U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:20856. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_003997.1          1   ---------------------------MLWWEE--VEDCYEREDVQKKTF   21
XP_003317462.2       1   ------------------------------MED-------EREDVQKKTF   13
NP_001003343.1       1   ---------------------------MLWWEE--VEDCYEREDVQKKTF   21
NP_031894.1          1   ---------------------------MLWWEE--VEDCYEREDVQKKTF   21
NP_990630.1          1   -----------------------MSAHVLWYEE--VEDDYEREDVQKKTF   25
NP_001262730.1       1   MHDPSDYDSVYSEEDFVDTVRGAATPPLMDYEEFRVKTMDERQHIQKKTF   50
XP_319450.4              --------------------------------------------------


NP_003997.1         22   TKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGSTRV   71
XP_003317462.2      14   TKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGSTRV   63
NP_001003343.1      22   TKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGSTRV   71
NP_031894.1         22   TKWINAQFSKFGKQHIDNLFSDLQDGKRLLDLLEGLTGQKLPKEKGSTRV   71
NP_990630.1         26   TKWINAQFAKCGRRCIEDLFNDFRDGRKLLELLECLTGQKIAKEKGSTRV   75
NP_001262730.1      51   TKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQTNLKPEKGRMRV   100
XP_319450.4              --------------------------------------------------


NP_003997.1         72   HALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVK   121
XP_003317462.2      64   HALNNVNKALRVLQNNNVDLVNIGSTDIVNGNHKLTLGLIWNIILPWQVK   113
NP_001003343.1      72   HALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVK   121
NP_031894.1         72   HALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVK   121
NP_990630.1         76   HALNNVNKALQILQRNNVDLVNIGSSDIVDGNHKLTLGLIWNIILHWQVK   125
NP_001262730.1     101   HHINNLNKVITEIQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQ   150
XP_319450.4              --------------------------------------------------


NP_003997.1        122   NVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNA   171
XP_003317462.2     114   NVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNA   163
NP_001003343.1     122   NVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNA   171
NP_031894.1        122   NVMKTIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTSSWSDGLALNA   171
NP_990630.1        126   DVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTSSWSDGLAFNA   175
NP_001262730.1     151   HLVKS----HSSNGVEKSLLAWARQYTEPH-GLQLNDFSSSWSDGRAFLM   195
XP_319450.4              --------------------------------------------------


NP_003997.1        172   LIHSHRPDLFDWNSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTT   221
XP_003317462.2     164   LIHSHRPDLFDWNSVVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVATT   213
NP_001003343.1     172   LIHSHRPDLFDWNSVVCQQSATQRLEHAFNIAKYQLGIEKLLDPEDVATT   221
NP_031894.1        172   LIHSHRPDLFDWNSVVSQHSATQRLEHAFNIAKCQLGIEKLLDPEDVATT   221
NP_990630.1        176   LLHSHRPDLFDWNAVASQQSPVQRLDHAFNIARQHLGIEKLLDPEDVATA   225
NP_001262730.1     196   ILDAHVEELN--LQAALQQHALKRLHLAFDLAHRHFKIEKLLDAEDVHTH   243
XP_319450.4              --------------------------------------------------


NP_003997.1        222   YPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPR-PPKVTKEEHFQLHH   270
XP_003317462.2     214   YPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPR-PPKVTKEEHFQLHH   262
NP_001003343.1     222   YPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPR-PSQVTREEHFQIHH   270
NP_031894.1        222   YPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPRTSSKVTREEHFQLHH   271
NP_990630.1        226   CPDKKSILMYVTSLFQVLPQQVTMEAIREVEMLPR-HSRVTTEEHIQVHH   274
NP_001262730.1     244   KPDNKSIQMYVMCLYHAMESMRTRQQEQEQDEGQDQDPGRVPCTSITDLD   293
XP_319450.4              --------------------------------------------------


NP_003997.1        271   QMHYSQQITVSLAQGYERTSS-PKPRFKSYAYTQAAYVTTSDPTRSPFPS   319
XP_003317462.2     263   QMHYSQ--------------------------------------------   268
NP_001003343.1     271   QMHYSQQITVSLAQGYERAPSFPKPRFKSYAYTQAAYVTTSDPTRSPLPS   320
NP_031894.1        272   QMHYSQQITVSLAQGYEQTSSSPKPRFKSYAFTQAAYVATSDSTQSPYPS   321
NP_990630.1        275   QQHFSQEITVNIPQ---RPSPSPKPRFKSYAYAQTAYVIPPDQKRRQVPP   321
NP_001262730.1     294   EVPLDNDQT-----------------------SLGLYTSDSAGSMEQRSS   320
XP_319450.4              --------------------------------------------------


NP_003997.1        320   QHLEAPEDKSFGSSLMESEVNLDRYQTALEEVLSWLLSAEDTLQAQGEIS   369
XP_003317462.2     269   QHLEAPEDKSFGSSLMESEVNLDGYQTALEEVLSWLLSAEDTLQAQGEIS   318
NP_001003343.1     321   QHLETPEDKSFGRSLTETEANLDSYQTALEEVLSWLLSAEDALQAQGEIS   370
NP_031894.1        322   QHLEAPRDKSLDSSLMETEVNLDSYQTALEEVLSWLLSAEDTLRAQGEIS   371
NP_990630.1        322   QFLETVEKRTYTTTVMRSEMDLDSYQTALEEVLTWLLSAEDALQAQGDIS   371
NP_001262730.1     321   GELKTHSMRPLSTA-TNASVEISGYQSALEAVLTLLLEDEQLLSQNLPDP   369
XP_319450.4              --------------------------------------------------


NP_003997.1        370   NDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGT-----GKLSE   414
XP_003317462.2     319   NDVDVVKEQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGT-----GKLSE   363
NP_001003343.1     371   NDVEEVKEQFHTHEGYMMDLTSHQGRVGNVLQLGSQLIGT-----GKLSE   415
NP_031894.1        372   NDVEEVKEQFHAHEGFMMDLTSHQGLVGNVLQLGSQLVGK-----GKLSE   416
NP_990630.1        372   SDVEVVKEQFHTHEGFMMELTAHQGRVGNVLQVGSQLLAM-----GKLSD   416
NP_001262730.1     370   QDFQTAKLQFHENESFMLKLTEHQEYVGEALEEGSNLINESQKAGAGLSQ   419
XP_319450.4          1   ---------------------------------------------MGLSK   5


NP_003997.1        415   DEETEVQEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWL   464
XP_003317462.2     364   DEETEVQEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQNQKLKELNDWL   413
NP_001003343.1     416   DEETEVQEQMNLLNSRWECLRVASMEKQSNLHKVLMDLQNQQLKELNDWL   465
NP_031894.1        417   DEEAEVQEQMNLLNSRWECLRVASMEKQSKLHKVLMDLQNQKLKELDDWL   466
NP_990630.1        417   DEENEIQEQMNLLNSRWESLRVASMEKQSNLHKILMDLQNQQLAQLADWL   466
NP_001262730.1     420   EDQNEVRQQMVLLNERWETLRLRALDVQAKILMRLAEFQKQKLEQLRQFL   469
XP_319450.4          6   DD-------------------LRT--------------------------   10


