U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:17128. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_689812.3          1   -----MSANPRWDISRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAA   45
XP_511849.2          1   -----MSANPRWDISRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAA   45
XP_001113290.1       1   -----MNANPRWDISRALGVAKLFHLVCGVREACVTPFLTLYLRQLGLAA   45
XP_546614.2          1   -----MSANPQWDISRALGVARLFHLVCGVRDACVTPFLTLYLRQLGLAA   45
NP_001095993.1       1   -----MSANPQWDISRALRVAKLFHLVCGVRDACVTPFLTLYLRQLGLAA   45
NP_666116.1          1   -----MSPNPQWDVPRALRVARLFHLVCGVRDACVTPFLTLYLRQLGVAA   45
NP_001099257.1       1   -----MSPNPQWDVPRALGVARLFHLVCGVRDACVTPFLTLYLRQLGVAA   45
NP_001003586.1       1   MKKGAMQKSKQWNVKGAVRLASVFHFLHSCGSGCLLPFLTLYFRHLGLSA   50
XP_002937042.1       1   -----MSTTKQWDISKALAVASLFHFFHNVGKFCLIPFLTLYFRQLGLAA   45


NP_689812.3         46   PWVGTLMGTKHLIAAFWAPVCAFLAKSYRKRRALLIGSLLGSVGASLLMV   95
XP_511849.2         46   PWVGTLMGTKHLIAAFWAPLSAFLAKSYRKRRALLIGSLLGSVGASLLMV   95
XP_001113290.1      46   PWVGILMGTKHLIAAFWAPVCAFLAKSYRKRRVLLIGSLLSSVGASLLMV   95
XP_546614.2         46   PWVGVLMGAKHLVAAFWAPSWAFLAKSYRKRRALLTGSLLGSAGASLLMA   95
NP_001095993.1      46   PWVGILMGTKHHIAASWAPFCAFLARSHQKRRVLMTASLLGSAGASLFMV   95
NP_666116.1         46   PLVGILMGTKHLIATCWIPFCAFLAKRYQKRRMFLTGSLLSSAGASLLMV   95
NP_001099257.1      46   PWVGILMGTKHLIAACWTPFCAFLARRYQKRRMFLTGSLLGSAGASLLMV   95
NP_001003586.1      51   AMIGIIMASKHLLALLWRPFSSVLARQYDKRRTVIVGSLLSSALVVLPLL   100
XP_002937042.1      46   PLVGIVIGFKHAVHLLWAPLCSFLAKSHRKRRFFIMASLLLSAGAGGVFA   95


NP_689812.3         96   LVPPVDKNRVHFPCNGSSGLTSTDALP-GVTLPV----NITSAQESASSH   140
XP_511849.2         96   LVPPVDKNRVHFPCNGSSGLTSTDALP-GITLPV----NITSAQESASSH   140
XP_001113290.1      96   LIPAADKNRMHLPCNGSSGVTSTDALP-GVTLRV----NITSAQGPASRH   140
XP_546614.2         96   LVPPPDEAPADPSCNASRGARPS-ALP-PAAASI----PRAVGAPGLRRA   139
NP_001095993.1      96   LVPPLDRDPGDRRCNGSHSLTAEGPPP-GVELTV----TVTLASEPASNS   140
NP_666116.1         96   LVPPVDRNLVNHFCNGSSRVATTILPL-GVTQTV----IMTPTQGS----   136
NP_001099257.1      96   LVPPADRNLGNHFCNGSSKVATTVLPL-VVTQTV----TMTSAQGSVPNH   140
NP_001003586.1     101   LFPSAGILVESGRCNTSQPDADPTLPL-AVIEQM----TVPVGSNATVY-   144
XP_002937042.1      96   FYPPLDKNIASMFCNTSMPWKEQFNPPVGISVSVDEYFNTTYAAPSDHHT   145


