U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:140834. Gene exclusive to G.gallus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_004949545.1       1   MENEVFRYLLFKPLDPKQLSLLKELTTLEICKVWEATSKYIWRQLLEKRA   50
XP_004949551.1       1   MENEVFRYLLFKPLDPKQLSLLQELTTLEICRVWEGTSKYIRRQLLEKRA   50
XP_004949553.1       1   MENEVFRYLLFKPLDPKQLSLLQELTTLEICRVWEGTSKYIRRQLLEKRA   50
XP_430498.4          1   MVAGVFRYLLFKPLDPKQLSLLKELSTLEICRVWETTSKYIQGQLLEKRA   50


XP_004949545.1      51   VDIGIGSFAVVSAHAAAREDGVLVVDKPIFQMNQHVQRFYKMKEPKTKIP   100
XP_004949551.1      51   VDIGIGSFAIVSARAAAGEDGVLVVDKPIFQLNQHVQRFYKIKEPKTKIP   100
XP_004949553.1      51   VDIGIGSFAIVSARAAAGEDGVLVVDKPIFQLNQHVQRFYKIKEPKTKIP   100
XP_430498.4         51   VDIGIGSFAVVSARAAAGEDGVLVVDKPIFQLNQHVQEFYEIKEPKTKIP   100


XP_004949545.1     101   SEIFEYPLNFREIAETICFRVPIIEHCIHETLLFFAEAIRGKKELDFFFK   150
XP_004949551.1     101   SDMFEYPLNFQEIAETISFRVPIVEQCVHETLLFFAEAIRGKKEVDFFFK   150
XP_004949553.1     101   SDMFEYPLNFQEIAETISFRVPIVEQCVHETLLFFAEAIRGKKEVDFFFK   150
XP_430498.4        101   SEMFEYPLDFQEIAKNSYFRVPIVERCIHETLLFFAEAIRGKKEVDFFFK   150


XP_004949545.1     151   RLGILSLRGQEVIMNFFDDCVLQLDATGNMLPALLGDSEMMNMIAFRGKN   200
XP_004949551.1     151   RLGILSLRGQEVIMNFFDDCVLQLDATGNMLPALLGDSKMMNMIAFRGKN   200
XP_004949553.1     151   RLGILSLRGQEVIMNFFDDCVLQLDATGNMLPALLGDSKMMNMIAFRGKN   200
XP_430498.4        151   RLGILSLRGQEVIMNFFDDCVLQLDATGNMLPALLGDPEMMNMIAFKGKN   200


XP_004949545.1     201   KFTRRSEDGCIVLPRIGVEGSKTSQEITSIKPRRESQPWGGGARRVSVYD   250
XP_004949551.1     201   KFSRQSEDGCIVLPRISVEGSKTSQDMTFFRPQRGLHPWSRSARRVSVYD   250
XP_004949553.1     201   KFSRQSEDGCIVLPRISVEGSKTSQDMTFFRPQRGLHPWSRSARRVSVYD   250
XP_430498.4        201   KFTRRSEDGCIIIPKIGVEGSKTSREITSLKPRRESQPWGGGARRVSVYD   250


XP_004949545.1     251   PVLLARRRASQAVRAEKIRKVQEKKKQGVRFRFLPQLEQAHAEDLKQPKT   300
XP_004949551.1     251   PVLLAQRRAFQAVRAERIHREQERRKHRVRVRFLSQVEPVNVEELKQPKP   300
XP_004949553.1     251   PVLLAQRRAFQAVRAERIHREQERRKHRVRVRFLSQVEPVNVEELKQPKP   300
XP_430498.4        251   PVVLARRRASQAVREERKQKEQEKKKQGVRVRFLSQLEQAHAEDLKQLKP   300


XP_004949545.1     301   PDHPELSTSAKQPSRMAAHLMRAQIVEKRLQVLMASKRKEVEAEIQSEYQ   350
XP_004949551.1     301   PDQPKPSASAKQPSRTAARLMRPQTEEKRRQVLIGSKRKEVEAEIQSEYQ   350
XP_004949553.1     301   PDQPKPSASAKQPSRTAARLMRPQTEEKRRQVLIGSKRKEVEAEIQSEYQ   350
XP_430498.4        301   PDQPKPSASAKQPSRMAARLMRAQIEEKRLQVLMASKRKEVEAEIQRQYQ   350


XP_004949545.1     351   QCTWRQSLERSQNPFHRLLEGDPRPSYVVRREYDQQLGERLKGKDGCQSP   400
XP_004949551.1     351   QCTWRQSLERSQNPFHRLLEGDSRPSYIMRREYDQQLRERLKGKDGCQKP   400
XP_004949553.1     351   QCTWRQSLERSQNPFHRLLEGDSRPSYIMRREYDQQLRERLKGKDGCQKP   400
XP_430498.4        351   ECTHRLSSERSQYPFHRLLEGDPRPSYIVRREYDQQLGERLKGKDGCQSP   400


XP_004949545.1     401   AGQTAPDGWQNKPQLPGISQKQKGEKTRLLDRCGEAQGLPDLLGTCQAAS   450
XP_004949551.1     401   AGQTALEGWQNKPQLPRTSREQKGEKMRLLDHRGKAQGLPTLLGSCQAAS   450
XP_004949553.1     401   AGQTALEGWQNKPQLPRTSREQKGEKMRLLDHRGKAQGLPTLLGSCQAAS   450
XP_430498.4        401   AGQTAPKGWQNKPQLPGTSREQKGEKMRLLDHHGETQGL-----------   439


XP_004949545.1     451   SCSSRSNPSLHQNAVSGASDC-TQAHSDRTSHCCTLPPL-----------   488
XP_004949551.1     451   SCSSRSFPGLHQNAATGTSTCSTQVHSNRTSHCCMLPPLQGESCQQRGRG   500
XP_004949553.1     451   SCSSRSCPGLHQNAATGTTTCSTQVHSNRISHCCMLPPLQGESCQQRGRG   500
XP_430498.4              --------------------------------------------------


XP_004949545.1           -----
XP_004949551.1     501   ASLQK   505
XP_004949553.1     501   ASLQK   505
XP_430498.4              -----


Protein Acc. Gene Organism
XP_004949545.1 LOC101750451 G.gallus
XP_004949551.1 LOC101750733 G.gallus
XP_004949553.1 LOC101750829 G.gallus
XP_430498.4 CCDC81 G.gallus


Support Center