Display Settings:

Format

Send to:

Choose Destination
HomoloGene:136447. Gene conserved in Euarchontoglires Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_006716276.1       1   MCWLRAWGQILLPVFLSLFLIQLLISFSENGF-IHSPRNNQKPRDGNEEE   49
XP_003951119.1       1   MCWLRAWGQILLPVFLSLFLIQLLISFSENGF-IHSPRNNQKPRDGNEEE   49
NP_001186954.1       1   MCWLRAWSHILLPVFLSVALIQLIFNLSDHKTKTHHHWKRKIEAKYVEKE   50


XP_006716276.1      50   CAVKKSCQLCTEDKKCVWCSEEKACKKYCFPYFGCRFSSIYWLNCKVDMF   99
XP_003951119.1      50   CSVKKSCQLCTEDKKCVWCSEEKACKKYCFPYFGCRFSSIYWLNCKVDMF   99
NP_001186954.1      51   CAQKETCPVCTRDKRCIWCREEKVCKKYCFPYSDCKFNSIFWANCNVDLF   100


XP_006716276.1     100   GIMMLLLIAVLITGFVWYCCAYHFYLQDLNRNRVYFYGRRETVPIHDRSA   149
XP_003951119.1     100   GIMMLLLIAILITGFVWYCCAYHFYLQDLNRNRVYFYGRRETVPIHDRSA   149
NP_001186954.1     101   GIVMLILIVILALAFLWYCLAYYFYMQQ----HMALYARHGQVPVYNWDA   146


XP_006716276.1     150   TVYDE   154
XP_003951119.1     150   TVYDE   154
NP_001186954.1     147   PG-DW   150


Protein Acc. Gene Organism
XP_006716276.1 LOC102723899 H.sapiens
XP_003951119.1 LOC101058276 P.troglodytes
NP_001186954.1 1700015F17Rik M.musculus


Support Center