Display Settings:

Format

Send to:

Choose Destination
HomoloGene:133078. Gene conserved in Eukaryota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_005176.1          1   MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELR   50
XP_003951634.1       1   MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELR   50
NP_081692.1          1   MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQ   50
NP_001012054.1       1   MANQLTEEQIAEFKEAFSLFDKDGDGCITTQELGTVMRSLGQNPTEAELQ   50
NP_001075166.1       1   MAERLSEEQIAEFKEAFSLFDRDGDGCITTMELGTVMRSLGQNPTEAELQ   50
NP_176814.1          1   MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQ   50
NP_198594.1          1   MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQ   50
NP_001055907.1       1   MADQLTDEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQ   50


NP_005176.1         51   DMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGF   100
XP_003951634.1      51   DMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGF   100
NP_081692.1         51   GMVNEIDKDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGF   100
NP_001012054.1      51   DMVNEIDKDGNGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGF   100
NP_001075166.1      51   DMVGEVDADGSGTIDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGY   100
NP_176814.1         51   DMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGF   100
NP_198594.1         51   DMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGF   100
NP_001055907.1      51   DMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGF   100


NP_005176.1        101   VSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK   149
XP_003951634.1     101   VSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK   149
NP_081692.1        101   VSAAELRHVMTKLGEKLSDEEVDEMIQAADTDGDGQVNYEEFVHMLVSK   149
NP_001012054.1     101   VSAAELRHVMTRLGEKLSDEEVDEMIQAADTDGDGQVNYEEFVHMLVSK   149
NP_001075166.1     101   ISAAELRHVMTNLGEKLTDEEVDEMIKEADCNNDGQVNYEEFVRMMTEK   149
NP_176814.1        101   ISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK   149
NP_198594.1        101   ISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK   149
NP_001055907.1     101   ISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK   149


Protein Acc. Gene Organism
NP_005176.1 CALML3 H.sapiens
XP_003951634.1 CALML3 P.troglodytes
NP_081692.1 Calml3 M.musculus
NP_001012054.1 Calml3 R.norvegicus
NP_001075166.1 CALML3 G.gallus
NP_176814.1 CAM4 A.thaliana
NP_198594.1 CAM1 A.thaliana
NP_001055907.1 Os05g0491100 O.sativa


Support Center