Display Settings:

Format

Send to:

Choose Destination
HomoloGene:41305. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_061926.3          1   MAENSESLGTVPE-----------HERILQEIESTDTACVGPTLRSVYDD   39
XP_507926.3          1   MAENSESLGTVPE-----------HERILQEIESTDTACVGPTLRSVYDD   39
XP_001088450.2       1   MAESSEGLGTVPE-----------HERILQEIESTDTACVGPTLRSVYDD   39
XP_534966.3          1   MAENSEGLGTVPE-----------HERILQEIESTDTACVGPTLRSVYDD   39
NP_001095355.1       1   MAEIGEGPGTVPE-----------HERILQEIQSTDTACVGPTLRSVYDD   39
NP_780562.2          1   MAESCEALGTVPE-----------HERILQEIESTDTACVGPTLRSVYDD   39
NP_062150.2          1   MAESGEALGTVPE-----------HERILQEIESTDTACVGPTLRSVYDG   39
NP_001012923.1           --------------------------------------------------
NP_998465.1          1   MYDSSSSLKIPSSPQEEDKAEGKVYGNVFAELESVDLP-LGTSLRSVYDD   49
XP_002939141.2       1   MAESSGSLETVTE-----------HERILQEIESTDTACLGPTLRSVYDD   39


NP_061926.3         40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEK   89
XP_507926.3         40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEK   89
XP_001088450.2      40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEK   89
XP_534966.3         40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEK   89
NP_001095355.1      40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRTDAEK   89
NP_780562.2         40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRADAEK   89
NP_062150.2         40   QPNAHKKFMEKLDACIRNHDKEIEKMCNFHHQGFVDAITELLKVRADAEK   89
NP_001012923.1       1   --------MEKLDACIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEK   42
NP_998465.1         50   QPNAHKRFMEKLDARIRNHDREIEKMCNFHHQGFVDAITELLKVRADAEK   99
XP_002939141.2      40   QPNAHQRFMEKLDARIRNHDREIEKMCNFHHQGFVEAINELLKVRADAEK   89


NP_061926.3         90   LKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVL   139
XP_507926.3         90   LKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVL   139
XP_001088450.2      90   LKVQVTDTNRRFQDAGKEVIVHTEDIIRCRIQQRNITTVVEKLQLCLPVL   139
XP_534966.3         90   LKVQVTDTNRRFQDAGKEVIIQTEDIIRCRIQQRNITTVVENLQYAFPVL   139
NP_001095355.1      90   LKVQVTDTNRRFQDAGKEVIVQTEDIIRCRIQQRNITTVVEKLQLCLPVL   139
NP_780562.2         90   LKVQVTDTNRRFQDAGKEVIIQTEDIIRCRIQQRNITTVVEKLQLCLPVL   139
NP_062150.2         90   LKVQVTDTNRRFQDAGKEVIEQTEDIIRCRIQQRNITTVVEKLQLCLPVL   139
NP_001012923.1      43   LKVQVTDTNRRLQDAGKEVIAQTEEIIRCRVQQRNITTVVEKLQLCLPVL   92
NP_998465.1        100   LMGQVSDTNRRLQDAGREVTAQTEEVIRCRVQQRNMATTVEKLQLCIPVL   149
XP_002939141.2      90   LKVQVTDTNRRLQDAGKEVIAKTEESIRCRIQQRNIATVIDKLQLCLPAL   139


NP_061926.3        140   EMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLR   189
XP_507926.3        140   EMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLR   189
XP_001088450.2     140   EMYSKLKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLR   189
XP_534966.3        140   EMYSKLKEQMTAKRYYSALKTMEQLENVYFPRVSQYRFCQLMIENLPKLR   189
NP_001095355.1     140   EMYSKLKEQMSTKRYYSALKTMEQLENVYFPRVSQYRFCQLMIENLPKLR   189
NP_780562.2        140   EMYSKLKEQMSMKRYYSALKTMEQLENVYFPRVSQYRFCQLMMETLPKLR   189
NP_062150.2        140   EMYSKLKEQMSMQRYYSALKTMEQLENVYFPRVSQYRFCQLMMDTLPKLR   189
NP_001012923.1      93   EMYSKLKEQMKVKRYYSALKTMEQLENLYLPRVSQYRFCQIMIENLPKLR   142
NP_998465.1        150   EMYSKLKEQLESKRYYSALKTMEQLENIYIPRVSQYRFCQIMAETLPKLR   199
XP_002939141.2     140   EMYSKLKEQISGKRYYSALKTMEQLENIYLPKVSQYRFCQIMGENLPKLR   189


