U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:327. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_000374.1          1   ------MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQ   44
XP_531580.1          1   ------MAADAALRRLLRLHRTEIAMAVDSAFPLLHALADHDVVPEDKFQ   44
XP_001103602.2       1   ------MAADAALRQLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQ   44
XP_544921.3          1   MAGEARAGGDAGLRRLLRLHRTEIAMAVDCAFPLLHALADHDVVPEDKFQ   50
XP_002685182.2       1   MAGETRAGGDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEEKFQ   50
NP_001258478.1       1   -----MAGGDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQ   45
NP_001099849.1       1   -----MAGGDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQ   45
NP_001103484.1       1   -MSKVESFEESDLRSQLRACRTEIAMAIHDPFPLLYGLADHNVISEQILR   49


NP_000374.1         45   ETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQ   94
XP_531580.1         45   ETLHLKEKEGCPQAFHALLSWLLTQGSTAILDFWRVLFKDYNLERYGRLQ   94
XP_001103602.2      45   ETLRLKEKEGCPQAFHALLSWLLTQDSTVILDFWRVLFKDYNLERYGRLQ   94
XP_544921.3         51   ETLRLKEKEGCPQAFHALLSWLLTQDAAAILDFWRVLFKDYNVERYARLQ   100
XP_002685182.2      51   ETLRLKEKEGCPQAFHALLSWLLTQDTGAILDFWRVLFKDYNLERYARLQ   100
NP_001258478.1      46   ETLRLKEKEGCPQAFHALLSWLLTRDSGAILDFWRILFKDYNLERYSRLH   95
NP_001099849.1      46   ETLRLKEKEGCPQAFHALLSWLLTRDSGAILDFWRVLFKDYNLERYSRLH   95
NP_001103484.1      50   ETLERKKKDGIHKAIYSLLTLLLDQDTTVLKAFWKNLCKEYNKECYPKLE   99


NP_000374.1         95   PILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARAAAPA   144
XP_531580.1         95   PILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARAAAPA   144
XP_001103602.2      95   PILDSFPKDVDLSQSRKGRKLPTIPKALVLPPRHPTKRKASEEPRAAAPA   144
XP_544921.3        101   PILDSFPKDVDLSQPRKGRKPPPGPKAAALLPRPPAKRKVPEEPRATPPA   150
XP_002685182.2     101   SILDTFPKDVDLSQPRKGRRSPAGPKATVLLPRPPTKRKALEEPRTVPPA   150
NP_001258478.1      96   SILDGFPKDVDLNQSRKGRKPLAGPKAAVLPPRPPTKRKALEEPRATPPA   145
NP_001099849.1      96   TILDGFPKDVDLSQPRKGRKPLAGPKASVVPPRPPTKRRALEEPRATPPA   145
NP_001103484.1     100   TVFMNLPKGLKQEVRQNGN-----PKLELQARSQSGKKRGVSEKQLTHRT   144


NP_000374.1        145   -ALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVA   193
XP_531580.1        145   -ALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVA   193
XP_001103602.2     145   -ALTPRGTSSPGSQLKAKPSKKAESSAEQQRLPLGNGIQTMSASVQRAVA   193
XP_544921.3        151   -ALSPRVTSSPGSQAKAKP-RKPESSAEPQRLPLGNGIQTMSTSVQRAVT   198
XP_002685182.2     151   -ALSPRGTSSPGSQTKTKPAKKPESNAEPQRLPLGNGIQTMSTSVQRAMA   199
NP_001258478.1     146   -TLASKSVSSPGSHLKTKPPKKPDGNLESQHLPLGNGIQTMAASVQRAVT   194
NP_001099849.1     146   -TLASKSISSPGSHSKAKPPKKPEGNLESQRLPLGNGIQTMAASVQRAVT   194
NP_001103484.1     145   HHHHSKKSLTSSSGSKGKLMKKTDGAAHSQ-VSVGNGVQAVSTSVQRAVT   193


