Display Settings:

Format

Send to:

Choose Destination
HomoloGene:134531. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_083324.3          1   MGEGTPGVDSARVQEEGGRDQSLGFVEGRIQVGRIVTAGQLSLCSEEQSP   50
NP_001029325.1       1   MAASGPSSQ-----------------------------------SEEQCP   15


NP_083324.3         51   QPGITRPSPGVVVDGESSGLAEPRVEATPQPPSSIQKRKRDESLDSEDDL   100
NP_001029325.1      16   QLSTTMASP--VMDDDIPGLSEPRVEARSQPPSSSPKRKRDLSSDSEDDL   63


NP_083324.3        101   AELFEPDPQPVWSVEMLCGLRMRLKRRRVSTVRPEHHKVFTKLLEDPVVK   150
NP_001029325.1      64   AELLEPDPQPVWSVETLCGLRMRLKRRRVSTVRPEHHKVFTRLLEDPVVK   113


NP_083324.3        151   KFLTWDKMLRVSDKYLLSMVIAYFSRAGLFSWQYRPIHFFLALYLANDME   200
NP_001029325.1     114   KFLNWDKMLRVSDKYLLSMVIAYFSRAGLFSWQYRPIHFFLALYLANDME   163


NP_083324.3        201   EDNQAPKQDIFYFLYGKSYAQRPMFHKLRFQFIRSMGWKIWVSREECEEI   250
NP_001029325.1     164   EDNQAPKQDIFYFLYGKSYAQRPMFHKLRFQFIRSMGWRIWVSREECEEI   213


NP_083324.3        251   QAYNPDLWVWARDRTNLT   268
NP_001029325.1     214   QAYNPDLWVWARDRTNLT   231


Protein Acc. Gene Organism
NP_083324.3 Spdyb M.musculus
NP_001029325.1 Spdye4 R.norvegicus


Support Center