NP_689812.3        141   PAK-------------------RTAEVEMPGFRNPPGESDRETFRDLHVY   171
XP_511849.2        141   PAK-------------------RTAEVEMPGFRNPPGESDRETFRDLHVY   171
XP_001113290.1     141   PAN-------------------RTAEVEMPGFRNPPGESDRETFRDPHGY   171
XP_546614.2        140   PAG---------------------------GVHAPAGRPAGYTV----GY   158
NP_001095993.1     141   PAGALSLP-----------GERSSGVAGTLGFREGPGESAQEPFSYPPGS   179
NP_666116.1        137   --GAPNLP-----------GSRHTRALDTSGFPNGS----EGTFSGLQTY   169
NP_001099257.1     141   WAGAPSLP-----------GSRHTRALDTSGFPNGSGKTQERTLRGLQTY   179
NP_001003586.1     145   ------------------------------SVNQTSVSTNQTLEDNTLVN   164
XP_002937042.1     146   TAGAPTTLRDGELTTDISIDTTTTSPLDLETSAPPFSSSSPATSNKTLEH   195


NP_689812.3        172   LAPSVEGARTTSQALLHPVTSGLKDHPWEVTFEVVKTALPLLPGGKGPGN   221
XP_511849.2        172   LAPSVEGARTTSQALLHPVTSGLKDHPREVTFEVVKTALPLLPGGKGPGN   221
XP_001113290.1     172   VAPSVEGARTTSQVLLHPVTSGLKDHPWEVTFEMVKTALPLLPAGKGPGN   221
XP_546614.2        159   AVGSVEGAGTAARV-LPPVASGLRDTARAGAFKVGRTAPPLLAGGTAPGS   207
NP_001095993.1     180   SVGSTQGTRNRSGVLLH---------------------------------   196
NP_666116.1        170   LVGSVEGARTTTQG-LHLVTSGLRDNSQKGTFEVGNVTLNLLPGSTALGG   218
NP_001099257.1     180   LVGSVEGVRTTAQA-LNLVTSGLRENSQKGTSEVSNANLSLLPGSTTLGG   228
NP_001003586.1     165   HSRSARGLRSLKKE-------EEPHSEFLGSLKV----------------   191
XP_002937042.1     196   RTRKVPGSGKTHKA------NGTKASASNSKQK-SPPSHRTSASGTHPNV   238


NP_689812.3        222   PANLSGTKGKAWAFDLS-----LEALRRTFILSLGSVAFWELLTAPLEQV   266
XP_511849.2        222   PANLSGTKGKAWAFDLS-----LEALRWTFILSLGSVAFWELLTAPLEQV   266
XP_001113290.1     222   PANLSGTKGKAWAFDLS-----LGGLRWTFILSLGSMAFWELLAAPLEQV   266
XP_546614.2        208   PANLSAAKGDAGALGLS-----LEGLRWTFLLSLGSVVFWELLTAPLEQV   252
NP_001095993.1           --------------------------------------------------
NP_666116.1        219   PVNLSKPQGDTQTPDHS-----SKGSPWTFILSLGVVVFWELLAAPLEQV   263
NP_001099257.1     229   PVNVSKTQGDIQTHNHT-----LKGSQWTVILSFGFLVFWELLAAPLEQV   273
NP_001003586.1     192   ----------------------MDAQHQMFFLVLLVTALWEFVAVPLEWT   219
XP_002937042.1     239   SQHPSANRRKVRDVGLDFADTFLDPEHKVFLIVLGLVIIWELVAAPLEWI   288


NP_689812.3        267   ADDSLYEFLDFVDATDRYRSLWVWRLLGMSAGVCGITALVGQLDCFLMTS   316
XP_511849.2        267   ADDSLYEFLDFVDATDRYRSLWVWRLLGMSAGVCGITALVGQLDCYLMTS   316
XP_001113290.1     267   ADDSLYEYLDFVDATDRYRSLWVWRLLGMLAGVCGIAALVGQLDCFLMNS   316
XP_546614.2        253   ADDSLYEYLDFVDATDRYGSLWIWRLLGLSAGVCGIAAAVGQLECFVATS   302
NP_001095993.1           --------------------------------------------------
NP_666116.1        264   ADDSLYEYLDFVDATDRNRDLWVWKLLGVSAGVCGIAALVGHLECLLVAN   313
NP_001099257.1     274   ADDSLYEYLDFVDAADRNKDLWVWRLLGISAGVCGIAALVEHLECFLVAN   323
NP_001003586.1     220   ADDGLYEYLDFVDATDRHSGVKVWKHVGAAFGSCLVGVLVTNLFCRIGNS   269
XP_002937042.1     289   ADDSLYEYLDFVDATDRHGKLWIWGYLGASMGSIFIAFLVDNLNCFVIFN   338


