Display Settings:

Format

Send to:

Choose Destination
HomoloGene:2614. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_003493.1              --------------------------------------------------
XP_001152990.3       1   MPGPGRGSAWVAACSGVRTLQVDALLPKHWSFSWACSSSSSSSSKFYSSL   50
XP_002802391.1           --------------------------------------------------
XP_852321.3          1   ----------------------------MGQEEDGRGHNPGSLARPQQQL   22
NP_001178327.1           --------------------------------------------------
NP_033863.2              --------------------------------------------------
NP_077381.1              --------------------------------------------------
NP_990275.1              --------------------------------------------------
NP_571578.2              --------------------------------------------------
XP_002935881.1           --------------------------------------------------


NP_003493.1          1   -------------------------------MNIQEQG--FPLDLGASFT   17
XP_001152990.3      51   MSKRDRLIHFGAVSTDVLGCSAHCSLTQSPKMNIQEQG--FPLDLGASFT   98
XP_002802391.1       1   -------------------------------MNIQEQG--FPLDLGASFT   17
XP_852321.3         23   CRTKDRLIHFGAISTDVLGCSAHCSLTQSPKMNIQEQG--FPLDLGASFT   70
NP_001178327.1       1   -------------------------------MNIQEQG--FPLDLGASFT   17
NP_033863.2          1   --------------------------MQSPKMNVQEQG--FPLDLGASFT   22
NP_077381.1          1   --------------------------MQSPKMNVQEQG--FPLDLGASFT   22
NP_990275.1          1   -------------------------------MNIQGKG--FPLDLGRSFT   17
NP_571578.2          1   -----------------------------MSMSVNEKGICYLPDLGSSFT   21
XP_002935881.1       1   -------------------------------MSVKGKG--FPLDLGGSFT   17


NP_003493.1         18   EDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLD   67
XP_001152990.3      99   EDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLD   148
XP_002802391.1      18   EDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKAETSTATPRRSDLD   67
XP_852321.3         71   EDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGAGVKGETSAATPRRSDLD   120
NP_001178327.1      18   EDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGAGIKGETSTATPRRSDLD   67
NP_033863.2         23   EDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLD   72
NP_077381.1         23   EDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLD   72
NP_990275.1         18   EDAPRPPVPGEEGELVSTDPRPVSHGFYSSKSDAVRNETSTATPRRSDLD   67
NP_571578.2         22   EDAPRPPVPGEEGDLVSSDGRQYNHSFYSSKSDSLKNEASIATPRRPDLD   71
XP_002935881.1      18   EDAPRPPVPGEEGELITTDQRPFSHSYYSLKNDGIKNETSTATPRRPDLD   67


NP_003493.1         68   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDF   117
XP_001152990.3     149   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDF   198
XP_002802391.1      68   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDF   117
XP_852321.3        121   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDF   170
NP_001178327.1      68   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDF   117
NP_033863.2         73   LGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDF   122
NP_077381.1         73   LGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDF   122
NP_990275.1         68   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDF   117
NP_571578.2         72   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEECADMLDF   121
XP_002935881.1      68   LGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLQQENCADLLDF   117


NP_003493.1        118   WFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSF   167
XP_001152990.3     199   WFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSF   248
XP_002802391.1     118   WFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSF   167
XP_852321.3        171   WFACSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNNGIVSRQTKPATKSF   220
NP_001178327.1     118   WFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSF   167
NP_033863.2        123   WFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSF   172
NP_077381.1        123   WFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSF   172
NP_990275.1        118   WFACSGFRKLEPCVSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSF   167
NP_571578.2        122   WFACSGFRKQEANDGN-EKMLKLAKAIYKKYILDNNGIVSRQIKPATKSF   170
XP_002935881.1     118   WFACSGFRKLEPNDSKVEKRLKLAKAIYKKYILDSNGIVSRQIKPATKSF   167


NP_003493.1        168   IKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSES   217
XP_001152990.3     249   IKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSES   298
XP_002802391.1     168   IKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSES   217
XP_852321.3        221   IKDCIVKQLIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSES   270
NP_001178327.1     168   IKDCISKQQIDPAMFDQAQTEVQSTMEENTYPSFLKSDIYLEYTRTGSES   217
NP_033863.2        173   IKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSES   222
NP_077381.1        173   IKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSES   222
NP_990275.1        168   IKDCVMKLQIDPDMFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGES   217
NP_571578.2        171   IKDCVTKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLEYTRTGGES   220
XP_002935881.1     168   IKDCVLRQQIDPAMFDQAQTEIQSMMEDNTYPVFLKSDTYLEYTTIGGES   217