NP_003997.1        465   TKTEERTRKMEEEPLGPDLEDLKRQVQQHKVLQEDLEQEQVRVNSLTHMV   514
XP_003317462.2     414   TKTEERTRKMEEEPLGPDLEDLKRQVQQHKVLQEDLEQEQVRVNSLTHMV   463
NP_001003343.1     466   TKTEERTRKMEKEPLGPDIEDLKRQVQQHKVLQEDLEQEQVRVNSLTHMV   515
NP_031894.1        467   TKTEERTKKMEEEPFGPDLEDLKCQVQQHKVLQEDLEQEQVRVNSLTHMV   516
NP_990630.1        467   TKTEERTKKIDSEPLGPDLEDLKRQVEEHKAFQDDLEQEQVKVNSLTHMV   516
NP_001262730.1     470   TSVEDRISHMSD--IGPTLEEAEKQLLEAQKLKADLSEQQELVDSLSSMV   517
XP_319450.4              --------------------------------------------------


NP_003997.1        515   VVVDESSGDHATAALEEQLKVLGDRWANICRWTEDRWVLLQDILLKWQRL   564
XP_003317462.2     464   VVVDESSGDHATAALEEQLK------------------------------   483
NP_001003343.1     516   VVVDESSGDHATAALEEQLKVLGDRWANICRWTEDRWVLLQDILLKWQRF   565
NP_031894.1        517   VVVDESSGDHATAALEEQLKVLGDRWANICRWTEDRWIVLQDILLKWQHF   566
NP_990630.1        517   VVVDENSGDKATAALEEQLQHFGSRWAAICRWTEDRWVLLQDILRKWQHF   566
NP_001262730.1     518   VIVNDTSGNFND--LEDRLSALGERWSHVVKWSD----------LRKEKL   555
XP_319450.4              --------------------------------------------------


NP_003997.1        565   TEEQCLFSAWLSEKEDAVNKIHTTGFKDQNEMLSSLQKLAVLKADLEKKK   614
XP_003317462.2     484   ----------------------------------------VLKADLEKKK   493
NP_001003343.1     566   TEEQCLFSAWLSEKEDAVNKIHTTGFKDQSEVLSNLQKLAVLKTDLEKKK   615
NP_031894.1        567   TEEQCLFSTWLSEKEDAMKNIQTSGFKDQNEMMSSLHKISTLKIDLEKKK   616
NP_990630.1        567   AEEQCLFDAWLTEKEGSLSKIQTSDFKDENEMLTSLRKLAILKGDIEMKK   616
NP_001262730.1     556   QQYKCI-SRWLDAREQDLKLMESRDVTDVGGITQRINELNYCAKDLLELQ   604
XP_319450.4              --------------------------------------------------


NP_003997.1        615   QSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEKSTAQ   664
XP_003317462.2     494   QSMGKLYSLKQDLLSTLKNKSVTQKTEAWLDNFARCWDNLVQKLEKSTAQ   543
NP_001003343.1     616   QTMDKLCSLNQDLLSALKNTVVAHKMEAWLDNFAQRWDNLVQKLEKSSAQ   665
NP_031894.1        617   PTMEKLSSLNQDLLSALKNKSVTQKMEIWMENFAQRWDNLTQKLEKSSAQ   666
NP_990630.1        617   QMMSKLKSLSRDLLVAVKNKAVAQKLESRLENFAQRWDSLVQKLESDSKQ   666
NP_001262730.1     605   RYLIDLRQMVAATLQDGDDKG--ERVLIQLESYEDRLDALKQIVEVQTVR   652
XP_319450.4              --------------------------------------------------


NP_003997.1        665   ISQAVT---TTQPSLTQTTVMETVTTVTTREQILV--KHAQEELPPPPPQ   709
XP_003317462.2     544   ISQAVT---TTQPSLTQTTVMETVTTVTTREQILV--KHAQEELPPPPPQ   588
NP_001003343.1     666   ISQAVT---TTQPSLTQTTVMETVTMVTTREHILV--KHAQEELPPPPPQ   710
NP_031894.1        667   ISQAVT---TTQPSLTQTTVMETVTMVTTREQIMV--KHAQEELPPPPPQ   711
NP_990630.1        667   VSQAVT---TTQTSLTQTTVMETVTMVTTREQILV--KHAKEELPPPPPH   711
NP_001262730.1     653   IETKGFNFGRDRASYDDSRVVRPEGWVDYQMIIRFGEDDSQEDDDEHDLA   702
XP_319450.4         11   ---------RRRSSHDES--------------------------------   19


NP_003997.1        710   KKRQITVDSEIRKRLDVDITELHSWITRSEAVLQSPEFAIFRKEGNFSDL   759
XP_003317462.2     589   KKRQITVDSEIRKRLDVDITELHSWITRSEAVLQSPEFAIFRKEGNFSDL   638
NP_001003343.1     711   KKRQIIVDSEIRKRLDVDITELHSWITRSEAVLQSPEFAIYRKEGNFSDL   760
NP_031894.1        712   KKRQITVDSELRKRLDVDITELHSWITRSEAVLQSSEFAVYRKEGNISDL   761
NP_990630.1        712   KKRQLLVDSEIRKRFDSDTTELHSWMTRSEAVLQSPEFAIYRKEGNLSDL   761
NP_001262730.1     703   SKKRKLRNADNFNALENHIMEHFGYVQEVEQKLQQLQRQSLRQQCELLKE   752
XP_319450.4              --------------------------------------------------


NP_003997.1        760   KEKVNAIEREKAEKFRKLQDASRSAQALVEQMVNEGVNADSIKQASEQLN   809
XP_003317462.2     639   KEKVNAIEREKAEKFRKLQDASRSAQALVEQMVNEGVNADSIKQASEQLN   688
NP_001003343.1     761   KEKVNAIEREKAEKFRKLQDASRSAQALVEQMVNEGVNADSIKQASEQLN   810
NP_031894.1        762   QEKVNAIAREKAEKFRKLQDASRSAQALVEQMANEGVNAESIRQASEQLN   811
NP_990630.1        762   RERVNAIQREKPEKYRKLQDASRSAEALVEQMVNEGLNADNIRQASEQLK   811
NP_001262730.1     753   LQAENSRRCGTLPELKKLYEVCELEDPSRNLLLEE--------THIKQLE   794
XP_319450.4              --------------------------------------------------


NP_003997.1        810   SRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQMTTTAENWLKIQPTT   859
XP_003317462.2     689   SRWIEFCQLLSERLNWLEYQNNIIAFYNQLQQLEQMTTTAENWLKIQPTT   738
NP_001003343.1     811   SRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLEQMTTTAENWLKTQPTT   860
NP_031894.1        812   SRWTEFCQLLSERVNWLEYQTNIITFYNQLQQLEQMTTTAENLLKTQSTT   861
NP_990630.1        812   SRWIEFCQLLSERLVWLEYQNSIIDFYSQLQRLEQTAITAENWLKAQPTP   861
NP_001262730.1     795   QRYANLSQKLSSQQSESHTLLAKEKYYNSLTGFKLVLADSRDWYKQHAGS   844
XP_319450.4              --------------------------------------------------


