U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:55941. Gene conserved in Bilateria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_001242941.1           --------------------------------------------------
XP_001166541.2           --------------------------------------------------
XP_001118181.2           --------------------------------------------------
XP_005620092.1       1   MSVLPGARGNEEEKEVPTGALPSPPCWFFSPQPLPAHLAWSLDNQRHNLW   50
NP_777259.1              --------------------------------------------------
NP_780469.1              --------------------------------------------------
NP_113708.1              --------------------------------------------------
NP_990805.1              --------------------------------------------------
XP_005165776.1           --------------------------------------------------
NP_523860.2          1   -------------------------MKSAWLALKSKSALHPKSEYPVSNI   25
XP_308355.3              --------------------------------------------------
NP_508504.2              --------------------------------------------------
XP_004916274.1           --------------------------------------------------


NP_001242941.1       1   --------------------MAQRTGLEDPE-RYLFVDRAVIYNPATQAD   29
XP_001166541.2       1   --------------------MAQRTGLEDPE-RYLFVDRAVIYNPATQAD   29
XP_001118181.2       1   --------------------MAQRTGLEDPE-RYLFVDRAVIYNPATQAD   29
XP_005620092.1      51   SPLKFTLDSRGNCPWILLFTMAQRTGLEDPE-RYLFVDRAVIYNPATQAD   99
NP_777259.1          1   --------------------MAQRTGLEDPE-RYLFVDRAVIYNPATQAD   29
NP_780469.1          1   --------------------MAQRTGLEDPE-RYLFVDRAVIYNPATQAD   29
NP_113708.1          1   --------------------MAQRTGLEDPE-RYLFVDRAVIYNPATQAD   29
NP_990805.1          1   --------------------MAQRSGQEDPE-RYLFVDRAVIYNPATQAD   29
XP_005165776.1       1   -----------------MPEMAQRSGQEDPE-RYLFVDRAVVYNPTTQAD   32
NP_523860.2         26   HYPKAANYRQTRNYLEIAAKMSEEVDRNDPELKYLSVERNQFNDPATQAE   75
XP_308355.3          1   ---MAEDLR----------------DRNDPELKYLSVERNSFNDPATQAE   31
NP_508504.2          1   ----------------------------MGDLQYLQVQRAAVADPATLAA   22
XP_004916274.1       1   --------------------MSRNSYRDDAE-RYLFVDRNPTSVTATQAD   29


NP_001242941.1      30   WTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKM   79
XP_001166541.2      30   WTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKM   79
XP_001118181.2      30   WTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKM   79
XP_005620092.1     100   WTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKM   149
NP_777259.1         30   WTAKKLVWIPSERHGFEAASIKEERGDEVLVELAENGKKAMVNKDDIQKM   79
NP_780469.1         30   WTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKM   79
NP_113708.1         30   WTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKM   79
NP_990805.1         30   WTAKKLVWIPSERHGFEAASIKEERGDEVLVELAENGKKALVNKDDIQKM   79
XP_005165776.1      33   WTAKKLVWVPSERHGFEAASIREERGEEVLVELAENGKKAMVNKDDIQKM   82
NP_523860.2         76   WTQKRLVWVPHENQGFVAASIKREHGDEVEVELAETGKRVMILRDDIQKM   125
XP_308355.3         32   WTQKRLVWVPHESQGFVAASIKGERGDEVEVELAETGKRVLVLKDDIQKM   81
NP_508504.2         23   WAQRKLCWVPDQNEGFLIGSIKRETNDEVLVELVDTSRQVTISRDDVQKA   72
XP_004916274.1      30   WTAKRQVWVPSEKHGFEAASIKEERGEEVIVELAENGKRVPVAKDDIQKM   79


NP_001242941.1      80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
XP_001166541.2      80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
XP_001118181.2      80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
XP_005620092.1     150   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   199
NP_777259.1         80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
NP_780469.1         80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
NP_113708.1         80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
NP_990805.1         80   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129
XP_005165776.1      83   NPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   132
NP_523860.2        126   NPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYK   175
XP_308355.3         82   NPPKFDKVEDMAELTCLNEASVLHNIKDRYYSGLIYTYSGLFCVVVNPYK   131
NP_508504.2         73   NPPKFDKIEDMSELTYLNEASVLHNLKDRYYSSLIYTYSGLFCVVINPYK   122
XP_004916274.1      80   NPPKFTKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYK   129


