAFDRYVAICDPFHYVTIMGHRRCVLLVAFSC   149
XP_002684027.1     100   QMYFIYALGNTDSWLLVVMAFDRYVAICDPFHYVTIMSHHRCVLLVAFSC   149
XP_002691594.1     100   QMYFIYALGNTDSWLLVVMAFDRYVAICDPFHYVTIMSHHRCVLLVAFSC   149
XP_002691593.1     100   QMYFIYALGNTDSWLLVVMAFDRYVAICDPFHYVTIMSHHRCVLLVAFSC   149
XP_002691590.1     101   QMYFIYALGNIDSCLLVAMAYDRYVAICDPFHYVTIMSHQRCVLMVAFSC   150
NP_666836.1        101   QMYFLYALGNSDSCLLAVMAFDRYVAICNPFHYVTIMNHHRCALLVTFSC   150
NP_001000825.1     101   QMYFLYALGNSDSCLLAVMAFDRYVAICNPFHYVTIMNHHRCVLLVTFSC   150


NP_001004454.1     151   SFPHLHSLLHTLLLNRLTFCDSNVIHHFLCDLSPVLKLSCSSIFVNEIVQ   200
XP_528414.3        151   SFPHLHSLLHTLLLNRLTFCDSNVIHHFLCDLSPVLKLSCSSIFVNEIVQ   200
XP_003435361.2     150   SLPHFHSLVHTLLLNSLTFCDSNVIHHFLCDLSPLMKLSCSSTFVNEVVI   199
XP_002691591.1     150   SLPHFHSLLHTLLLNQLTFCDSNIIHNFLCDLSPLIKLSCSPTFVNEIVI   199
XP_002683764.1     150   SLPHFHSLLHTLLLNQVTFCDSNIIHHFLCDFSPLVKLSCSSTFVNEIVM   199
XP_002707763.1     150   SLPHFHSLLHTLLLNHLTFCDSNIIHHFLCDLSPLMKLSCSSTFVNEIVL   199
XP_003586714.1     150   SLPHFHSLLHTLLLNHLTFCDSNIIHHFLCDLSPLMKLSCSSTFVNEIVL   199
XP_002691592.1     150   SLPHFHSLLHVLLLNQLTFCDSNVIHHFLCDLSPLMKLSCSPTLINEIVI   199
XP_002684027.1     150   SLPHFHSLLHTLLLNQVTFCDSNIIHHFLCDFSPLVKLSCSSTFVNEIVM   199
XP_002691594.1     150   SLPHFHSLLHTLLLNQVTFCDSNIIHHFLCDFSPLVKLSCSSTFVNEIVM   199
XP_002691593.1     150   SLPHFHSLLHTLLLNQVTFCDSNIIHHFLCDFSPLVKLSCSSTFVNEIVM   199
XP_002691590.1     151   SLPHFHSLLHILLLNQLTFCDSNIIHHFLCDLSPLIKLSCSPTFVNEIVL   200
NP_666836.1        151   SFPHFHSLLHTLLLNLLTFCDSNVIHHFLCDLSPLLKLSCSSTFVNEIVI   200
NP_001000825.1     151   SFPHLHSLLHTLLLNLLTFCDSNVIHHFLCDLSPLIKLSCSSTFVNEIVI   200


NP_001004454.1     201   MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT   250
XP_528414.3        201   MTEAPIVLVTPFLCIAFSYIRILTTVLKIPSTSGKRKDFSTSGFNLTVVT   250
XP_003435361.2     200   ISEGSVVLVTPFLCITLSYVRILIAVLKIPSAAGKRKAFSTCGSHLTVVT   249
XP_002691591.1     200   LIEGSFILVTPFLCITFSYIQILIAVLKIPSASGKRKAFSTCGSHLTVVT   249
XP_002683764.1     200   MIEGSVFLVTPFLCITFSYIRILLAVLKIPSAAGKCKAFSTCGSHLTVVT   249
XP_002707763.1     200   MTEAXAFLVTPFLCIAFSYIRILITVLKIPSAAGKHKAFSTCGSHLTVVT   249
XP_003586714.1     200   MTEASAFLVTPFLCIAFSYIRILITVLKIPSAAGKHKAFSTCGSHLTVVT   249
XP_002691592.1     200   MTEGPVLLVTPFLFITFSYIRILIAILKIPSTSGKHKAFSTCGSHLTVVT   249
XP_002684027.1     200   MIEGSVFLVTPFLCITFSYIRILLAVLKIPSAAGKCKAFSTCGSHLTVVT   249
XP_002691594.1     200   MIEGSVFLVTPFLCITFSYIRILLAVLKIPSAAGKCKAFSTCGSHLTVVT   249
XP_002691593.1     200   MIEGSVFLVTPFLCITFSYIRILLAVLKIPSAAGKCKAFSTCGSHLTVVT   249
XP_002691590.1     201   MTEASAFLVTPFLCIVFSYIRILVVVLKIPSAAGKCKAFSTCGSHLTVVT   250
NP_666836.1        201   VTEGALVLVTPFLCIAFSYIRILVTVLKIPSAAGKRKAFSTCGSHFTVVT   250
NP_001000825.1     201   VTEGALVLVTPFLCIAFSYIRILITVLKIPSAAGKCKAFSTCGSHLTVVI   250