NP_003997.1        860   PSEPTAIKSQLKICKDEVNRLSGLQPQIERLKIQSIALKEKGQGPMFLDA   909
XP_003317462.2     739   PSEPTAIKSQLKICKDEVNRLSGLQPQIERLKIQSIALKEKGQGPMFLDA   788
NP_001003343.1     861   TSEPTAIKSQLKICKDEINRLSALQPQIERLKIQSIALKEKGQGPMFLDA   910
NP_031894.1        862   LSEPTAIKSQLKICKDEVNRLSALQPQIEQLKIQSLQLKEKGQGPMFLDA   911
NP_990630.1        862   ATDPATVKIQLEKCKDEIIRMSTLQPQIERLKAQSQALKEKEQCPVFLDA   911
NP_001262730.1     845   ASG------------------NELEQRLSHMESLASEISEAKTATEELDD   876
XP_319450.4              --------------------------------------------------


NP_003997.1        910   DFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSE   959
XP_003317462.2     789   DFVAFTNHFKQVFSDVQAREKELQTIFDTLPPMRYQETMSAIRTWVQQSE   838
NP_001003343.1     911   DFVAFTNHFNQVFADVQAREKELQTIFDSLPPMRYQETMSTILTWIQQSE   960
NP_031894.1        912   DFVAFTNHFNHIFDGVRAKEKELQTIFDTLPPMRYQETMSSIRTWIQQSE   961
NP_990630.1        912   DLAAFTSHFKQILADMHTREKQLQTIFDSLPPARYKDTVTTILSWIQQSE   961
NP_001262730.1     877   NLIEWKQDFGLFYDSWHDMKQALQALIQQ----RGGESLSRQLKQIQDFV   922
XP_319450.4              --------------------------------------------------


NP_003997.1        960   TKLSIPQLSVTDYEIMEQRLGELQALQSSLQEQQSGLYYLSTTVKEMSKK   1009
XP_003317462.2     839   TKLSIPQLSVTDYEIMEQRLGELQALQSSLQEQQSGLNYLSTTVKEMSKK   888
NP_001003343.1     961   TKLSIPQVTVTEYDIMEQRLGELQALQSSLQEQQNGLNYLSTTVKEMSKK   1010
NP_031894.1        962   SKLSVPYLSVTEYEIMEERLGKLQALQSSLKEQQNGFNYLSDTVKEMAKK   1011
NP_990630.1        962   TKVSIPPVAVAEYEIMEQRLGELKALQSSLQEQQKGLKYLNTTVEDLSRK   1011
NP_001262730.1     923   TKVSNQKVRVSNLEVMQEQQHFLNQLLDEMESLRLTYDNIPKHLIG----   968
XP_319450.4              --------------------------------------------------


NP_003997.1       1010   AP-SEISRKYQSEFEEIEGRWKKLSSQLVEHCQKLEEQMNKLRKIQNHIQ   1058
XP_003317462.2     889   AP-SEISRKYQSEFEEIEGRWKKLSCQLVEHCQKLEEQMNKLRKIQNHIQ   937
NP_001003343.1    1011   APLSDISRKYQSEFEEIEGRWKKLSSQLVEHCQKLEEQMAKLRKIQNHIK   1060
NP_031894.1       1012   AP-SEICQKYLSEFEEIEGHWKKLSSQLVESCQKLEEHMNKLRKFQNHIK   1060
NP_990630.1       1012   AP-AEVSQKYRSEVELIVGRWKKLSSQLVEHCQKLEDLMTKLQRFQNDTK   1060
NP_001262730.1     969   --------------EELQTAWNRLPEQLNERVIKQTTAIENLNHFAAEYN   1004
XP_319450.4              --------------------------------------------------


NP_003997.1       1059   TLKKWMAEVDVFLKEEWPALGDSEILKKQLKQCRLLVSDIQTIQPSLNSV   1108
XP_003317462.2     938   TLKKWMAEVDVFLKEEWPALGDSEILKKQLKQCRLLVNDIQTIQPSLNSV   987
NP_001003343.1    1061   TLKKWITEVDVFLKEEWPALGDSEILKRQLKQCRLLVNDIQTIQPSLNSV   1110
NP_031894.1       1061   TLQKWMAEVDVFLKEEWPALGDAEILKKQLKQCRLLVGDIQTIQPSLNSV   1110
NP_990630.1       1061   TLKKWMAEVDVFLKEEWPALGDSEALEKQLEQCTALVNDIQTIQPSLNSV   1110
NP_001262730.1    1005   AII---------------AMLRSAADSKLNGSDGASSQDLRKLEIDVISA   1039
XP_319450.4              --------------------------------------------------


NP_003997.1       1109   NEGGQKIKNEAEPEFASRLETELKELNTQWDHMCQQVYARKEALKGGLEK   1158
XP_003317462.2     988   NEGGQKIKNEAEPEFASRLEKELKELNTQWDHMCQQVYARKEALKGGLEK   1037
NP_001003343.1    1111   NEGAQKMKNEAEPEFAGRLETELRELNTQWDYMCRQVYARKEALKGGLDK   1160
NP_031894.1       1111   NEGGQKIKSEAELEFASRLETELRELNTQWDHICRQVYTRKEALKAGLDK   1160
NP_990630.1       1111   NEIGKKMKREAEPEFASRIATELKDLNAQWEHICQQAHAKKAALKGGLDK   1160
NP_001262730.1    1040   RNFSEILIKEAEPAQKESLQSQIRALNTLYDQVEQVHREKKEQQTVLQSH   1089
XP_319450.4              --------------------------------------------------


NP_003997.1       1159   TVSLQKDLSEMHEWMTQAE--------EEYLERDFEYKTPDELQKAVEEM   1200
XP_003317462.2    1038   TVSLQKDLSEMHEWMTQAE--------EEYLERDFEYKTPDELQKAVEEM   1079
NP_001003343.1    1161   TVSLQKDLSEMHEWMTQAE--------EEYLERDFEYKTPDELQTAVEEM   1202
NP_031894.1       1161   TVSLQKDLSEMHEWMTQAE--------EEYLERDFEYKTPDELQTAVEEM   1202
NP_990630.1       1161   TVSLRKDLSEMHEWITQAE--------EEYLERDFEYKTPEELQKAVEEL   1202
NP_001262730.1    1090   IDLIQLRLKETDQWLTDLESNTPKSGISDIVNSNELFQSKSRFQTLKETC   1139
XP_319450.4              --------------------------------------------------


NP_003997.1       1201   KRAKEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWL   1250
XP_003317462.2    1080   KRAKEEAQQKEAKVKLLTESVNSVIAQAPPVAQEALKKELETLTTNYQWL   1129
NP_001003343.1    1203   KRAKEEAQQKEAKVKLLTESVNSVIAQAPPAAQEALKKELDTLTTNYQWL   1252
NP_031894.1       1203   KRAKEEALQKETKVKLLTETVNSVIAHAPPSAQEALKKELETLTTNYQWL   1252
NP_990630.1       1203   KRAKEDAMQKEVKVKLITDSVNNFIAKAPPAANEALKKELDVLITSYQRL   1252
NP_001262730.1    1140   ERETTQFRDLNERGGELLLQMDELQDQDRESRYGSLAKQFTRINARWTEV   1189
XP_319450.4         20   -----------------LFSMNN---------------------------   25


