Display Settings:

Format

Send to:

Choose Destination
HomoloGene:136361. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001171367.1       1   MAWEPTYLLSPVLLLLLASGSWTQNPELLRVLEGKTVSVTCMYDPLYNSD   50
NP_848911.2          1   MAWEPTYLLSPVLLLLLASGSWTQNPELLRTQEGETVSVTCWYDSLYHSS   50
XP_006244556.1       1   MAWEATYLLSSMLLLLLASGSWAQDPEVFRTWEGKTVSVTCWHNPGYRFN   50


NP_001171367.1      51   EKIWCKQIDNL-CYPL---VSKGAEKPRFSILQSSKFNFFTVTMSKLRMS   96
NP_848911.2         51   EKIWCKQIDNL-CYPF---VSKSAEKPRFLIQQSSRFNFFTVTMTKLKMS   96
XP_006244556.1      51   EKFWCKETSEVACQPLVSSVSRGAEKLRLSIQEDSRFSFFTVTMTELETA   100


NP_001171367.1      97   DSGIYHCGIAANTR--ITYLRGIQLVVSKDDSSAPANGTFPTLR------   138
NP_848911.2         97   DSGIYHCGIVANNT--SVYLRNIHLVVSKGSSVVSTPDIIPATRLTKLPT   144
XP_006244556.1     101   DSGIYHCGFFGNQRNFIYILRTIHLVVSKVSSDVSIPDIIPIEKLTAVSI   150


NP_001171367.1     139   ----------AHTFRTTQDPISI---------------AARGSVSSVTIP   163
NP_848911.2        145   LITTKHSPSDTTTTRSLPQPTTVVSSPDPRVIIINGTDADRGFVSSVTIP   194
XP_006244556.1     151   LVTTKYSPSDTTTTPSLPKSTAVVSSPDPEVTVKNGTDPTRGCVFSV-VP   199


NP_001171367.1     164   VVCGLLSKTLVFTVLFIVTQKSFGRQAMKAHNSNS---------------   198
NP_848911.2        195   VVCGLLSKTLVFTVLFIVTQKSFGRQAMKAHNSNS---------------   229
XP_006244556.1     200   VVCALLIKNVIFIVLFAVTQRSFGXQILKLHNSDLQPCLSQKELTWGAKE   249


NP_001171367.1           --
NP_848911.2              --
XP_006244556.1     250   DL   251


Protein Acc. Gene Organism
NP_001171367.1 9830107B12Rik M.musculus
NP_848911.2 A530064D06Rik M.musculus
XP_006244556.1 LOC680920 R.norvegicus


Support Center