U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:141246. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_420836.1          1   MPESRLLVSAPPRVKRKLRLGRELELLTRAMALPSAWSVMRVVIPFISVL   50
XP_695097.1          1   MRPSGALAAA---------------------------AVMLMLL------   17


XP_420836.1         51   GLLGVRLVGASQDSGSVIPAESRPCVDCHAFEFMQRALQDLKKMAYNLDT   100
XP_695097.1         18   ------VCCQAEDSGSVIPAESRPCVDCHAFEFMQRALQDLKKTAFNLDS   61


XP_420836.1        101   RTETLLLRAEKRGLCDCFPA--MH   122
XP_695097.1         62   RTENLVLRAEKRALCDCMPASSLR   85


Protein Acc. Gene Organism
XP_420836.1 LOC422894 G.gallus
XP_695097.1 wu:fj40g07 D.rerio


Support Center