NP_689812.3        317   GPRGVVHFYGYSVVSTLALLVSIAFPIPICQQWEPSYKRVKALSIVGGDP   366
XP_511849.2        317   GPRGVVHFYGYSVVSTLALLVSIAFPIPICQQWEPSYKRFKALSIVGGDP   366
XP_001113290.1     317   GPLGVVHFYGYSVVSTLALLVSIFFPIPICQRWEPSYKSVKALSIVGSDP   366
XP_546614.2        303   GPRGVLHFYGYSVVSTVALLVSIAFPVPICRRQEPSYKTIKALSLVGGDP   352
NP_001095993.1           --------------------------------------------------
NP_666116.1        314   GPQGVIYFYSYSLVSTLALAVSTAFPVPIDQQQGPSYKAIKALSLIRGDS   363
NP_001099257.1     324   GPQGVIYFYSYSLVSTLALAVSTAFPVPIDQQQRPSYKAIKALSLVRDDS   373
NP_001003586.1     270   -----VEFYSYTVLMILTVPASALLPIYLRKRERPTSGGFKALQLVHGNP   314
XP_002937042.1     339   IPRVSFHFFCYGGFLVSTLFLSALYPIHVSKKTEHSNKTVKALGFLGSDG   388


NP_689812.3        367   HLILLASTTVLVGAIVSTVQNFLFWHMKDHGSGELVMGFSVALSLLGEIL   416
XP_511849.2        367   RLILLASTIVLVGAIVSTVQNFLFWHMKDHGSGELVMGFSVTLSLLGEIL   416
XP_001113290.1     367   RLILLAFTVVLTGAIVSTVQNFLFWHMKDHGSGELVMGFSVALSLLGEIL   416
XP_546614.2        353   RLILLTFTVFLVGAATSAVQNFLFWHMKDHGSSELVMGFSVALGLLGEIL   402
NP_001095993.1           --------------------------------------------------
NP_666116.1        364   RLILLAFTVFWIGATASTVQDFLFWHMKDHGSSELVMGFSVALSLLGEIL   413
NP_001099257.1     374   RLILLAFTVFWIGATTSTVQNFLFWHMKDHGSSDLVMGFSVVLGLLGEIL   423
NP_001003586.1     315   QAILCAVTVILTGMVTSAVSDFLLWLMQDCGAMEIHMGICLALAHLSHTG   364
XP_002937042.1     389   RIVLTALTVFLLGAVGSTTQNFLFWQMQDAGSGELYMGLSVAAGLLAELT   438


NP_689812.3        417   LHPFKATLLRKLSRT-GLVGLGLSCLAGQLLYYSFLWSWWSVLPIQILSA   465
XP_511849.2        417   LHPFKTTLLRKLSRT-GLVGLGLSCLAGQLLYYSFLWSWWSVLPIQILSA   465
XP_001113290.1     417   LHPFKTALLRKLPRV-GLVGLGLSCLAGQLLYYSFLWSWWSVLPVQILSA   465
XP_546614.2        403   LHPFKTTLLRKLSRM-GTVGLGLGCLAAQLLYYSFLWSWWAALPAQILSA   451
NP_001095993.1           --------------------------------------------------
NP_666116.1        414   FHPFRTSLLRKLSRV-GVLGLGLGCLALQVLYYAFIWSWWSVLPVQILST   462
NP_001099257.1     424   FHPFRTSLLRKLSRV-GVLGLGLGCLALQMLYYAFIWSWWSVLPVQILSA   472
NP_001003586.1     365   FSPIAGPLSRFLKYHGWMLVLAVVGLAMQCLYYSFLWSPWAVMPAQLLAG   414
XP_002937042.1     439   LYFFRNKILKVLTFK-WMVVLGLLSLGVQVLYYSFLWAPWSVLAVQLLNA   487