NP_003997.1       1251   CTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAE   1300
XP_003317462.2    1130   CTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVEFKLKTTENIPGGAE   1179
NP_001003343.1    1253   CTRLNGKCKTLEEVWACWHELLSYLEKANKWLSEVEVKLKTTENISGGAE   1302
NP_031894.1       1253   CTRLNGKCKTLEEVWACWHELLSYLEKANKWLNEVELKLKTMENVPAGPE   1302
NP_990630.1       1253   CSRLNGKCKTLEEVWACWHELLSYLDAENKWLNEVELKLKATENIQGGAE   1302
NP_001262730.1    1190   TELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTPENAADAE   1239
XP_319450.4              --------------------------------------------------


NP_003997.1       1301   EISEVLDSLENLMR-HSEDNPNQIRILAQTLTDGGVMDELINEELETFNS   1349
XP_003317462.2    1180   EISEVLDSLENLMR-HSEDNPNQIRILAQTLTDGGVMDELINEELETFNS   1228
NP_001003343.1    1303   EIAEVLDSLENLMQ-HSEDNPNQIRILAQTLTDGGVMDELINEELETFNS   1351
NP_031894.1       1303   EITEVLESLENLMH-HSEENPNQIRLLAQTLTDGGVMDELINEELETFNS   1351
NP_990630.1       1303   EISESLDSLERLMR-HPEDNRNQIRELAQTLTDGGILDELINEKLEKFNT   1351
NP_001262730.1    1240   EIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQ   1289
XP_319450.4              --------------------------------------------------


NP_003997.1       1350   RWRELHEEAVRRQKLLEQSIQSAQETEKSLHLIQESLTFIDKQLAAYIAD   1399
XP_003317462.2    1229   RWRELHEEGVRRQKLLEQSIQSAQETEKSLHLIQESLTFIDKQLAAYIAD   1278
NP_001003343.1    1352   RWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQESLSSIDKQLAAYIAD   1401
NP_031894.1       1352   RWRELHEEAVRKQKLLEQSIQSAQEIEKSLHLIQESLEFIDKQLAAYITD   1401
NP_990630.1       1352   RWEELQQEAVRRQKSLEQSIQSAQETDKTLRLIQESLAAIDKQLTAYTAD   1401
NP_001262730.1    1290   RWTQLQQQAKKRTELLEQKVSEAEQSEKCIVQFEKWLTRVDDILSDHLDN   1339
XP_319450.4              --------------------------------------------------


NP_003997.1       1400   KVDAAQMPQEAQKIQSDLTSHEISLEEMKK------HNQGKEAAQRVLSQ   1443
XP_003317462.2    1279   KVDAAQMPQEAQASHT----------------------------------   1294
NP_001003343.1    1402   KVDAAQMPQEAQKIQSDLTSHEISLEEMKK------HNQGKETAQRVLSQ   1445
NP_031894.1       1402   KVDAAQMPQEAQKIQSDLTSHEISLEEMKK------HNQGKDANQRVLSQ   1445
NP_990630.1       1402   RVDAAQVPQEAQKIQSELTSHEISLEEMKK------RNRGKESAKRVLSQ   1445
NP_001262730.1    1340   DVTIVDQPEEFQRLAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQ   1389
XP_319450.4              --------------------------------------------------


NP_003997.1       1444   IDVAQKKLQDVSMKF-RLFQKPANFEQRLQESKMILDEVKMHLPALETKS   1492
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1446   IDVAQKKLQDVSMKF-RLFQKPANFEQRLQESKMILDEVKMHLPALETKS   1494
NP_031894.1       1446   IDVAQKKLQDVSMKF-RLFQKPANFEQRLEESKMILDEVKMHLPALETKS   1494
NP_990630.1       1446   IDVAQKKLQDVSMKF-RLFQKPANFEQRLQECKRILDEVKLQVPKLETKS   1494
NP_001262730.1    1390   LNLMEVRFKYCQAKLSKCTAIQHSYESRLNRAYTDLRNVERSTEVVDVAS   1439
XP_319450.4              --------------------------------------------------


NP_003997.1       1493   VEQEVVQSQLNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELD   1542
XP_003317462.2    1295   ------------CI------------------------------------   1296
NP_001003343.1    1495   VEQEVVQSQLNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELD   1544
NP_031894.1       1495   VEQEVIQSQLSHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELD   1544
NP_990630.1       1495   VEQEVVQSHLDHCMKLYKSLSEVKSEVETVIKTGRQIVQKQQTENPKELD   1544
NP_001262730.1    1440   AGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKTGRRVCEDRYTKSPKQLS   1489
XP_319450.4              --------------------------------------------------


NP_003997.1       1543   ERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNVLTEWLAATDM   1592
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1545   ERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNALTEWLAATDM   1594
NP_031894.1       1545   ERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMRKEMNVLTEWLAATDT   1594
NP_990630.1       1545   ERLTALKLQYNELGAKVTEKKQELEKCLKLSRKLRKEINSLTEWLAATDV   1594
NP_001262730.1    1490   QRIDALKHLYNTLGENVTQSKATLERLLTLARQLEECFDSAD--------   1531
XP_319450.4              --------------------------------------------------


NP_003997.1       1593   ELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLKSITEVGEALKTVL   1642
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1595   ELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLKSVTEVGEALKTVL   1644
NP_031894.1       1595   ELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKAHLKSVTELGESLKMVL   1644
NP_990630.1       1595   ELTKRSAVQGMPSNLDAEIAWGKATRKEIEKRQVQLKNICDLGENLKTVL   1644
NP_001262730.1           --------------------------------------------------
XP_319450.4              --------------------------------------------------


NP_003997.1       1643   GKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQNVDHIT   1692
XP_003317462.2    1297   ----------------------------INIVLD----------------   1302
NP_001003343.1    1645   GKKEMLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMETFDQNVDYIT   1694
NP_031894.1       1645   GKKETLVEDKLSLLNSNWIAVTSRVEEWLNLLLEYQKHMETFDQNIEQIT   1694
NP_990630.1       1645   KGKESLVEDKLSLLNSNWIAVTSRAEEWLNLLMEYQKHMEAFDQKVANVT   1694
NP_001262730.1    1532   -----------------------------NLIRRFESPQEVHDRN-----   1547
XP_319450.4              --------------------------------------------------


NP_003997.1       1693   KWIIQADTLLDESEKKKPQQKEDVLKRLKAELNDIRPKVDSTRDQAANLM   1742
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1695   NWIIQADALLDESEKKKPQQKEDILKRLKAEMNDIRPKVDSTRDQAANLM   1744
NP_031894.1       1695   KWIIHADELLDESEKKKPQQKEDILKRLKAEMNDMRPKVDSTRDQAAKLM   1744
NP_990630.1       1695   TWIYRAEILLDESDKQKPQQKEETLKRLKAELNDMHPKVDSVRDQAVDLM   1744
NP_001262730.1           --------------------------------------------------
XP_319450.4              --------------------------------------------------