NP_001242941.1     130   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   179
XP_001166541.2     130   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   179
XP_001118181.2     130   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   179
XP_005620092.1     200   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   249
NP_777259.1        130   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   179
NP_780469.1        130   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   179
NP_113708.1        130   NLPIYSENIIEMYRGKKRHEKPPHIYAISESAYRCMLQDRKDQSILCTGE   179
NP_990805.1        130   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   179
XP_005165776.1     133   NLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGE   182
NP_523860.2        176   KLPIYTEKIMERYKGIKRHEVPPHVFAITDSAYRNMLGDREDQSILCTGE   225
XP_308355.3        132   KLPIYTEKIMEKYKGIKRHEVPPHVFAITDTAYRSMLQDREDQSILCTGE   181
NP_508504.2        123   KLPIYSEDLIEEFKGKKRHEMPPHIFAIADTAYRSMLQEREDQSILCTGE   172
XP_004916274.1     130   NLPIYTEQIVEMYRGKKRHEIPPHIYAISETAYRSMLQDREDQSILCTGE   179


NP_001242941.1     180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
XP_001166541.2     180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
XP_001118181.2     180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
XP_005620092.1     250   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   281
NP_777259.1        180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
NP_780469.1        180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
NP_113708.1        180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
NP_990805.1        180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   211
XP_005165776.1     183   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKDHNIP-   214
NP_523860.2        226   SGAGKTENTKKVIQFLAYVAASKPKGSGAVPHPAVLINFSVNTNKYIKVK   275
XP_308355.3        182   SGAGKTENTKKVIQYLAYVAASKPKGSVAVGVGCSLYFPWRSRNKHVQPC   231
NP_508504.2        173   SGAGKTENTKKVIQYLAHVAGATRN---------------KSLNAAAQQN   207
XP_004916274.1     180   SGAGKTENTKKVIQYLAHVASSH-----------------KGRKEHTAP-   211


NP_001242941.1     212   ----QESPKPVK--------HQ------GELERQLLQANPILESFGNAKT   243
XP_001166541.2     212   -----ESPKPVK--------HQ------GELERQLLQANPILESFGNAKT   242
XP_001118181.2     212   ----QESPKPVK--------HQSGSLLYGELERQLLQANPILESFGNAKT   249
XP_005620092.1     282   ----QESPKPVK--------HQ------GELERQLLQANPILESFGNAKT   313
NP_777259.1        212   ----------------------------GELERQLLQANPILESFGNAKT   233
NP_780469.1        212   ----------------------------GELERQLLQANPILESFGNAKT   233
NP_113708.1        212   ----------------------------GELERQLLQANPILESFGNAKT   233
NP_990805.1        212   ----PESPKPVK--------HQ------GELERQLLQANPILESFGNAKT   243
XP_005165776.1     215   ----PESPKAVK--------LQ------GELERQLLQANPILESFGNAKT   246
NP_523860.2        276   IMA-QNQNQTIEVVNGLKMVEVNSNCQEGELEQQLLQANPILEAFGNAKT   324
XP_308355.3        232   IDCWEASNSLAEGLSALR--EMRLLWGKGELEQQLLQANPILEAFGNAKT   279
NP_508504.2        208   IVQKPDVRNPI-----------------GELEHQLLQANPILEAFGNSKT   240
XP_004916274.1     212   ----SSSNTFY-----------------GELEHQLLQANPILEAFGNAKT   240


NP_001242941.1     244   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   293
XP_001166541.2     243   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   292
XP_001118181.2     250   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   299
XP_005620092.1     314   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   363
NP_777259.1        234   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   283
NP_780469.1        234   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   283
NP_113708.1        234   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   283
NP_990805.1        244   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHI   293
XP_005165776.1     247   VKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQAKDERTFHV   296
NP_523860.2        325   VKNDNSSRFGKFIRINFDASGFISGANIETYLLEKSRAIRQAKDERTFHI   374
XP_308355.3        280   VKNDNSSRFGKFIRINFDASGYISGANIETYLLEKSRAIRQAKDERTFHI   329
NP_508504.2        241   VKNDNSSRFGKFIRINFDMSGYISGANIEFYLLEKSRVLRQAQDERSFHI   290
XP_004916274.1     241   VKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHV   290


NP_001242941.1     294   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   343
XP_001166541.2     293   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   342
XP_001118181.2     300   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   349
XP_005620092.1     364   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   413
NP_777259.1        284   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   333
NP_780469.1        284   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   333
NP_113708.1        284   FYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   333
NP_990805.1        294   FYQLLAGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAM   343
XP_005165776.1     297   FYQLLAGAGEHLRSDLLLEGFNSYRFLSNGNIPIPGQQDKDNFQETMEAM   346
NP_523860.2        375   FYQLLAGATPEQREKFILDDVKSYAFLSNGSLPVPGVDDYAEFQATVKSM   424
XP_308355.3        330   FYQLLAGASPEQRERFILDDVKTYPFLSNGGLPVPGVDDYAEFQATVKSM   379
NP_508504.2        291   FYQILRGCSAKEKSEYLLEGVDNYRFLVNRGITLPNVDDVQEFHSTINSM   340
XP_004916274.1     291   FYQLLAGAGEHMKTDLLLEGFNQYRFLSNGNLPIPGQQDREIFQETMESM   340