NP_689812.3        466   ISNRALWWAVGASVEDLATPRMERALSALFRGHFYGSGCSLGSFVGGFVV   515
XP_511849.2        466   ISNRALWWAVGASVEDLATPRMERALSALFRGHFYGSGCSLGSFVGGFVV   515
XP_001113290.1     466   ISNGALWWAVGASVEDLATPRMERALSALFRGHFYGSGCSLGSFVGGFVV   515
XP_546614.2        452   VSNGALWWAVKASVEDLATPRTERPLGAMFRGHIFGGGSSLGSFVGGFVV   501
NP_001095993.1     197   -------------------PGTERPLSAVFRAHVCGSGASLGSFVGGFVV   227
NP_666116.1        463   ISSGALWWAVGASIEDLAFSGMERSLGTMFRGHFYGSGCSLGSFVGGFVV   512
NP_001099257.1     473   ISSGALWWAVGASIGDLASSRMERSLNTLFRGHLYESGCSLGSFVGGFVA   522
NP_001003586.1     415   FSTGALWWSVTSQSEDIATPGTEKTILRLFEAFSLDMGAALGSLIAGFVV   464
XP_002937042.1     488   FSSGVIWWAINSQVVDVASPGTERSLQLALRWLAYGSGASTGSFASGFVI   537


NP_689812.3        516   MRFSLAVLYQACCVALLLWLALLLSIQRRLPRERKIKYSKLLSMEVSDTS   565
XP_511849.2        516   MRFSLAVLYQACCVALLLWLALLLSIQRRLPQERKIKYSKLLSMEVSDTS   565
XP_001113290.1     516   MRFSLAVLYQACCVALLLWLALLLSIQQRLPQERKIKYSKLLSMEVSDTS   565
XP_546614.2        502   MYFSLAVLYRACCVLLLLWLALLLSIQSRLPQEQKINYSKLLVMEASDTS   551
NP_001095993.1     228   MRFSLPVLYQACCVLLLLWLALFLSIQPRLPQERKINYSKLLTVEASDTS   277
NP_666116.1        513   LHFGIAVLYEACCVVLLLWLALFLSIQPRLPQEQRINYSKLLAMGGSDSS   562
NP_001099257.1     523   LRFGVAVLYQACCVVLLLWLAVFLSIQPRLPQEQRINYSKLLAMEGSNSS   572
NP_001003586.1     465   QKFGVNVLFQGASVMLAVWSSALAVLKWKIPRQRRINYSRLLAAD-TEVS   513
XP_002937042.1     538   TRFSLAVLYQACCVLLLLWIAVFLLVQPKLPNIKKINYSRLLAADNSDMS   587


NP_689812.3        566   DSEQGTEQDWLVKAMREEHSD--------   586
XP_511849.2        566   DSEQGTEQDWLVKAMREEHSD--------   586
XP_001113290.1     566   DSEQGTERDWLVKAMREEHSD--------   586
XP_546614.2        552   DSEQGTERDWLVKAMREEYSE--------   572
NP_001095993.1     278   DSEQGTERDWLVKAIREEHSDWRG-----   301
NP_666116.1        563   DSEQGSEGDWLVKAMREEHSDWKG-----   586
NP_001099257.1     573   DSEQGSEGDWLVRAMREEHTDWKG-----   596
NP_001003586.1     514   ESESDQEKDWLETAMEDDRRNNKWTVNKS   542
XP_002937042.1     588   DSDEEQDRDWLVTAMKDENSNRKW-----   611


Protein Acc. Gene Organism
NP_689812.3 MFSD6L H.sapiens
XP_511849.2 MFSD6L P.troglodytes
XP_001113290.1 MFSD6L M.mulatta
XP_546614.2 MFSD6L C.lupus
NP_001095993.1 MFSD6L B.taurus
NP_666116.1 Mfsd6l M.musculus
NP_001099257.1 Mfsd6l R.norvegicus
NP_001003586.1 mfsd6l D.rerio
XP_002937042.1 mfsd6l X.tropicalis


Support Center