Display Settings:

Format

Send to:

Choose Destination
HomoloGene:133031. Gene conserved in Euarchontoglires Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001005235.1       1   METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAI   50
XP_528418.1          1   METKNYSSSTSGFILLGLSSNPQLQKPLFAIFFIMYLLTAVGNVLIILAI   50
XP_528419.3          1   MEIKNYSSSTSGFILLGLSSNPQLQKPLFAIFFIMYLLTAVGNVLIILAI   50
NP_001000823.1       1   ----MNSSSTSDFILLGLSSDPWMQKPLFVIFIVMYLVTVVGNVLIILVI   46


NP_001005235.1      51   YSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNFLSETKIISYVGCLI   100
XP_528418.1         51   YSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNFLSETKVISYVGYLV   100
XP_528419.3         51   YSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNFLSETKVISYVGCLV   100
NP_001000823.1      47   RSDTKLHTPMYFFLSNLSFMDICFTTVIVPKMLVNVLSKTKTISYVGCLV   96


NP_001005235.1     101   QMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPWHCLLMLLGSC   150
XP_528418.1        101   QMYFFMAFANTDSYLLASMAIDRLVAICNPLHYDVVMKPWHCLLMLMGSC   150
XP_528419.3        101   QMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPWHCLLMLMGSC   150
NP_001000823.1      97   QMYFFIALANTDSYLLASMAIDRLVAICNPLHYDVVMRPQHCLLMLLGSC   146


NP_001005235.1     151   SISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVV   200
XP_528418.1        151   SISHLHSLFRVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTSSSQMVV   200
XP_528419.3        151   SISHLHSLFRVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTSSSQMVV   200
NP_001000823.1     147   TISHLHALFRVLLMSRLSFCASHVIKHFFCDTQPVLKLSCSDTSSNQIVV   196


NP_001005235.1     201   MTETLAVIVTPFLCTIFSYLQIIVTVLRIPSAAGKWKAFSTCGSHLTVVV   250
XP_528418.1        201   MTETLAVIVTPFLCIIFSYLRIIVTVLRIPSAAGKWKAFSTCGSHLTVVV   250
XP_528419.3        201   MTETLAVIVTPFLCIIFSYLQIIVTVLRIPSAAGKWKAFSTCGSHLTVVA   250
NP_001000823.1     197   MTETLAVIVTPFLCILFSYLRIIVTVLRIPSAAGKWKAFSTCGSHLTVVS   246


NP_001005235.1     251   LFYGSVIYVYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKR   300
XP_528418.1        251   LFYGSVIYVYFRPLSMYSVMKDRVATVMYTVVTPMLNPFIYSLRNKDMKR   300
XP_528419.3        251   LFYGSVIYVYFRPLSMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKK   300
NP_001000823.1     247   LFYGSVIYVYFRPLSMYSVVKDRVATIMYTVVTPMMNPFIYSLRNKDMKR   296


NP_001005235.1     301   GLKKLRHRIYS   311
XP_528418.1        301   GLKKLRDRIYS   311
XP_528419.3        301   GLKKLRDRIYR   311
NP_001000823.1     297   GLRKLRDRFHS   307


Protein Acc. Gene Organism
NP_001005235.1 OR1L4 H.sapiens
XP_528418.1 LOC473048 P.troglodytes
XP_528419.3 LOC473049 P.troglodytes
NP_001000823.1 Olr427 R.norvegicus


Support Center