U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:140842. Gene conserved in Amniota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_006230994.1       1   MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAED   50
XP_004950444.1       1   MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAED   50


XP_006230994.1      51   AIRNLHHYKLHGVNINVEASKNKSKASTKLHVGNISPTCTNQELRAKFEE   100
XP_004950444.1      51   AIRNLHHHKLHGVCINVEASKNKSKASTKLHVGNISPTCTNLELRAKFEE   100


XP_006230994.1     101   YGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQG------------   138
XP_004950444.1     101   YGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGDTTRGGALGWER   150


XP_006230994.1     139   --------------------------------------------FEP---   141
XP_004950444.1     151   ESRCQVGRRRLGSSPRRDALERMGASCGALWGGGVVDVEWCSGVFVPNLG   200


XP_006230994.1           --------------------------------------
XP_004950444.1     201   CFGGFTAEIWGVLVLLFLKPERFGGQVTKSRAFWCLCV   238


Protein Acc. Gene Organism
XP_006230994.1 LOC100909948 R.norvegicus
XP_004950444.1 LOC425562 G.gallus


Support Center