Display Settings:

Format

Send to:

Choose Destination
HomoloGene:41306. Gene conserved in Amniota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_061932.1          1   MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL   50
XP_001153870.2       1   MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL   50
XP_001102062.1       1   MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL   50
XP_539468.3          1   MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL   50
NP_001106777.1       1   MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFKRGADPGMPEPTVL   50
NP_079670.1          1   MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFTRGADPGMPEPSVL   50
NP_001128646.1       1   MVKLSKEAKQRLQQLFKGGQFAIRWGFIPLVIYLGFTRGADPGMPEPSVL   50
NP_001186546.1       1   MPKLSKEAKQRLQQLFKGGQFAIRWGFIPVVLYLGFRRGADPGMPEPTIW   50


NP_061932.1         51   SLLWG   55
XP_001153870.2      51   SLLWG   55
XP_001102062.1      51   SLLWG   55
XP_539468.3         51   SLLWG   55
NP_001106777.1      51   SLLWG   55
NP_079670.1         51   SLLWG   55
NP_001128646.1      51   SLLWG   55
NP_001186546.1      51   SLLWG   55


Protein Acc. Gene Organism
NP_061932.1 TOMM7 H.sapiens
XP_001153870.2 TOMM7 P.troglodytes
XP_001102062.1 TOMM7 M.mulatta
XP_539468.3 TOMM7 C.lupus
NP_001106777.1 TOMM7 B.taurus
NP_079670.1 Tomm7 M.musculus
NP_001128646.1 Tomm7 R.norvegicus
NP_001186546.1 TOMM7 G.gallus


Support Center