NP_061926.3        190   EDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNKMK   239
XP_507926.3        190   EDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNKMK   239
XP_001088450.2     190   EDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQHQKTFSVSLQKQNKMK   239
XP_534966.3        190   EDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQQQKTFSVALQKQNNVK   239
NP_001095355.1     190   EDIKEISMSDLKDFLESIRKHSDKIGETAMKQAQQQKIITVTLQKQNNVK   239
NP_780562.2        190   EDIKDISMSDLKDFLESIRKHSDKIGEAAMKQAQQQKSFSVALQKQNNMR   239
NP_062150.2        190   EDIKDISMSDLKDFLESIRKHSDKIGETAMKQAQQQKSFSIAVQKQTNMR   239
NP_001012923.1     143   EEIKEISMSDLKDFLESIRKHSDRIGETAMKQAQQQKTFSTTLQKHHNVN   192
NP_998465.1        200   EEIKEISMSDLKDFLESIRKHSDKIGETAMRQAQQHRTFNSAVQKQVTLS   249
XP_002939141.2     190   EEIKEISMSGLKDFLESIRKHSDKIGETAMRQAQQQKTFQVALHKKTNVS   239


NP_061926.3        240   FGKNMYINRDRIPEERNETVLKHSLEEEDENEEEILTVQDLVDFSPVYRC   289
XP_507926.3        240   FGKNMYINRDRIPEERNETVLKHSLEEEDENEEEVLTVQDLVDFSPVYRC   289
XP_001088450.2     240   FGKNMYINHDRIPEERNETVLKHSLEEEDENEEEVLTVQDLVDFSPVYRC   289
XP_534966.3        240   FGKNMYIN-DRIPEERKENELKQGFEEEDENEEEILTVQDLVDFSPVYRC   288
NP_001095355.1     240   FGKTMYIN-DRIPEERNEIVLKHAFEEEDENEEEVLTVQDLVDFSPVYQC   288
NP_780562.2        240   FGKNMHVNNDRILEEKSDVIPKHALEEEAENDEEVLTVQDLVDFSPVYRC   289
NP_062150.2        240   FGKNMHVNNDRTLEEKSDIILKHTLEEEAENDEEVLTVQDLVDFSPVYRC   289
NP_001012923.1     193   YGRNMHLGRSRILESRNEMTLKRTFEEDDEHDEEVLTAQDLVDFSPVYRC   242
NP_998465.1        250   CAKPLYGLNGRTPLHHNG--LSTDTAEEEEMDEEVLTAQDLVDFSPVYRC   297
XP_002939141.2     240   LKKNKYILNGHISEDKNGVKSKYDAADED-TEEEVLNVQDLVDFSPVYRC   288


NP_061926.3        290   LHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIV   339
XP_507926.3        290   LHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIV   339
XP_001088450.2     290   LHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIV   339
XP_534966.3        289   LHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIV   338
NP_001095355.1     289   LHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFTQIV   338
NP_780562.2        290   LHIYSALGDEETFENYYRKQRKKQARLVLQPQSSVHETVDGYRRYFTQIV   339
NP_062150.2        290   SHIYSALGDEETFENYYRKQRKKQARLVLQPQSSVHETVDGYRRYFTQIV   339
NP_001012923.1     243   LHIYSVLGDGEIFENYYRKQRRKQARLVLQPQSSMHETVEGYRRYFSQIV   292
NP_998465.1        298   LHIYTVLGDRETFENYYRKQRKKQARLVLQPQSNMHETVEGYRKYFNQIV   347
XP_002939141.2     289   LHIYSILGDKEVFENYYRKQRRKQARLVLQPQSTMHETVEGYRKYFSQIA   338


NP_061926.3        340   GFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLV   389
XP_507926.3        340   GFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLV   389
XP_001088450.2     340   GFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLV   389
XP_534966.3        339   GFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLV   388
NP_001095355.1     339   GFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLV   388
NP_780562.2        340   GFFVVEDHILHVTQGLVTRVYTEELWNMALSKIIAVLRAHSSYCTDPDLV   389
NP_062150.2        340   GFFVVEDHILHVTQGLVTRAYTDELWNMALSKIIAVLRAHSSYCTDPDLV   389
NP_001012923.1     293   GFFVVEDHILHVTQGLVTRTYTDELWNMALSKIIAVLRTHSSYCNDPDLV   342
NP_998465.1        348   GFFVVEDHILHATQGLVTRAFTDELWNMALSKIIAVLRTHSSYCNDPDLV   397
XP_002939141.2     339   GFFVVEDHILHVTQGLVTGSYTTELWNMAQSKIIAVLRTHSSYCTDPDLV   388


