U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:141197. Gene exclusive to M.musculus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_006515359.1       1   ------------------------QRHKRIHTGEKPYECNQCGKAFARHS   26
XP_006515368.1       1   ------------------------------HTGEKPYECNQCGKAFARPS   20
XP_006515366.1       1   RTHTGEKPYECHQCGQGFKKCNHLQRHKRTHTGEKPYECNQCGKAFPTPS   50


XP_006515359.1      27   HLQCHKRTHTGEKPYECNQCGKGFALRSSFQRHKRIHTGEKPYECNQCGK   76
XP_006515368.1      21   HLQHHKRTHTGEKPYECNQCGKAFAGHSNLQCHKRTHTGEKPYECNQCGK   70
XP_006515366.1      51   HLQYHKRTHTGEKPYECNQCGKAFARPSHVQCHKRTHTGEKPYECNHCGK   100


XP_006515359.1      77   GFALRSSFQCHERTHTGEKPYECNQCGKAFAQLSHLQRHKRIHTGEKPYE   126
XP_006515368.1      71   VFSQHGHLQCHKRTHTGEKSYECNQCGKAFACHSYLQCHKRTHTGEKPYE   120
XP_006515366.1     101   AFARHSYLQCHKRTHTGEKPYECNQCGKVFSQHSHLQCHKRTHTGEKLYE   150


XP_006515359.1     127   CNQCGKAFARHSHLQCHKRTHTGEKPYECNQCGKAFAQFSNLQCHKRTHI   176
XP_006515368.1     121   CNQCGKVFSHHSNLQHHKRTHTGEKPYGCNQCGKAFAQLSSFQCHKRTHT   170
XP_006515366.1     151   CNQCGKAFAELSNLQRHKRTHTGEKPYECNQCGKVFSHHSNLQHHKRTHT   200


XP_006515359.1     177   GEKPYECNQCGKAFARHSHLQCHKRTHIVEKPYECNQCGKAFAQFSNLQC   226
XP_006515368.1     171   GEKPYECNHCGKAFARHSYLQCHKRTHTGEKPYECNQCGKAFARHSYLQF   220
XP_006515366.1     201   GEKPYGCNQCGKAFALLSSFQCHKGTHTGEKPYECIQCGKAFARPSLLQF   250


XP_006515359.1     227   HKRTHIGEKPYECNQCGKGFALRSSLQCHERTHTGEKPYECNQCGKAFAR   276
XP_006515368.1     221   HKRTHTGEKPYECNQCGKAFARPSHLQHHKRTHTGEKPYECNQCGKAFAG   270
XP_006515366.1     251   HKRTHTGEKPYECNQCGKAFARPSHLQYHKRTHTGEKPYECNQCGKAFAG   300


XP_006515359.1     277   HSHLQCHKRTHTFLI   291
XP_006515368.1     271   HSNLQRHKRT-----   280
XP_006515366.1     301   HSNLQRHKRT-----   310


Protein Acc. Gene Organism
XP_006515359.1 LOC102634489 M.musculus
XP_006515368.1 LOC102639700 M.musculus
XP_006515366.1 LOC102637083 M.musculus


Support Center