Display Settings:

Format

Send to:

Choose Destination
HomoloGene:135984. Gene exclusive to R.norvegicus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001102921.1       1   MMNFGTSPLESIESEGALETLGPPPEPRAPEPWVLETEPGLDLSLSPSPL   50
XP_003751203.1       1   MMNFGTSPLESIESEGALETLGPPPEPRAPEPWVLETEPGLDLSLSPSPL   50


NP_001102921.1      51   PESPKQRKNSPGQRKGRRGGSRRGRQVRFQLAPPSPVRSEPRVAAGALGD   100
XP_003751203.1      51   PESPKQRKNSPGQRKGRRGGSRRGRQVRFQLAPPSPVRSEPRVAAGALGD   100


NP_001102921.1     101   GHELEAPALQSSLALSLELQNARAAVASGQFNASKAVEEQLRKSFQTRCV   150
XP_003751203.1     101   GHELEAPALQSSLALSLELQNARAAVASGQFNASKAVEEQLRKSFQTRCV   150


NP_001102921.1     151   LEETVAEGLNVPRSKRLYRDLVSLQVPEEQVLNAALREKLAMLPPQPRAP   200
XP_003751203.1     151   LEETVAEGLNVPRSKRLYRDLVSLQVPEEQVLNAALREKLAMLPPQPRAP   200


NP_001102921.1     201   PPKEVLGPGPDMTMLCNPDSLWYESPHLTVDGLPPLRLQARPRPSEDTFL   250
XP_003751203.1     201   PPKEVLGPGPDMTMLCNPDSLWYESPHLTVDGLPPLRLQARPRPSEDTFL   250


NP_001102921.1     251   MHQMLRRWEA   260
XP_003751203.1     251   MHQMLRRWEA   260


Protein Acc. Gene Organism
NP_001102921.1 Ppp1r35 R.norvegicus
XP_003751203.1 LOC100910581 R.norvegicus


Support Center