Display Settings:

Format

Send to:

Choose Destination
HomoloGene:136207. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001156887.1       1   -------MAPLTPRLQLKVDELFRRWLGDPHTQRALSHALRRIRDPGTTS   43
NP_001132964.1       1   MAPRKPPPSPLRPCLQMKVDELFLRWLSDPGTQRALRAGLRRIQGPAVIL   50


NP_001156887.1      44   DPAAAATPDADPGNTT---------SDPNPASRPLPRPALRTTGPRTVHA   84
NP_001132964.1      51   DHTVTPNPATALDSATKAIAAPAKIAPPDPAVTPNPAAIASSTAITKFSA   100


NP_001156887.1      85   HRK-----------EEPPPQSPPPGHSVPAFYFPCGRPPPRPQDTEDAIA   123
NP_001132964.1     101   SRKRNRHRAVPPRGEEPGPKAPLPGRGIPAFYFPRGRPGQGP-DVDDVIA   149


NP_001156887.1     124   LVECAFEGLPRGRAGLGDMAVVAKACGCPLYWKAPLFYAAGGERTGS-VS   172
NP_001132964.1     150   DVERAFARLPSGRAGLQDMGVVAKACCCPLYWKAPLFLAAGGGAQGGFVS   199


NP_001156887.1     173   VHMFVAMWRKVLLTCHDDAARFVRLLGHPGCSGLIQEDFVPFLQDVVNSH   222
NP_001132964.1     200   ARDIIGLWKPILLTCHDEAARFERLLGGPGDGGLSPEDLAPLVQDVADSH   249


NP_001156887.1     223   PGLAFLRAAKDFHSRYITTVIQRIFYTVNRSWSGMISREELRRSSFLQAV   272
NP_001132964.1     250   PGLSFLREAEPLRRDYVTTVTQRVFYAVNRSWSGRISCQEIRRSCFLQAV   299


NP_001156887.1     273   SQLEVEPDINRMT-SFFSYEHFYVIYCKFWELDLDRDLTIDRSDLARHGD   321
NP_001132964.1     300   SQLEAEPNPGRATPSFFSYPHFCVIVSKFQALDADGDGLIDRHDLRRHAD   349


NP_001156887.1     322   GAISSRMIDRIFSGAVTRARLPRKVGKLSYADFVWFLLSEEDKTTPTSTE   371
NP_001132964.1     350   GAISSRMIDRIFSGAVTRARPSPEGGKMGLADFVWFLLSEEDKTTPTSTE   399


NP_001156887.1     372   YWFRCMDLDGDGALSMFELEFFYEEQAQRMAARGVEPLPFHDLARQVLDL   421
NP_001132964.1     400   YWFRCMDLDGDGVLSAPELSFFYEEQAQNLAARGAEPPPFADLTRQALDL   449


NP_001156887.1     422   VAPRCPGRITLRDLKQCGLAGEFFDAFFNVDKYLAREQREQAGTPQDTDS   471
NP_001132964.1     450   VQPRCPGQITLGDLKRCGLAGEFFDAFFNADKFLEHERREPAGPVRAPDA   499


NP_001156887.1     472   DPAASAWDRYAAEEYDFLVAEEAMAEDDDDHDEGSD----PIDLYGLADE   517
NP_001132964.1     500   DPTLSDWDRFAAAEYDFLLAEE--AQDDDAWEEGSESPPSSPDPYDFAD-   546


NP_001156887.1     518   DCDDLEPL   525
NP_001132964.1     547   --DTLDPL   552


Protein Acc. Gene Organism
NP_001156887.1 Ppp2r3d M.musculus
NP_001132964.1 Ppp2r3b R.norvegicus


Support Center