NP_003997.1       1743   ANRGDHCRKLVEPQISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQK   1792
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1745   ANRGDHCRKVVEPKISELNHRFAAISHRIKTGKASIPLKELEQFNSDIQK   1794
NP_031894.1       1745   ANRGDHCRKVVEPQISELNRRFAAISHRIKTGKASIPLKELEQFNSDIQK   1794
NP_990630.1       1745   TNRGDHCRKVIEPKLSELNHRFAAISQRIKSGKPFIPLKELEQFDFDIQK   1794
NP_001262730.1           --------------------------------------------------
XP_319450.4              --------------------------------------------------


NP_003997.1       1793   LLEPLEAEIQQGVNLKEEDFNKDMNEDNEGTVKELLQRGDNLQQRITDER   1842
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1795   LLEPLEAEIQQGVNLKEEDFNKDMSEDNEGTVKELLQRGDNLQQRITDER   1844
NP_031894.1       1795   LLEPLEAEIQQGVNLKEEDFNKDMSEDNEGTVNELLQRGDNLQQRITDER   1844
NP_990630.1       1795   LLEPLEVEIQQGVNLKEEDFNKDMSEDDESTVKELLQRGDTLQKRITDER   1844
NP_001262730.1    1548   ---SILLEFEDVLRRCEDHYNEYNKSCDQSCMVETRQRIDGLKATY----   1590
XP_319450.4              --------------------------------------------------


NP_003997.1       1843   KREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQADDLLKC   1892
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1845   KREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQADDLLKC   1894
NP_031894.1       1845   KREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQADDLLKC   1894
NP_990630.1       1845   KREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQADDLMTW   1894
NP_001262730.1    1591   ---------------------------------------HKLTSADIIKR   1601
XP_319450.4              --------------------------------------------------


NP_003997.1       1893   LDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAA   1942
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1895   LDDIEKKLASLPEPRDERKIKEIDRELQKKKEELNAVRRQAEGLSEDGAA   1944
NP_031894.1       1895   LDEIEKKLASLPEPRDERKLKEIDRELQKKKEELNAVRRQAEGLSENGAA   1944
NP_990630.1       1895   LDDIEKKLASLPDHKDEQKLKEIGGELEKKKEDLNAVNRQAERLSKDGAA   1944
NP_001262730.1    1602   LTEMKTTLQNLDNISLET--------------------------------   1619
XP_319450.4              --------------------------------------------------


NP_003997.1       1943   MAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVREETMMVMTEDMPLE   1992
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1945   MAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVHEESVVAMTEDMPLE   1994
NP_031894.1       1945   MAVEPTQIQLSKRWRQIESNFAQFRRLNFAQIHTLHEETMVVTTEDMPLD   1994
NP_990630.1       1945   KAVEPTLVQLSKRWRDFESKFAQFRRLNYAQIQTVLEDTTFVMTESMTVE   1994
NP_001262730.1    1620   -------------LRAMEHDLKEINVPSNPEIEKLQQQVIAIVVSRIMTP   1656
XP_319450.4              --------------------------------------------------


NP_003997.1       1993   ISYVPSTYLTEITHVSQALLEVEQLLNAPDLCAKDFEDLFKQEESLKNIK   2042
XP_003317462.2           --------------------------------------------------
NP_001003343.1    1995   ISYVPSTYLTEITHVSQALSEVEELLNAPDLCAQDFEDLFKQEESLKNIK   2044
NP_031894.1       1995   VSYVPSTYLTEISHILQALSEVDHLLNTPELCAKDFEDLFKQEESLKNIK   2044
NP_990630.1       1995   TTYVPSTYLAEILQLLQALSEVEERLNSPVLQAKDCEDLLKQEECLKNIK   2044
NP_001262730.1    1657   STKNPNPFLSKVLESLSSPVDDSNVTLKSPISEEQPQNL---DDRVREFD   1703
XP_319450.4              --------------------------------------------------


NP_003997.1       2043   DSLQQSSGRIDIIHSKKTAALQSATPVERVKLQEALSQLDFQWEKVNKMY   2092
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2045   DSLQQISGRIDIIHNKKTAALHSATPAERAKLQEALSRLDFQWERVNNMY   2094
NP_031894.1       2045   DNLQQISGRIDIIHKKKTAALQSATSMEKVKVQEAVAQMDFQGEKLHRMY   2094
NP_990630.1       2045   DCLGRLQGHIDIIHSKKTPALQSATPRETANIQDKLTQLNSQWEKVNKMY   2094
NP_001262730.1    1704   KQAKQMIYKLKLTKAKIEQCHESEAEDLRLLIAPDAATLISQGDSLVLET   1753
XP_319450.4              --------------------------------------------------


NP_003997.1       2093   KDRQGRFDRSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQI-PENWEHAKY   2141
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2095   KDRQGRFDRSVEKWRRFHYDMKILNQWLTEAEQFLKKTQI-PENWEHAKY   2143
NP_031894.1       2095   KERQGRFDRSVEKWRHFHYDMKVFNQWLNEVEQFFKKTQN-PENWEHAKY   2143
NP_990630.1       2095   RDRQARFDKSKEKWRLFHCEMKSFNEWLTETEEKLSRAQIEAGDVGHVKT   2144
NP_001262730.1    1754   HGRQGSISRLVMRTQI------ILREQFREVQQARSKTSGSGAPAPPLDS   1797
XP_319450.4         26   --------------------------------------SGKCAP------   31


NP_003997.1       2142   KWYLKELQDGIGQRQTVVRTLNATGEEIIQQSSKTDASILQEKLGSLNLR   2191
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2144   KWYLKELQDGIGQRQSVVRVLNATGEEIIQQSSKTDASILQEKLGSLNLR   2193
NP_031894.1       2144   KWYLKELQDGIGQRQAVVRTLNATGEEIIQQSSKTDVNILQEKLGSLSLR   2193
NP_990630.1       2145   KQFLQELQDGIGRQQTVVKTLNVTGEEIIEQSSAADANVLKEQLGNLNTR   2194
NP_001262730.1    1798   VNIEELVTKGL-------RRINVLIEKTVDLKSSTDLEKRMEDINERHDD   1840
XP_319450.4              --------------------------------------------------


NP_003997.1       2192   WQEVCKQLSDRKKRLEEQKNILSEFQRDLNEFVLWLEEADNIASIPLEPG   2241
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2194   WQEVCKQLAERKKRLEEQKNILSEFQRDVNEFVLWLEEADNVANIPLEPG   2243
NP_031894.1       2194   WHDICKELAERRKRIEEQKNVLSEFQRDLNEFVLWLEEADNIAITPL--G   2241
NP_990630.1       2195   WQEICRQLVEKRKRIEEEKNILSEFQEDLNKLILWLEETENVIAIPLEPG   2244
NP_001262730.1    1841   LQVIVSAIGKNAQMPKVTPLMMNEIEKTKNN-------------------   1871
XP_319450.4              --------------------------------------------------


NP_003997.1       2242   KEQQLKEKLEQVKLLVEELPLRQGILKQLNETGGPVLVSAPISPEEQDKL   2291
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2244   NEQQLKEKLEQVKLLAEELPLRQGILKQLNETGGTVLVSAPLSPEEQDKL   2293
NP_031894.1       2242   DEQQLKEQLEQVKLLAEELPLRQGILKQLNETGGAVLVSAPIRPEEQDKL   2291
NP_990630.1       2245   NEDQLRDCLGKVKLRVEELLPHKGILKRLNETGGTTLGSASLNPERKHKL   2294
NP_001262730.1           --------------------------------------------------
XP_319450.4              --------------------------------------------------


