U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:141248. Gene exclusive to G.gallus Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

XP_429907.3          1   -MTVPIPSCSLQRHGVEMVPDIEQLDPGKEEAASTPGCMREVLVLVPQLR   49
XP_429909.4          1   MPALPLSSTQL---------------------------------------   11


XP_429907.3         50   VWPQTAQSWMDSHASLASSAQQGNALKLNTGSHSFTPYHLFPLRPLQLLS   99
XP_429909.4         12   ---------------------------------------------LSCSS   16


XP_429907.3        100   LQPRSHPSSPPAMRFLYLIFSVFLLVSLATPGYGLVLKYCPKIGYCSNTC   149
XP_429909.4         17   LQPRSHPSSPPAMRFLCLVFAVLLLVSLAAPGYGLVLKYCPKIGYCSNTC   66


XP_429907.3        150   SKTQIWATSHGCKMYCCLPASWKWK   174
XP_429909.4         67   SKTQIWATSHGCKMYCCLPANWKWK   91


Protein Acc. Gene Organism
XP_429907.3 GALN1 G.gallus
XP_429909.4 GALN3 G.gallus


Support Center