U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:22507. Gene conserved in Murinae Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_033165.1          1   MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDC   50
NP_001004202.1       1   MRHSKTAISFFILVAVLGSQAGLIQDTVKEDRPFNPTIIHQGFQD-SSDC   49


NP_033165.1         51   CFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRC   100
NP_001004202.1      50   CFSYASQIPCSRFIYYFPTSGGCTKPGIIFVTRKRKRVCANPSDQRVQTC   99


NP_033165.1        101   LSTLKQGPRSGNKVIA   116
NP_001004202.1     100   ISTLKLGPRSGNSAIA   115


Protein Acc. Gene Organism
NP_033165.1 Ccl6 M.musculus
NP_001004202.1 Ccl6 R.norvegicus


Support Center