NP_003997.1       2292   ENKLKQTNLQWIKVSRALPEKQGEIEAQIKDLGQLEKKLEDLEEQLNHLL   2341
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2294   ENKLKQTNLQWIKVSRNLPEKQEEIEAHVKDLGQ-------LEEQLNHLL   2336
NP_031894.1       2292   EKKLKQTNLQWIKVSRALPEKQGELEVHLKDFRQ-------LEEQLDHLL   2334
NP_990630.1       2295   ESTLKEASRRLLKVSRDLPEKQKEIEILLKDFIE-------LNQQINQLT   2337
NP_001262730.1    1872   -----------------------------------------LIAHADSIE   1880
XP_319450.4              --------------------------------------------------


NP_003997.1       2342   LWLSPIRNQLEIYNQPNQEGPFDVQETEIAVQAKQPDVEEILSKGQHLYK   2391
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2337   LWLSPIRNQLEIYNQPNQTGPFDIKEIEVAVQAKQPDVEGILSKGQHLYK   2386
NP_031894.1       2335   LWLSPIRNQLEIYNQPSQAGPFDIKEIEVTVHGKQADVERLLSKGQHLYK   2384
NP_990630.1       2338   LWITPVKNQLELYNQVGQPGAFDIKETEAAVQAKQPNVEEVLSKGCHLYK   2387
NP_001262730.1    1881   LSLTELRNGPRISNGKERPDA-----------------------------   1901
XP_319450.4              --------------------------------------------------


NP_003997.1       2392   EKPATQPVKRKLEDLSSEWKAVNRLLQELRAKQPDLAPGLTTIGA-SPTQ   2440
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2387   EKPATQPAKRKLEDLSSDWKVVTQLLQELRAKQPGPAPGLTTVRA-PPSQ   2435
NP_031894.1       2385   EKPSTQPVKRKLEDLRSEWEAVNHLLRELRTKQPDRAPGLSTTGA-SASQ   2433
NP_990630.1       2388   EKPATHPVKKKLEDLNADWKAINHLILQLKEKPTFGEPALTSPGVLTSGQ   2437
NP_001262730.1           --------------------------------------------------
XP_319450.4              --------------------------------------------------


NP_003997.1       2441   TVTLVTQPVVTKETAISKLEMPSSLMLEVPALADFNRAWTELTDWLSLLD   2490
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2436   TVTLVTQPAVTKETAISKLEMPSSLLLEVPALADFNRAWTELTDWLSLLD   2485
NP_031894.1       2434   TVTLVTQSVVTKETVISKLEMPSSLLLEVPALADFNRAWTELTDWLSLLD   2483
NP_990630.1       2438   TVAVDTQARVTKETTSFTPEMPSSVLLEVPALADFNKAWAELTDWLSRLD   2487
NP_001262730.1    1902   ---------SSAATMSCRSEYNNEPSGTGALAGSFDKSVLQISDWLTWEQ   1942
XP_319450.4              --------------------------------------------------


NP_003997.1       2491   QVIKSQRVMVGDLEDINEMIIKQKATMQDLEQRRPQLEELITAAQNLKNK   2540
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2486   RVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKNK   2535
NP_031894.1       2484   RVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKNK   2533
NP_990630.1       2488   REIKAQRVTVGDLDDINDMIIKQKANMQDLEQRRPQLDELITAAQNLKNK   2537
NP_001262730.1    1943   NMIKIQSVLVDDGDAVRLAIEKQEKVLRELKMKKPQLNELVHTAEVLKGD   1992
XP_319450.4              --------------------------------------------------


NP_003997.1       2541   TSNQEARTIITDRIERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKE   2590
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2536   TSNQEARTIITDRIERIQSQWDEVQEHLQNRRLQLTEMLKDSTQWLEAKE   2585
NP_031894.1       2534   TSNQEARTIITDRIERIQIQWDEVQEQLQNRRQQLNEMLKDSTQWLEAKE   2583
NP_990630.1       2538   TSNQEARTIITDRIEKIQSQWDDVHGYLQNRRQQLHEMQKDSTQWLEAKQ   2587
NP_001262730.1    1993   VKRQQ----LQEKVTRLREHWDETSQCVLQRAAQLKNMLSDSQRFEAKRL   2038
XP_319450.4         32   ---------------RMKEQWEDTNQSVMQRKTQLTAMLGDSQRYEAKRL   66


NP_003997.1       2591   EAEQVLGQARAKLESWKEGPYTVDAIQKKITETKQLAKDLRQWQTNVDVA   2640
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2586   EAEQVLGQARAKLESWKEAPYTVDAIQKKITETKQLAKDLRQWQINVDVA   2635
NP_031894.1       2584   EAEQVIGQVRGKLDSWKEGPHTVDAIQKKITETKQLAKDLRQRQISVDVA   2633
NP_990630.1       2588   EAEQVLEQAKAKLESWKEISYTVEALKKQNSELKQFSKEIRQWQMNIEGV   2637
NP_001262730.1    2039   ELEKWLARMEQRAERMGTIATTADILEAQQKEQKSFHAELHQNKQHFDIF   2088
XP_319450.4         67   EIDAWLSRMETITERMGPVATTADVLDIQQKEQKSFHAELHKFNHQIELF   116


NP_003997.1       2641   NDLALKLLRDYSADDTRKVHMITENINASWRSIHKRVSEREAALEETHRL   2690
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2636   NDLALKLLRDYSADDTRKVHMITENINASWASIHKRLSEREAALEETHRL   2685
NP_031894.1       2634   NDLALKLLRDYSADDTRKVHMITENINTSWGNIHKRVSEQEAALEETHRL   2683
NP_990630.1       2638   NDVALKPVRDYSADDTRKVELMTDNINATWATINKRVSEREAALESALLM   2687
NP_001262730.1    2089   NELTQKLIAVYPNDDTTRIKKMTEVINQRYANLNSGVINRGKQLHAAVHS   2138
XP_319450.4        117   NQLTQKLISVYQCDDTSRIKRMTESINLRYNNLNNSIISRGKQLHAAIHS   166


NP_003997.1       2691   LQQFPLDLEKFLAWLTEAETTANVLQDATRKERLLEDSKGVKELMKQWQD   2740
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2686   LQQFPLDLEKFLAWLTEAETTANVLQDATHKERLLEDSKGVRELMKQWQD   2735
NP_031894.1       2684   LQQFPLDLEKFLSWITEAETTANVLQDASRKEKLLEDSRGVRELMKPWQD   2733
NP_990630.1       2688   LQEFYLDLEKFLAWLTEAETTANVLQDATHKEKTLEDPQMVRELMKQWQD   2737
NP_001262730.1    2139   LQSFDRAMDQFLAFLSETETLCENAESDIERNPLM------------FKD   2176
XP_319450.4        167   LQTFDRTFEQFLGWLSEAESLCENTETEAERNPHC------------LKD   204