NP_001004454.1     251   LFYGSIFCVYLQPPSTYAVKDHVATIVYTVLSSMLNPFIYSLRNKDLKQG   300
XP_528414.3        251   LFYGSIFYVYLQPPSTYTVKDHVATTVYTVLSSMLNPFIYSLRNKDLKQG   300
XP_003435361.2     250   LFYGSIFYVYLQPLSTYSARDHIATIVYTVLSSMLNPFIYSLRNKDLKQS   299
XP_002691591.1     250   LFYGSIFYVYLQPVSTYTVRDHMATIVYTVLSSMLNPFIYSLRNKDLKQG   299
XP_002683764.1     250   LFYGSIFYVYLQPVSTYTVRDHMATIVYTVLTSTLNPFIYSLRNKDLKQG   299
XP_002707763.1     250   LFYGSIFYVYLQPVSTYTVRDHVATIVYTVLSSLLNPFIYSLRNKDLKQG   299
XP_003586714.1     250   LFYGSIFYVYLQPVSTYTVRDHVATIVYTVLSSMLNPFIYSLRNKDLKQG   299
XP_002691592.1     250   LFYGSIFYVYLQPVSTYTVRDHVATIVYTVLSSMLNPFIYSLRNKDLKQS   299
XP_002684027.1     250   LFYGSIFYVYLQPVSTYTVRDHMATIVYTVLTSTLNPFIYSLRNKDLKQG   299
XP_002691594.1     250   LFYGSIFYVYLQPVSTYTVRDHMATIVYTVLTSTLNPFIYSLRNKDLKQG   299
XP_002691593.1     250   LFYGSIFYVYLQPVSTYTVRDHMATIVYTVLTSTLNPFIYSLRNKDLKQG   299
XP_002691590.1     251   LFYGSIFYVYLQPVSTYTVRDHMATIVHTILSSMLNPFIYSLRNKDLKQG   300
NP_666836.1        251   LFYGSIFYVYLQPVSTYTVKDHIATIVYTVLSSMLNPFIYSLRNKDLKQG   300
NP_001000825.1     251   LFYGSIFYVYLQPVSTYTVKDHIATIIYTVLSSMLNPFIYSLRNKDLKQG   300


NP_001004454.1     301   LRKLMSK-----------------------------------RS------   309
XP_528414.3        301   LRKLMSK-----------------------------------RS------   309
XP_003435361.2     300   LRKLMGRMIFALRGVTLWALANPELITTNITIKTLVEINKVHRGLLKHQS   349
XP_002691591.1     300   LRKLVGR-----------------------------------RKPQAAPS   314
XP_002683764.1     300   LRKLLVR-----------------------------------RKP-----   309
XP_002707763.1     300   LRKLVGR-----------------------------------RKPQAAPP   314
XP_003586714.1     300   LRKLVGR-----------------------------------RKPQAAPP   314
XP_002691592.1     300   LRKLVGR-----------------------------------RKPQTAPP   314
XP_002684027.1     300   LRKLLVR-----------------------------------RKP-----   309
XP_002691594.1     300   LRKLLVR-----------------------------------RKP-----   309
XP_002691593.1     300   LRKLLVR-----------------------------------RKP-----   309
XP_002691590.1     301   LRKLVGR-----------------------------------RGLQAATS   315
NP_666836.1        301   LRKLISR-----------------------------------RHI-----   310
NP_001000825.1     301   LRKLISR-----------------------------------RRI-----   310


NP_001004454.1           --
XP_528414.3              --
XP_003435361.2     350   SA   351
XP_002691591.1           --
XP_002683764.1           --
XP_002707763.1           --
XP_003586714.1           --
XP_002691592.1           --
XP_002684027.1           --
XP_002691594.1           --
XP_002691593.1           --
XP_002691590.1           --
NP_666836.1              --
NP_001000825.1           --


Protein Acc. Gene Organism
NP_001004454.1 OR1L8 H.sapiens
XP_528414.3 LOC473044 P.troglodytes
XP_003435361.2 LOC100687372 C.lupus
XP_002691591.1 LOC511741 B.taurus
XP_002683764.1 LOC100337234 B.taurus
XP_002707763.1 LOC531878 B.taurus
XP_003586714.1 LOC787415 B.taurus
XP_002691592.1 LOC515482 B.taurus
XP_002684027.1 LOC100301469 B.taurus
XP_002691594.1 LOC509074 B.taurus
XP_002691593.1 LOC100337506 B.taurus
XP_002691590.1 LOC787071 B.taurus
NP_666836.1 Olfr355 M.musculus
NP_001000825.1 Olr418 R.norvegicus


Support Center