U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:138086. Gene conserved in Ascomycota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_451741.1          1   MSDLLPLAAYNLNIEPYTPTPAIDVTTPVTVRITMAAIDPEALDDEKNPS   50
NP_985009.2          1   MSELLPMATYNLNIEPYSPTPAIDVTVPVTVRLTMAAIDPESLDDEKKPA   50
NP_596694.1          1   MS--LPIAVYSLSVKG-KDVPAVEESTDASIHLTMASIDAG--EKSNKPT   45


XP_451741.1         51   TLRI-IKRNPDYDDEDDAGGLLGDYDEDELDISEEEEEEEEKSKSKKGKG   99
NP_985009.2         51   TLRL-IRRNPAFDDEDD---LLADSEE------EEEEESEEESEPETKKP   90
NP_596694.1         46   TLLVKVRPRIPVEDEDD----------------EELDEQMQELLEESQR-   78


XP_451741.1        100   KGKSKKQEEEEEEEEEDEDEGDEELIEIDTDDEFQEFVLATLSPKTQYQQ   149
NP_985009.2         91   KKKAAKAESEEEDSEEEDSEGE------DSDDEFEEFVLATLSPESQYQQ   134
NP_596694.1         79   -----------------------------------EFVLCTLKPGSLYQQ   93


XP_451741.1        150   SLDIVIAPEEEVQFIVTGSYRVSLTGNYVKHPF-DAPGYDDE--------   190
NP_985009.2        135   TLDLVISPEEEVQFVVTGSYRVSLSGNYVQHPYDDEDSYDEDHEGCGENC   184
NP_596694.1         94   PLNLTITPGDEVFFSASGDATIHLSGNFL---------VDEE--------   126


XP_451741.1        191   --DDDEE---DDESYDEDEDDYLTPDEEADLEELEDASDVEAKIQELVEK   235
NP_985009.2        185   ACDDDHEGCGDDCACDDDSDYDLTPDEE-DILDMEDASDVEAKIEELVEQ   233
NP_596694.1        127   --DEEEE--------ESDEDYDLSPTEE-DLVETVSGDEESEEESESEDN   165


XP_451741.1        236   EQSKSKKNNKRKQPEPEEEEEEEEEE-------EEEQKLVEETKKNKKAK   278
NP_985009.2        234   EEANEKRKADEDEPKAAKKQKKDQKDTKKDAKKDAKKDQKDQKDAKKDAK   283
NP_596694.1        166   SASEEDELDSAPAKKAQVKKKRTKDESEQEEAASPKKNNTKKQKVEGTPV   215


XP_451741.1        279   KEKKVEFKKDLEEGPTKKEEKKEEKK------EKPKTKVLEGGIIIEDRV   322
NP_985009.2        284   KEKKVEFKKDLEEGPSKK------KD------DKPKTKILEGGVVIEDRV   321
NP_596694.1        216   KEKKVAFAEKLEQGPTGPAAKKEKQQASSNAPSSPKTRTLKGGVVVTDVK   265


XP_451741.1        323   TGKGKACKKGSKVGMRYIGKLKNGKVFDKNTSGKPFVFNLGRGEVIKGWD   372
NP_985009.2        322   VGSGKAAKKGARVGMRYIGKLKNGKVFDKNTSGKPFVFKLGHGEVIKGWD   371
NP_596694.1        266   TGSGASATNGKKVEMRYIGKLENGKVFDKNTKGKPFAFILGRGEVIRGWD   315


XP_451741.1        373   IGVAGMAVGGERRIVIPAPYAYGKQALPGIPANSELTFDVKLVSLK   418
NP_985009.2        372   IGVAGMAVGGERRIVIPAAYAYGKQALPGIPANSELTFDVKLVSLK   417
NP_596694.1        316   VGVAGMQEGGERKITIPAPMAYGNQSIPGIPKNSTLVFEVKLVRVH   361


Protein Acc. Gene Organism
XP_451741.1 KLLA0B04664g K.lactis
NP_985009.2 AGOS_AER150W E.gossypii
NP_596694.1 fkbp39 S.pombe


Support Center