NP_003997.1       2741   LQGEIEAHTDVYHNLDENSQKILRSLEGSDDAVLLQRRLDNMNFKWSELR   2790
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2736   LQGEIEAHTDIYHNLDENGQKVLRSLEGSDDAALLQRRLDNMNFKWSELR   2785
NP_031894.1       2734   LQGEIETHTDIYHNLDENGQKILRSLEGSDEAPLLQRRLDNMNFKWSELQ   2783
NP_990630.1       2738   LQAEIDAHTDIFHNLDENGQKILRSLEGSEDAVLLQRRLDNMNFRWSELR   2787
NP_001262730.1    2177   LQSEIETHRVVYDRLDGTGRKLLGSLTSQEDAVMLQRRLDEMNQRWNNLK   2226
XP_319450.4        205   LQSEIDANRKVYEGLDNTGRKLLRSLTSQEDAVMLQHKLDEMNQRWNHLN   254


NP_003997.1       2791   KKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQ--APIGGDF   2838
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2786   KKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQ--APIGGDF   2833
NP_031894.1       2784   KKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQ--APIGGDF   2831
NP_990630.1       2788   KKSLNIRSHLEASTDQWKRLHLSLQELLAWLQLKEDELKQQ--APIGGDI   2835
NP_001262730.1    2227   SKSIAIRNRLESNSEHWNALLLSLRELTEWVIRKDTELSTLGLGPVRGDA   2276
XP_319450.4        255   SRSAAIRNRLESNSDHWNALLLSSRELTEWVIRKNTELTSIGFGSINGDS   304


NP_003997.1       2839   PAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLT-EQPLEGLEKLY--   2885
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2834   PAVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFLT-EQPLEGLEKLY--   2880
NP_031894.1       2832   PAVQKQNDIHRAFKRELKTKEPVIMSTLETVRIFLT-EQPLEGLEKLY--   2878
NP_990630.1       2836   PTVQKQNDVHRTFKRELKTKEPVIMNALETVRLFLA-DQPVEGLEKVY--   2882
NP_001262730.1    2277   VSLQKQLDDHKAFRRQLEDKRPIVESNLTSGRQYIANEAAVSDTSDTEAN   2326
XP_319450.4        305   NSLQMQLDEHKAFRRQLDDKRSIIENNLMNGRQYISNESPLSDASDSEAI   354


NP_003997.1       2886   --QEPRELPPEERAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKIDETL   2933
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2881   --QEPRELPPEERAQNVTRLLRKQAEEVNTQWEKLNVHSADWQRKIDEAL   2928
NP_031894.1       2879   --QEPRELPPEERAQNVTRLLRKQAEEVNAEWDKLNLRSADWQRKIDEAL   2926
NP_990630.1       2883   --PEPRDLSPEERAQNVTKVLRRQADDVRTEWDKLNLRSADWQKKIDDAL   2930
NP_001262730.1    2327   HDSDSRYMSAEEQSRELTRSIRREVGKLSEQWNNLIDRSDNWKHRLDEYM   2376
XP_319450.4        355   --DETMYISTEEQNRILSRSIRREVNKLSEQWSLLIERCDKWKHRLDENI   402


NP_003997.1       2934   E-----------------RLQELQEATDELDLKLRQAEVIKGSWQPVGDL   2966
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2929   E-----------------RLQELQEATDELDLKLRQAEVIKGSWQPVGDL   2961
NP_031894.1       2927   E-----------------RLQELQEAADELDLKLRQAEVIKGSWQPVGDL   2959
NP_990630.1       2931   E-----------------RLQGLQEAMDELDLKLRQAEAFKGSWQPVGDL   2963
NP_001262730.1    2377   TPQSVSVVSEILISNTLKKMRQFQKILEDLSSRVALAEQTKTSWLPPSS-   2425
XP_319450.4        403   T-----------------KMRQFQKILEDLSSRVASAETITHSWTTPAP-   434


NP_003997.1       2967   LIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLST   3016
XP_003317462.2           --------------------------------------------------
NP_001003343.1    2962   LIDSLQDHLEKVKALRGEITPLKENVSYVNDLARQLTTLGIQLSPYNLNT   3011
NP_031894.1       2960   LIDSLQDHLEKVKALRGEIAPLKENVNRVNDLAHQLTTLGIQLSPYNLST   3009
NP_990630.1       2964   LIDSLQDHLEKVKVYRAEMVPLKEKVHQVNELAHRFAPPDIQLSPYTLSC   3013
NP_001262730.1    2426   -VGEANEQMQQLQRLRDKMTTASALLDDCNEQQSFFTANQVLVPTPCLSK   2474
XP_319450.4        435   -GSDTTEEMQHLQRLKDKLTTANALLDDCNEQQNFFSSCRVIVPSPYLAK   483


NP_003997.1       3017   LEDLNTRWKLLQVAVEDRVRQL-----------------HEAHRDF----   3045
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3012   LEDLNTRWKLLQVAIEDRIRQL-----------------HEAHRDF----   3040
NP_031894.1       3010   LEDLNTRWRLLQVAVEDRVRQL-----------------HEAHRDF----   3038
NP_990630.1       3014   LEDLNTRWKVLQVAIDERIRQL-----------------HEAHRDF----   3042
NP_001262730.1    2475   LEDLNTRMKLLQIAMDERQKVLCQAGAQQTHENG------DDGRTTSNSG   2518
XP_319450.4        484   LEDINTRMKLLHIAVEERFKVL-QQSMQTTAEDGIVGSHHEEGSKFSKPL   532


NP_003997.1       3046   --GPASQHF--LSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTEL   3091
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3041   --GPASQHF--LSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTEL   3086
NP_031894.1       3039   --GPASQHF--LSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTEL   3084
NP_990630.1       3043   --GPTSQHF--LTTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTEL   3088
NP_001262730.1    2519   TIGP----LPNLGQSVKPPWERATTAANVPYYIDHERETTHWDHPEMIEL   2564
XP_319450.4        533   HIAPGSSTVPNLEKSVQIPWERAVTPANVPYYINHERESTHWDHPEMIEL   582


NP_003997.1       3092   YQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLK-Q   3140
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3087   YQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLK-Q   3135
NP_031894.1       3085   YQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDALDQHNLK-Q   3133
NP_990630.1       3089   YQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLNLSAACDALDQHNLK-Q   3137
NP_001262730.1    2565   MKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQ   2614
XP_319450.4        583   MKSLADLNEVRFSAYRTALKLRTVQKKLAFDRLNMSVAIEIFDRYGLRAQ   632


NP_003997.1       3141   NDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGR   3190
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3136   NDQPMDILQVINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGR   3185
NP_031894.1       3134   NDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGR   3183
NP_990630.1       3138   NDQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGR   3187
NP_001262730.1    2615   NDKLIDIPDMTTVLHSLYVTIDK-----IDLTLMLDLAINWILNVYDSQR   2659
XP_319450.4        633   NDKLIDIPDMTTILNSLYTTLEP-----IDRAVMLDLAINWVLNVYDSQR   677


NP_003997.1       3191   TGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD   3240
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3186   TGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD   3235
NP_031894.1       3184   TGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD   3233
NP_990630.1       3188   TGRIRVLSFKTGVVSLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHD   3237
NP_001262730.1    2660   TGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHD   2709
XP_319450.4        678   TGQIRVLSFKVGLILLCRGHLEEKYRYLFRLIADLEKKVDQRKMGLLLHD   727