NP_003493.1        218   PKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRL   267
XP_001152990.3     299   PKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRL   348
XP_002802391.1     218   PKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRL   267
XP_852321.3        271   PKLCSDQSSGSGTGKGIPGYLPTLNEDEEWKCDQEQDEDSGRDPAPPGRL   320
NP_001178327.1     218   PKLCSDQSSGSGTGKGVPGYLPTLNEDEEWKCDREVDEDSGRDPAPPGRL   267
NP_033863.2        223   PKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDPLPPSRL   272
NP_077381.1        223   PKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDSVPPSRL   272
NP_990275.1        218   PKIYSDPSSGSGTGKGLPGYLPTLNEDEEWKCDQDTEPEASRDSAPSSRL   267
NP_571578.2        221   PKLFSDQSSVSGNGKVLPGYLPTVIEDVEWRCDQEEEQIAESDPTPSNRL   270
XP_002935881.1     218   PKNYSDQSSASGTGKGPSGYLPTLNEDEEWRCDQGGELERERDSVPSSLF   267


NP_003493.1        268   PQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATS   317
XP_001152990.3     349   PQKLLLETAAPRVSCSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATS   398
XP_002802391.1     268   PQKLLLETAAPRASSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATS   317
XP_852321.3        321   TQKLLLETAAPRASSSRRYSEGREFRCGSWREPVHPYYVSSGYALAPATS   370
NP_001178327.1     268   TQKLLLETAAPRASSSRRYSEGRELRCGSWREPVNPYYVNSGYALAPATS   317
NP_033863.2        273   TQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATS   322
NP_077381.1        273   TQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATS   322
NP_990275.1        268   TQKLLLETATQRATSTRRYSEGREFRHGSWREPVNPYYVNTGYAMAPATS   317
NP_571578.2        271   TQKLPLETVPQRVANSKRYQDNREYRHASWREPVNPYYVNSGYALAPATS   320
XP_002935881.1     268   TQKLVLDSSSHCVGPNRRLSDGREFRPGTWREPVNPYYVNTGYAVAPVTS   317


NP_003493.1        318   ANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVP   367
XP_001152990.3     399   ANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVP   448
XP_002802391.1     318   ANDSEQQSLSSDADTLSLTDSSVWVFGAY---------------------   346
XP_852321.3        371   ANDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVP   420
NP_001178327.1     318   ANDSEQQSLSSDADSLSLTDSSVDGVPPYRTRRQHRREMQESVQANGRVP   367
NP_033863.2        323   ANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESIQVNGRVP   372
NP_077381.1        323   ANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVP   372
NP_990275.1        318   ANDSEQQSMSSDADTMSLTDSSIDGIPPYRLRKQHRREMQESAKANGRVP   367
NP_571578.2        321   ANDSEQQSMSSDADTLSLTDSSVDGVPPYRYRKPHRREIHESAKVNGRVP   370
XP_002935881.1     318   ANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKHYRREMQESANANGRGP   367


NP_003493.1        368   LPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVR   417
XP_001152990.3     449   LPHIPRTHRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVR   498
XP_002802391.1     347   -----RTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVR   391
XP_852321.3        421   LPHIPRTYRMPKEIRVEPQKFAAELIHRLEAIQRTREAEEKLEERLKRVR   470
NP_001178327.1     368   LPHIPRTYRMPKEVRVEPQKFAAELIHRLEAVQRTREAEEELEERLKRVR   417
NP_033863.2        373   LPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVR   422
NP_077381.1        373   LPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVR   422
NP_990275.1        368   LPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRVR   417
NP_571578.2        371   LPHIPRTNRIPKDIHVEPEKFAAELISRLEGVLREREAQEKLEERLKRVR   420
XP_002935881.1     368   LPHIPRTYHMPKDIHVDPEKFAAELISRLEGVLRDREAEQKLEERLKRVR   417