NP_061926.3        390   LELKNLTVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDI   439
XP_507926.3        390   LELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDI   439
XP_001088450.2     390   LELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDI   439
XP_534966.3        389   LELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDI   438
NP_001095355.1     389   LELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGVFRDI   438
NP_780562.2        390   LELKNLIVIFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWAGIFRDI   439
NP_062150.2        390   LELKNLIVIFADTLQGYGFSVNRLFDLLFEIRDQYNETLLKKWAGIFRDI   439
NP_001012923.1     343   LELKNLIVVFADTLQGYGFPVNRLFDLLFEIRDQYNETLLKKWSGLFRDI   392
NP_998465.1        398   LELKNLIVIFADTLQGYGFPVNRLFDLLFEVRDQYNETLLKKWALVFRDI   447
XP_002939141.2     389   LELKNLIVVFADTMQGFGFPVTRLFDLLFEVRDRYNETLLKKWAGIFRTI   438


NP_061926.3        440   FEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIY   489
XP_507926.3        440   FEEDNYSPIPVVNEEEYKIVISKFPFQDPDLEKQSFPKKFPMSQSVPHIY   489
XP_001088450.2     440   FEEDNYSPIPIVNEEEYKIVISKFPFQDLDLEKQSFPKKFPMSQSVPHIY   489
XP_534966.3        439   FEEDNYSPIPIVNEEEYKAVISKFPFQDPDFEKQSFPKKFPMSQSVPHIY   488
NP_001095355.1     439   FEEDNYSPIPIVSEEEYRAIISKFPFQDPDLEKQPFPKKLPMSQSVPHIY   488
NP_780562.2        440   FEEDNYSPIPIGSEEEYKVVISRFPFQDPDLEKQSFPKKFPMSQSVPLIY   489
NP_062150.2        440   FEEDNYSPIPIGSEEEYKMVISKFPFQDPDLEKQSFPKKFPMSQSVPLIY   489
NP_001012923.1     393   FEADNYSPIPVANEEEYKIVISKFPFQDSELDKQCFPKKLPMSQSVPQIY   442
NP_998465.1        448   FEQDNYSPIPVDTEEEYKAVVSRFPFHDAEIEKQQFPKKLPMSQSVPQIY   497
XP_002939141.2     439   FEADNYSPIPIANEEEYRNVISKFPFQDAETDKKPFPKKLPVSQSVPQIY   488


NP_061926.3        490   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRK   539
XP_507926.3        490   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRK   539
XP_001088450.2     490   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRK   539
XP_534966.3        489   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRK   538
NP_001095355.1     489   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIKK   538
NP_780562.2        490   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSSCLLNLIRK   539
NP_062150.2        490   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRILSSCLLNLIRK   539
NP_001012923.1     443   IQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLQNLIKK   492
NP_998465.1        498   SQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSCLQNLIKK   547
XP_002939141.2     489   SQVKEFIYASLKFSESLHRSSTEIDDMLRKSTNLLLTRTLSSSLQNVIKK   538


NP_061926.3        540   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   589
XP_507926.3        540   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   589
XP_001088450.2     540   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   589
XP_534966.3        539   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   588
NP_001095355.1     539   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   588
NP_780562.2        540   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   589
NP_062150.2        540   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLST   589
NP_001012923.1     493   PHIGLTELVQIIINTTHLELACKYLEDFISNITNISQVTVHTARLYGLST   542
NP_998465.1        548   PHIGLTELVQIIINTTHLEHACKYLEDFITNITNVSPETVHTTRLYGLST   597
XP_002939141.2     539   PHIGLTELVQIIINTTHLEQACKYLEDFITNITNISPETVHTTRLYGLST   588


