Display Settings:

Format

Send to:

Choose Destination
HomoloGene:135996. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_082735.2          1   MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADR   50
NP_001103835.1       1   MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADR   50


NP_082735.2         51   NCMWAKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSP   100
NP_001103835.1      51   NCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSP   100


NP_082735.2        101   RGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPN   150
NP_001103835.1     101   RGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPN   150


NP_082735.2        151   GPNLPMATVDIKNPEITTNRFYGSQVNNISHTKEKKKGKAKKKRLTKADI   200
NP_001103835.1     151   GPNLPMATVDIKNPEITTNRFYGSQVNNISHTKEKKKGKAKKKRLTKADI   200


NP_082735.2        201   GTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSK   250
NP_001103835.1     201   GTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSK   250


NP_082735.2        251   VIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPP   300
NP_001103835.1     251   VIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPP   300


NP_082735.2        301   ARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSS   350
NP_001103835.1     301   ARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSS   350


NP_082735.2        351   APSGPPPPPPPSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPAPSG   400
NP_001103835.1     351   APSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSG   400


NP_082735.2        401   NKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQ   450
NP_001103835.1     401   NKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQ   450


NP_082735.2        451   ESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFEDDDEWE   500
NP_001103835.1     451   ESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFEDDDEWE   500


NP_082735.2        501   D   501
NP_001103835.1     501   D   501


Protein Acc. Gene Organism
NP_082735.2 Wasl M.musculus
NP_001103835.1 Wasl R.norvegicus


Support Center