NP_003493.1        418   MEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGL--RDAHEE   465
XP_001152990.3     499   MEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDVGCAGL--RDAHEE   546
XP_002802391.1     392   MEEEGEDGDPSSGLPGPCHKLPPAPAWHHFPPRCVDVGCAGL--RDAHEE   439
XP_852321.3        471   MEEEGEDGDVPSGPLGAIHKLPLAPAWHHFPPRYADVGCVGL--RDAHEE   518
NP_001178327.1     418   MEEEGEDSDMPSGPQGASHKLPSAPAWHHFPSRYADVGCTGL--RDAHEE   465
NP_033863.2        423   MEEEGEDGEMPSGPM-ASHKLPSVPAWHHFPPRYVDMGCSGL--RDAHEE   469
NP_077381.1        423   MEEEGEDGEMPSGPM-ASHKLPSVPAWHHFPPRYVDMGCSGL--RDAHEE   469
NP_990275.1        418   AEEEGEDADISSGPSVISHKMPSAQPFHHFAPRYSEMGCAGMQMRDAHEE   467
NP_571578.2        421   LEEEGDDADISTGPSLANHRVPPAVHVQHYGGRYSEMSYNGLQLRDAHEE   470
XP_002935881.1     418   AEEEGDDGDVSSGPSIISHKLPSGPPMHHYNSRYSDMGCVGMQVRDAHEE   467


NP_003493.1        466   NPESILDEHVQRVLRTPGRQSPGPGH-----RSPDSGHVAK-MPVALGGA   509
XP_001152990.3     547   NPESILDEHVQRVLRTPGRQSPGPGH-----RSPDSGHVAK-MPVALGGA   590
XP_002802391.1     440   NPESILDEHVQRVLRTPGRQSPGPGH-----RSPDSGHMAK-MPVALGSA   483
XP_852321.3        519   NPESILDEHVQRVMRTPGCQSPGPGH-----RSPDNAHVPK-IVGVLGGV   562
NP_001178327.1     466   NPESILDEHVQRVMRTPGCQSPGPGH-----RSPDSAHVPK-I-GVLGGA   508
NP_033863.2        470   NPESILDEHVQRVMRTPGCQSPGPGH-----RSPDSGHVAK-T-AVLGGT   512
NP_077381.1        470   NPESILDEHVQRVMRTPGCQSPGPGH-----RSPDSGHVAK-T-AVLGGT   512
NP_990275.1        468   NPESILDEHVQRVMKTPGCQSPGPGRHSPKPRSPESGHLGK-LSGTLGTI   516
NP_571578.2        471   NPESILDEHVQRVMKTPGCQSPGTGRHSPKSRSPDGLPAGK-IPGLMMPL   519
XP_002935881.1     468   NPESILDEHVQRVMKTPGCQSPGTGRHSPKPRSPD-GHVSKTLPGSLGTM   516


NP_003493.1        510   ASGHGKHVPKSGAKLDAAGLHHHRHVHHHV-HHSTARPKEQVEAEATRRA   558
XP_001152990.3     591   ASGHGKHVPKSGAKLDAAGLHHHRHVHHHI-HHSTARPKEQVEAEATRRA   639
XP_002802391.1     484   ASGHGKHAPKSGVKLDAAGLHHHRHVHHHV-HHSTARPKEQVEAEAARRA   532
XP_852321.3        563   PSGHGKHAPKSGAKLDTAGPHLHRHSHHHS-HHSAARPKEQADAEAARRV   611
NP_001178327.1     509   MPGHGKHAPKLGAKLDPTGLHLHRHGHHHG-HHGAARPKEPAEAEAARRV   557
NP_033863.2        513   ASGHGKHVPKLGLKLDTAGLHHHRHVHHHV-HHNSARPKEQMEAEVARRV   561
NP_077381.1        513   ASGHGKHAPKLGLKLDSAGLHHHRHVHHHV-HHNSARPKEQMEAEAARRV   561
NP_990275.1        517   PPGHGKHTTKSGMKLDAANLYHHKHVYHHIHHHSMMKPKEQIEAEATQRV   566
NP_571578.2        520   SGGQGKHQARQGPKGEAAHLHHHKHIHHTH-YAAAGKPKEQAEAEAA-RM   567
XP_002935881.1     517   QTGHGKHTSKSGSKVDSGNMHHHKHVYHHVHHHGGVKPKEQIEAEATQRV   566