NP_061926.3        590   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINF   639
XP_507926.3        590   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINF   639
XP_001088450.2     590   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINF   639
XP_534966.3        589   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINF   638
NP_001095355.1     589   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINF   638
NP_780562.2        590   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMAESDGRASGYLMDLINF   639
NP_062150.2        590   FKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMAESDGRASGYLMDLINF   639
NP_001012923.1     543   FKDARHAAEGEIYTKLNQKIDEFIQIADYDWTMSESDGRASGYLMDLINF   592
NP_998465.1        598   FKDARHAAEGEIYTKLNQKIDEFIQLADYEWGMAESDGRASGYLMDLINF   647
XP_002939141.2     589   FKDARHSAEEEIYTKLNQKIDEFIQLADYDWTMSEPDGRASGYLMDLINF   638


NP_061926.3        640   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   689
XP_507926.3        640   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   689
XP_001088450.2     640   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   689
XP_534966.3        639   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   688
NP_001095355.1     639   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   688
NP_780562.2        640   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   689
NP_062150.2        640   LRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQ   689
NP_001012923.1     593   LRSTFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDTELKQISMGAIQQ   642
NP_998465.1        648   LRSTFQVFTHLPGKVAQTACMSACKHLATSLMQMLLDTELKQISMGAIQQ   697
XP_002939141.2     639   LRSTFQVFTNLPGKVAQTACMSACKHLSTSLTQMLLDSDLKQISMGAIQQ   688


NP_061926.3        690   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   739
XP_507926.3        690   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   739
XP_001088450.2     690   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   739
XP_534966.3        689   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   738
NP_001095355.1     689   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   738
NP_780562.2        690   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   739
NP_062150.2        690   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   739
NP_001012923.1     643   FNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLAD   692
NP_998465.1        698   FNLDVIQCE-----------------------------------------   706
XP_002939141.2     689   FNLDVIQCELFASSDPVPGFQEDTLQLAFIDLRQLLDLFMVWDWSAYLAD   738


NP_061926.3        740   YGQPASKYLRVNPNTALTLLEK----MKDTSKKNNIFAQFRKNDRDKQKL   785
XP_507926.3        740   YGQPASKYLRVNPNTALTLLEK----MKDTSKKNNIFAQFRKNDRDKQKL   785
XP_001088450.2     740   YGQPASKYLRVNPNTALTLLEK----MKDTSKKNNIFAQFRKNDRDKQKL   785
XP_534966.3        739   YGQPASKYLRVNPNTALTLLEK----MKDTSKKNNIFAQFRKNDRDKQKL   784
NP_001095355.1     739   YGQPASKYLRVNPNTALTLLEK----MKDTSKKNNIFAQFRKNDRDKQKL   784
NP_780562.2        740   YGQPASKYLRVNPHAALTLLEK----MKDTSKKNNIFAQFRKNDRDRQKL   785
NP_062150.2        740   YGQPASKYLRVNPHAALTLLEK----MKDTSKKNNIFAQFRKNDRDRQKL   785
NP_001012923.1     693   YGQATSKYLRVNPSTALTLLEKVHRGMRDSSKKNNIFAQFRKNDRDKQKL   742
NP_998465.1        707   --------------------------CE----------------------   708
XP_002939141.2     739   YGQPYSKYLRVNPSTAXYCLEK----MKDSSKKNNIFSQFRKNDRDKQKL   784


NP_061926.3        786   IETVVKQLRSLVNGMSQHM   804
XP_507926.3        786   IETVVKQLRSLVNGMSQHM   804
XP_001088450.2     786   IETVVKQLRSLVNGMSQHT   804
XP_534966.3        785   IETVVKQLRSLVNGMSQHT   803
NP_001095355.1     785   IETVVKQLRSLVNGMSQHT   803
NP_780562.2        786   IETVVRQLRGLVTGMSQHT   804
NP_062150.2        786   IETVVKQLRGLVTGMSQHM   804
NP_001012923.1     743   IETVVKQLRSLVNGMSQHT   761
NP_998465.1              -------------------
XP_002939141.2     785   IETVVKQLRSLVNGMSQHS   803


Protein Acc. Gene Organism
NP_061926.3 EXOC6 H.sapiens
XP_507926.3 EXOC6 P.troglodytes
XP_001088450.2 EXOC6 M.mulatta
XP_534966.3 EXOC6 C.lupus
NP_001095355.1 EXOC6 B.taurus
NP_780562.2 Exoc6 M.musculus
NP_062150.2 Exoc6 R.norvegicus
NP_001012923.1 EXOC6 G.gallus
NP_998465.1 exoc6 D.rerio
XP_002939141.2 exoc6 X.tropicalis


Support Center