NP_000374.1        194   MSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDSGSG-   242
XP_531580.1        194   VSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPGSG-   242
XP_001103602.2     194   MSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPSGG-   242
XP_544921.3        199   VSSGDVPGACGALEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDPSGG-   247
XP_002685182.2     200   VSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPNKFEDPAGG-   248
NP_001258478.1     195   VASGDVPGTRGAVEGILIQQVFESGRSKKCIQVGGEFYTPNKFEDPSGNL   244
NP_001099849.1     195   VSSGDVPGSRGAVEGILIQQVFESGGSKKCIQVGGEFYKPSKFEDPSGNL   244
NP_001103484.1     194   VSAGDLPDSCGTVEEILIQQVIESGGAKKCIKVGGEFYSSGKLDETAGAQ   243


NP_000374.1        243   KNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLH   292
XP_531580.1        243   KNKARSSSGLKPLVRAKGAQGAAPGGGEARLGQQGRVPAPLALPSDPQLH   292
XP_001103602.2     243   KNKARSGGGLKPLVRAKGAQGAAPGGGEARLGQQSRAPAPPALPSDPQLH   292
XP_544921.3        248   KNRTRS-SGLKTLVRAKGAQAPAPGGGDPRAGQPGRVQAPPALPSEPQLQ   296
XP_002685182.2     249   KNKTRS-SSLKTLVRAKGTQAPAPGGGDSRAGPRDRAPAPPALPSEPQLH   297
NP_001258478.1     245   KNKARSGSSLKPVVRAKGAQVTIPGRDEQKVGQQCGVPPLPSLPSEPQVN   294
NP_001099849.1     245   KNKTRGGSSLKPVIRGKGTQ----GRDEQKVSQQCGVPPLPPLPNEPQVH   290
NP_001103484.1     244   QTQTQTAHT------SSHQQREPSSRGLATPGLQYVVAVLTCYPQKMTFA   287


NP_000374.1        293   -QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCL   341
XP_531580.1        293   -QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCL   341
XP_001103602.2     293   -QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSGCL   341
XP_544921.3        297   -QKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLHDIPSGTWRCSSCL   345
XP_002685182.2     298   -QKNEDECAACRDGGELLCCDGCPRAFHLACLTPPLSEIPSGTWRCSNCV   346
NP_001258478.1     295   -Q-NEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCCL   342
NP_001099849.1     291   -QKNEDECAVCHDGGELICCDGCPRAFHLACLSPPLQEIPSGLWRCSCCL   339
NP_001103484.1     288   VEHNDDECAVCKDGGELICCDGCPRAFHLSCLVPPLTSIPRGTWRCQLCQ   337


NP_000374.1        342   QA-TVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDT   390
XP_531580.1        342   QA-TVQEVQPRAEEPQPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDT   390
XP_001103602.2     342   QV-TVQETQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLTGMDT   390
XP_544921.3        346   QG-RAQRDVPRAEEPPPQEPPAETPVLLGLRLAGEDAKGPSREPPAGMDA   394
XP_002685182.2     347   QGTTAQRDLPRAEQPRPQELPAETPAFLGLR-SGEEARALSTGLPPGTDA   395
NP_001258478.1     343   QG-RVQQNLSQPEVSRPPELPAETPILVGLRSASEKTRGPSRELKASSDA   391
NP_001099849.1     340   QG-RIQQNLSQPEESRPLEPSAETPILLGLRSASEKTRVLSRELPAGSDA   388
NP_001103484.1     338   SN-RLKDRTYTHVQP------------------------PATETSSGSAV   362