NP_003997.1       3241   SIQIPRQLGEVASFGGSNIEPSVRSCFQFAN------------NKPEIEA   3278
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3236   SIQIPRQLGEVASFGGSNIEPSVRSCFQFAN------------NKPEIEA   3273
NP_031894.1       3234   SIQIPRQLGEVASFGGSNIEPSVRSCFQFAN------------NKPEIEA   3271
NP_990630.1       3238   SIQIPRQLGEVASFGGSNIEPSVRSCFQFAN------------NKPEIEA   3275
NP_001262730.1    2710   CIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGNQDIS---IEL   2756
XP_319450.4        728   CIQVPRQLGEVAAFGGSNIEPSVRSCFELAG----GVNQNGELTETAIEA   773


NP_003997.1       3279   ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRS   3328
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3274   ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRS   3323
NP_031894.1       3272   ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRS   3321
NP_990630.1       3276   ALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRS   3325
NP_001262730.1    2757   QHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRC   2806
XP_319450.4        774   QHFLSWLQHEPQSIVWLPVLHRLVAAETAKHQAKCNICKEYPIEGFRYRC   823


NP_003997.1       3329   LKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN   3378
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3324   LKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN   3373
NP_031894.1       3322   LKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN   3371
NP_990630.1       3326   LKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKN   3375
NP_001262730.1    2807   LKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKN   2856
XP_319450.4        824   LKCFNFDMCQKCFFTGRSTKNHKLSHPMHEYCTTATSTEDVRDFTRALRN   873


NP_003997.1       3379   KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL   3428
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3374   KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL   3423
NP_031894.1       3372   KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL   3421
NP_990630.1       3376   KFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSA-------   3418
NP_001262730.1    2857   KFKSRKYFKKHPRVGYLPVQSVLEGDALESPA---------PSPQHTTHQ   2897
XP_319450.4        874   KFKSRKYFKKHPRVGYLPVQSVLEGDALESPI---------PSPQHGTHT   914


NP_003997.1       3429   SHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQS   3478
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3424   SHDDTHSRIEHYASRLKKMENSNGSYLNDSISPNESIDDEHLLIQHYWRS   3473
NP_031894.1       3422   SHDDTHSRIEHYASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQS   3471
NP_990630.1       3419   ---------------LAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQS   3453
NP_001262730.1    2898   LQNDMHSRLEMYASRLAQVE-----YGGTGSNSTPDSDDEHQLIAQYCQA   2942
XP_319450.4        915   LQNDMHSRLEMYASRLAQVE-----C-GTRSNSTPDSDDEHQLIAQYCQA   958


NP_003997.1       3479   L------NQDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQA   3522
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3474   L------NQESPLSQPRSPAQILISLESEERGELERILADLEGRNRNLQA   3517
NP_031894.1       3472   L------NQDSPLSQPRSPAQILISLESEERGELERILADLEEENRNLQA   3515
NP_990630.1       3454   L------NQESPLSQPRSPAQILISLESEERGELERILADLEEENRNLQA   3497
NP_001262730.1    2943   LP-----GTSNGS-APKSPVQVMAAMDAEQREELEAIIRDLEEENANLQA   2986
XP_319450.4        959   LPAANAVGTSTGSGGPKSPVQVMAAMEAEQREELETMIKELEEENANLQA   1008


NP_003997.1       3523   EYDRLKQQHEH---------KGLSPLPSPPEMMPTSPQSPRDAELIAEAK   3563
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3518   EYDRLKQQHEH---------KGLSPLPSPPEMMPTSPQSPRDAELIAEAK   3558
NP_031894.1       3516   EYDRLKQQHEH---------KGLSPLPSPPEMMPTSPQSPRDAELIAEAK   3556
NP_990630.1       3498   EYDRLKQQHDH---------KGLSPLPSPPEMMPVSPQSPRDAELIAEAK   3538
NP_001262730.1    2987   EYQQLCSKEQS---GMPEDSNGMQHSSSS--MTGLSGQGEQGQDMMAEAK   3031
XP_319450.4       1009   EYEKLKAKKTSTPITTPDEGYKTPTSTSNAIVSSVTTSSSGGSDMVTEAK   1058


NP_003997.1       3564   LLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSS   3613
XP_003317462.2    1303   ---------------------------------IESPQ------------   1307
NP_001003343.1    3559   LLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSS   3608
NP_031894.1       3557   LLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSS   3606
NP_990630.1       3539   LLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQADAKVNGTTLSS   3588
NP_001262730.1    3032   LLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDEP-------------   3068
XP_319450.4       1059   LLRQHKGRLEARMQILEDHNKQLEAQLQRLRQLLHEVLIRFIFHAILHCL   1108


NP_003997.1       3614   PSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQL   3663
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3609   PSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQL   3658
NP_031894.1       3607   PSTSLQRSDSSQPMLLRVVGSQTSESMGEEDLLSPPQDTSTGLEEVMEQL   3656
NP_990630.1       3589   PSTSLQRSDSSQPMLLRVVGSQTSETMGEDDLLSPPQDTSTGLEEVMEQL   3638
NP_001262730.1    3069   NGGGSSATSSGLPSAPGSALNSKPNTLQTRSVTASQLNTDSPAK--MNQQ   3116
XP_319450.4       1109   LKHLHSEFNNMFPTIP------KPQTLQTRSVTASQLNTDSPAK--M-QH   1149


NP_003997.1       3664   NNSFPSS-------------------------------------------   3670
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3659   NHSFPSS-------------------------------------------   3665
NP_031894.1       3657   NNSFPSS-------------------------------------------   3663
NP_990630.1       3639   NNSFPSS-------------------------------------------   3645
NP_001262730.1    3117   NGHYEHNSKGIMLPGMNSEIQQQHAQLASLAAKHHQHQLSGALNALHQQQ   3166
XP_319450.4       1150   NGHYDHK-------------------------------------------   1156


NP_003997.1       3671   -------------------------RGRNTPGKPMREDTM----------   3685
XP_003317462.2           --------------------------------------------------
NP_001003343.1    3666   -------------------------RGRNTPGKPMREDTM----------   3680
NP_031894.1       3664   -------------------------RGRNAPGKPMREDTM----------   3678
NP_990630.1       3646   -------------------------RGRNAPGKPVREATM----------   3660
NP_001262730.1    3167   QQQLQQQPPQQQRSMMTGNGGMDISGGMQTSGGYLGDDGRPPPPPHSSLM   3216
XP_319450.4              --------------------------------------------------


NP_003997.1              ------------
XP_003317462.2           ------------
NP_001003343.1           ------------
NP_031894.1              ------------
NP_990630.1              ------------
NP_001262730.1    3217   QQQHQQHLNDLA   3228
XP_319450.4       1157   ----------MC   1158


Protein Acc. Gene Organism
NP_003997.1 DMD H.sapiens
XP_003317462.2 LOC465559 P.troglodytes
NP_001003343.1 DMD C.lupus
NP_031894.1 Dmd M.musculus
NP_990630.1 DMD G.gallus
NP_001262730.1 Dys D.melanogaster
XP_319450.4 AgaP_AGAP010261 A.gambiae


Support Center