NP_003493.1        559   QSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAH--------SGKVGV   600
XP_001152990.3     640   QSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAH--------SGKVGM   681
XP_002802391.1     533   QSSFAWGPEPHSHGAKSRGYSXRVGAQPQPREARATRHSCCCLCSGKAGM   582
XP_852321.3        612   QGSFAWGPELHGHTAKPRSHSESVGAAPNASDSLAY--------SGKAGT   653
NP_001178327.1     558   PGSFAWGPELHGHAAKPRSHVESTGAPPAGGDGLAY--------GGKVGT   599
NP_033863.2        562   QSSFSWGPETHGH-AKPRSYSENAGTTLSAGD-LAF--------GGKTSA   601
NP_077381.1        562   QSSFSWGPETHGH-AKPRSYSESTGTNPSAGD-LAF--------GGKASA   601
NP_990275.1        567   QNSFAWNVDSHNYATKSRNYSENLGMAPVPMDSLGY--------SGKASL   608
NP_571578.2        568   HGGFAWNTEQHHYGPKSRNYADGMSVGPNTMDPMGY--------SSKGST   609
XP_002935881.1     567   QTNFPWNVESHNYATKSRNYAESMGMAPNPMDSLAY--------SGKVSM   608


NP_003493.1        601   ACKRNAKKAESGKSAST--EVPGASEDAEKNQKIMQWIIEGEKEISRHRR   648
XP_001152990.3     682   ACKRNAKKAESGKSAST--EVPGASEDAEKNQKIMQWIIEGEKEISRHRR   729
XP_002802391.1     583   ACKRNAKKAESGKSASA--EMPGASEDAEKNQKIMQWIIEGEKEISRHRR   630
XP_852321.3        654   ASRRNAKKAESGKNAST--EVPGPSEDTDKNQKIMQWIIEGEKEISRHRK   701
NP_001178327.1     600   TSKRNSKKAELGKSSST--EAPGPSEDAEKNQKIMQWIIEGEKEISRHRK   647
NP_033863.2        602   PSKRNTKKAESGKNANA--EVPSTTEDAEKNQKIMQWIIEGEKEISRHRK   649
NP_077381.1        602   PSKRNTKKAESGKNASA--EVPSTTEDAEKNQKIMQWIIEGEKEISRHRK   649
NP_990275.1        609   LSKRNIKKTDSGKSDGANYEMPGSPEDVERNQKILQWIIEGEKEISRHKK   658
NP_571578.2        610   LSKRPVRKGEDGRNFEM--REPLPADDMERNQKILQWMMEGEKEAGRYKR   657
XP_002935881.1     609   LSKRNAKKADLGKSESASYEMPVVPEDAERHQKILQWIMEGEKEISRHKK   658


NP_003493.1        649   TGHGS-SGTRKPQPHENSRPLSLE-----HPWAGPQLRTSVQPSHLFIQD   692
XP_001152990.3     730   TGHGS-SGTRKPQPHENSRPLSLE-----HPWAGPQLRTSVQPSHLFIQD   773
XP_002802391.1     631   TGHGS-SGTRKPQPHENSRPLSLERPAAVHPWAGPQLRTSVQPSHLFIQD   679
XP_852321.3        702   AGHGS-SGAKKQQVHESSRPLSVERPGAVHPWVSAQLRNSVQPSHLFIQD   750
NP_001178327.1     648   AGHGS-SGAKKQQAHESSRPLSIERPGAVHPWVSAQLRSSVQPSHLFIQD   696
NP_033863.2        650   AGHGS-SGLRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQD   698
NP_077381.1        650   AGHGS-SGMRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQD   698
NP_990275.1        659   TNHGS-SGVKKQLSHDMVRPLSIERPVAVHPWVSAQLRNVVQPSHPFIQD   707
NP_571578.2        658   GPYGSISGPKKAQGHEPARPSSVERLGAVHPWVTAQLRNNVQPSHPFIQD   707
XP_002935881.1     659   SNHGS-SGAKKQPPSELPRPLSIERPGAVHPWVSAQLRNVVQPSHPFIQD   707


