U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:140837. Gene exclusive to G.gallus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_004949995.1       1   MGNGHVLVAGAVLVALVALGARLTTGTRPSATPVSSNHAPFVPWPRPLFV   50
XP_004949997.1           --------------------------------------------------


XP_004949995.1      51   LAPPPFALCPPRARCRSRTHGTDPHRGPSDPDPVPAPGLTGPLPHPDPHR   100
XP_004949997.1           --------------------------------------------------


XP_004949995.1     101   GPMDPDPRPGAPQSEPEPRSGLAEPDPNPGPKPRLGAAGAGPGSVEADSE   150
XP_004949997.1       1   --MDPDPRPGAPQSEPEPRSGLAEPDPNPGPKPRLGAAGAGPGSVEADSE   48


XP_004949995.1     151   PNRGPEDPDPDPDQRPGPAEAVPAPAPAPCRWFLEGRCRFGPRCRHPHPG   200
XP_004949997.1      49   PNRGPEDPDPDPDQQPGPAEPVPAPAPAPCRWFLEGRCRFGPRCRHPHPG   98


XP_004949995.1     201   QSPSAVPEPKPEPNREEPGAAGKKPPLRRAAAVVSRLRWDPRVDPEAATV   250
XP_004949997.1      99   QSPSAVPEPKPEPNREEPGAAGKKPPLRRAAAVVSRLRWDPRVDPEAATV   148


XP_004949995.1     251   EYRDRFVGVVERPLPEFF   268
XP_004949997.1     149   EYRDRFVGVVERPL----   162


Protein Acc. Gene Organism
XP_004949995.1 LOC101751394 G.gallus
XP_004949997.1 LOC101752093 G.gallus


Support Center