U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:140832. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_004949280.1       1   MPARPPAWLWLAAALGAVWPPRSSPVQGRRLICWQAVLQCQGEPECSYAY   50
XP_005173679.1       1   MGSILAFFISLLMTLDA------------QLVCWQALIRCHEERDCELAY   38


XP_004949280.1      51   NQYAEACAPVLLQQQPAAGGGDGPAAAAASAASRRRCPSHCIAALIQLNH   100
XP_005173679.1      39   NQYLTAC--------------DGNI-----RGSRKQCPSHCISALIRLNQ   69


XP_004949280.1     101   TRRGPALEDCDCAQDENCRATKRAIEPCLPRTNSPAAGGAGGGGPGGGAG   150
XP_005173679.1      70   TSSGTHLESCDCGIDVECLRAKRAIEPCMPRTH-----------PGDAEG   108


XP_004949280.1     151   GGPGVMGCTEARRRCDWDSRCSQALNRYMAYCGKLFNGLRCTPECRAVIE   200
XP_005173679.1     109   -----MGCTEARQRCEEEPRCQESLNAYLSRCGQLFNGRKCSSRCKSTIE   153


XP_004949280.1     201   DMLAVPKAVLLNDCVCDGLERPICESVKENMARLCFGADMGSNGAGSSGG   250
XP_005173679.1     154   ELLFMPNGVLLNQCVCDGLERPFCEVVKQNMAKLC---AIGDHSISIE--   198


XP_004949280.1     251   SDGGLEEYYDEDYEEEPSQKGRDEAEDNAGPEPGFPMQADGAGRAGSTAW   300
XP_005173679.1     199   HDGTDDLYEDEDYEGKPDGEVTDSDAVSISSALTFTPQ------------   236


XP_004949280.1     301   AMLASILLPLLPPL   314
XP_005173679.1     237   VVLICIGFA-LAGF   249


Protein Acc. Gene Organism
XP_004949280.1 GAS1 G.gallus
XP_005173679.1 si:ch1073-459b3.2 D.rerio


Support Center