NP_003493.1        693   PTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACV   742
XP_001152990.3     774   PTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACV   823
XP_002802391.1     680   PTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACV   729
XP_852321.3        751   PTMPPNPAPNPLTQLEEARRRLEEEEKRASKLPSKQRYVQEVIQRGRSCI   800
NP_001178327.1     697   PTMPPNPAPNPLTQLEEARRRLEEEEKRASKAPSKQR-------------   733
NP_033863.2        699   PTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRYVQAVMQRGRTCV   748
NP_077381.1        699   PTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQR-------------   735
NP_990275.1        708   PTMPPNPAPNPLTQLEEARRRLEEEEKRAGKLPLKQR-------------   744
NP_571578.2        708   PTMPPNPAPNPLTQLEEARRRLEEERRKSGTLQAKQR-------------   744
XP_002935881.1     708   PTMPPNPAPNPLTQLEEARRRLEEEEKRAGKMPQKQRYVQEVIQRGRCPA   757


NP_003493.1        743   RPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGE   792
XP_001152990.3     824   RPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGE   873
XP_002802391.1     730   RPACAPVLRVVPAVSDMELSETETRSQRKAGGGSAQPCDSIVVAYYFCGE   779
XP_852321.3        801   RPTCTPVLSVVPAVSDLELSETETKSQRKAGSGSAQPCDSIVVAYYFCGE   850
NP_001178327.1     734   -----------------------TKSQRKAGGGSTQPCDSIVVAYYFCGE   760
NP_033863.2        749   RPACAPVLSVVPAVSDLELSETETKSQRKAGGGSAPPCDSIVVAYYFCGE   798
NP_077381.1        736   -----------------------TKSQRKAGGGSAPPCDSIVVAYYFCGE   762
NP_990275.1        745   -----------------------LKPQKRPGSGASQPCENIVVAYYFCGE   771
NP_571578.2        745   -----------------------HKNMKK------QPCENITVAYYFRGE   765
XP_002935881.1     758   RPAYVPLLNVVPAVSDMDLSEAELKAQKKSVGVPSQLCDNIVVAYYFCGE   807


NP_003493.1        793   PIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVRE   842
XP_001152990.3     874   PIPYRTLVRGRAVTLGQFKELLTKKGSYSTSLGHVC--------------   909
XP_002802391.1     780   PIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVRE   829
XP_852321.3        851   PIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVRE   900
NP_001178327.1     761   PIPYRTLVRGRAVTLGQFKELLTKKGNYRFYFKKVSDEFECGVVFEEVRE   810
NP_033863.2        799   PIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVRE   848
NP_077381.1        763   PIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVRE   812
NP_990275.1        772   PIPYRTLVKGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVRE   821
NP_571578.2        766   PIPYRTSVKGRIVTLGQFKELLTKKGSYKYYFKKVSYEFDCGVVFEEVRE   815
XP_002935881.1     808   PIPYRTMVKGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVRE   857


NP_003493.1        843   DEAVLPVFEEKIIGKVEKVD   862
XP_001152990.3           --------------------
XP_002802391.1     830   DEAVLPVFEEKIIGKVEKVD   849
XP_852321.3        901   DEAVLPVFEEKIIGKVEKVD   920
NP_001178327.1     811   DTAVLPVFEEKIIGKVEKVD   830
NP_033863.2        849   DEAVLPVFEEKIIGKVEKVD   868
NP_077381.1        813   DEAILPVFEEKIIGKVEKVD   832
NP_990275.1        822   DDTILPIFEEKIIGKVEKID   841
NP_571578.2        816   DDAILPIFEEKIIGKVEKVD   835
XP_002935881.1     858   DDMILPIYEEKIIGKVEKID   877


Protein Acc. Gene Organism
NP_003493.1 AXIN1 H.sapiens
XP_001152990.3 AXIN1 P.troglodytes
XP_002802391.1 AXIN1 M.mulatta
XP_852321.3 AXIN1 C.lupus
NP_001178327.1 AXIN1 B.taurus
NP_033863.2 Axin1 M.musculus
NP_077381.1 Axin1 R.norvegicus
NP_990275.1 AXIN1 G.gallus
NP_571578.2 axin1 D.rerio
XP_002935881.1 axin1 X.tropicalis


Support Center