NP_000374.1        391   TLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGAR--CGVCG   438
XP_531580.1        391   TLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGAR--CGVCG   438
XP_001103602.2     391   ALVYKHPPAPPSAAPLPGLDSSALHPLLCVGPEGQQSPAPGAQ--CGVCG   438
XP_544921.3        395   AGPYKHPLAPPPAAPSPVLEPSALRPLLCVGPEGQQG--PAAR--CGVCG   440
XP_002685182.2     396   AVTYKHLLAPPSVAPLPVLDPSALRPLLCVGPEGQQGPVPGAR--CGVCG   443
NP_001258478.1     392   AVTYVNLLAPHPAAPL--LEPSALCPLLSAGNEGRPGPAPSAR--CSVCG   437
NP_001099849.1     389   AVTYANLLAPPSTAPV--LEPSALCPLPSAGAEGQPGPTLSAR--CGVCG   434
NP_001103484.1     363   DFSFFSSLSSTSLSTV-----SASSSAQSIGLQSSDGERVGIRMACGICY   407


NP_000374.1        439   -DGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPA-----   482
XP_531580.1        439   -DGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPA-----   482
XP_001103602.2     439   -DGTDVLR----------------------TGLRCRSCSGDMTPA-----   460
XP_544921.3        441   -DGSDVLRCTHCAAAFHWRCHFPGGAPRPGAP-RCRSCSGDAGPA-----   483
XP_002685182.2     444   -DGADALRCAHCAAAFHWRCHFPGCATRPGAALRCRACSGDTAPELDVRN   492
NP_001258478.1     438   -DGTEVLRCAHCAAAFHWRCHFPTAAARPGTNLRCKSCSADSTPTPGT--   484
NP_001099849.1     435   -DSTDVLRCAHCAAAFHWRCHFPMAAVRPGTNLRCKSCSAEPTPTPGV--   481
NP_001103484.1     408   LTRGELITCPQCLQAYHALCNFPNGRT------RCRNCSRSWG-------   444


NP_000374.1        483   --PVEGVLAPS------PARLAP-------GPAK--DDTASHEPALHRDD   515
XP_531580.1        483   --PVEGVLAPS------PARLAP-------GPAK--DDTASHEPTLHRDD   515
XP_001103602.2     461   --PVEGLLAPS------PAHLAP-------GPAK--DDTASHEPTLHRED   493
XP_544921.3        484   --PGDGAPAST------PARAAP-------GPAKAGDGSSGHEPVLHRDD   518
XP_002685182.2     493   QFPGSHLEKESCFCGDDPSRGVEVGLTSYLSGIQVGDDSAGHEPVLHRDD   542
NP_001258478.1     485   --PGEAVPTSG-------PRPAP-------GLAKVGDDSASHDPVLHRDD   518
NP_001099849.1     482   --PGEAVPTA--------VRPTP-------GLAKVGDDSASHDPVLHRDD   514
NP_001103484.1     445   --PGNDNSSTC--------RSLQ------LSQHMSDQGLTPSEQLLNRDE   478


NP_000374.1        516   LESLLSEHTFDGILQWAIQSMARP---AAPFPS   545
XP_531580.1        516   LESLLSEHTFDGILQWAIQSMARP---VAPFPS   545
XP_001103602.2     494   LESLLSEHTFDGILQWAIQSMARPLAEAAPSPS   526
XP_544921.3        519   LESLLNEHSFDGILQWAIQSMSRPLAEAPPFPS   551
XP_002685182.2     543   LESLLSEHSFDGILQWAIQSMSRPLAEAPTFPS   575
NP_001258478.1     519   LESLLNEHSFDGILQWAIQSMSRPLAETPPFSS   551
NP_001099849.1     515   LESLLNEHSFDGILQWAIQSMSRPLAETPPFSS   547
NP_001103484.1     479   MDSVMGESSIDGILQWAFHNISRPLSETQGYFQ   511


Protein Acc. Gene Organism
NP_000374.1 AIRE H.sapiens
XP_531580.1 AIRE P.troglodytes
XP_001103602.2 AIRE M.mulatta
XP_544921.3 AIRE C.lupus
XP_002685182.2 AIRE B.taurus
NP_001258478.1 Aire M.musculus
NP_001099849.1 Aire R.norvegicus
NP_001103484.1 aire D.rerio


Support Center