NP_001242941.1     344   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   393
XP_001166541.2     343   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   392
XP_001118181.2     350   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   399
XP_005620092.1     414   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   463
NP_777259.1        334   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   383
NP_780469.1        334   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   383
NP_113708.1        334   HIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   383
NP_990805.1        344   HIMGFSHDEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQKLCH   393
XP_005165776.1     347   HIMSFNHEEILSMLKVVSAVLQFGNIVFKKERNTDQASMPENTAAQKLCH   396
NP_523860.2        425   NIMGMTSEDFNSIFRIVSAVLLFGSMKFRQERNNDQATLPDNTVAQKIAH   474
XP_308355.3        380   NIMGMTSEDFNSIFRIVSAVLLFGSMTFKQERNSDQATLPDNTVAQKIAH   429
NP_508504.2        341   RIMGFADDEISSIMRVVSAVLLLGNLEFTQEKKSDQAMLQDDRVIQKVCH   390
XP_004916274.1     341   KIMGFNHEEIMSMLKMVSAVLQFGNIVFRKERNTDQASMPDNTAAQKLCH   390


NP_001242941.1     394   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   443
XP_001166541.2     393   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   442
XP_001118181.2     400   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   449
XP_005620092.1     464   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   513
NP_777259.1        384   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   433
NP_780469.1        384   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   433
NP_113708.1        384   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   433
NP_990805.1        394   LLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   443
XP_005165776.1     397   LLGMNVMEFTRAILSPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLF   446
NP_523860.2        475   LLGLSVTDMTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMF   524
XP_308355.3        430   LLGLNVTDMTKAFLTPRIKVGRDFVTKAQTREQVEFAVEAIAKACYEKMF   479
NP_508504.2        391   LLGLPVIELQKAFLRPRIKVGREFVNKAQNQEQAEFAVEAIAKASYERLF   440
XP_004916274.1     391   LLGLNVTEFSRAILMPRIKVGRDYVQKAQTKEQADFAVEALAKALYERLF   440


NP_001242941.1     444   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   493
XP_001166541.2     443   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   492
XP_001118181.2     450   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   499
XP_005620092.1     514   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   563
NP_777259.1        434   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   483
NP_780469.1        434   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   483
NP_113708.1        434   RWLVHRINKALDRTKRQGTSFIGILDIAGFEIFELNSFEQLCINYTNEKL   483
NP_990805.1        444   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   493
XP_005165776.1     447   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFQLNSFEQLCINYTNEKL   496
NP_523860.2        525   KWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKL   574
XP_308355.3        480   KWLVNRINRSLDRTKRQGASFIGILDMAGFEIFELNSFEQLCINYTNEKL   529
NP_508504.2        441   KWLVTRINKSLDRTHRQGASFIGILDIAGFEIFDINSFEQICINYTNEKL   490
XP_004916274.1     441   RWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKL   490


NP_001242941.1     494   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   543
XP_001166541.2     493   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   542
XP_001118181.2     500   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   549
XP_005620092.1     564   QQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPANPPGVLA   613
NP_777259.1        484   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   533
NP_780469.1        484   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   533
NP_113708.1        484   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   533
NP_990805.1        494   QQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLA   543
XP_005165776.1     497   QQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPANPPGVLA   546
NP_523860.2        575   QQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMA   621
XP_308355.3        530   QQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTIDLIDKPG---GIMA   576
NP_508504.2        491   QQLFNNTMFILEQEEYQREGIEWDFIDFGLDLQPTIDLIEKPM---GVLA   537
XP_004916274.1     491   QQLFNHTMFVLEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLS   540


NP_001242941.1     544   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK   593
XP_001166541.2     543   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK   592
XP_001118181.2     550   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK   599
XP_005620092.1     614   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDRADFCIIHYAGK   663
NP_777259.1        534   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK   583
NP_780469.1        534   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK   583
NP_113708.1        534   LLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGK   583
NP_990805.1        544   LLDEECWFPKATDKTFVEKLVQEQGTHSKFQKPRQLKDKADFCIIHYAGK   593
XP_005165776.1     547   LLDEECWFPKATDKTFVDKLVQEQGTHGKFQKPRQLKDKADFCIIHYAGR   596
NP_523860.2        622   LLDEECWFPKATDKTFVDKLVSAHSMHPKFMKT-DFRGVADFAIVHYAGR   670
XP_308355.3        577   LLDEECWFPKATDKSFVEKLAAAHSMHPKFMKT-DFRGVADFAVVHYAGK   625
NP_508504.2        538   LLDEECLFPKANDKSFVEKLQKTHNKHPKFIVP-DMRSKSHFAVVHYAGR   586
XP_004916274.1     541   LLDEECWFPKATDKSFVEKVIQELGNHPKFQKPRQLRDKADLCIIHYAGK   590


NP_001242941.1     594   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASFYD   643
XP_001166541.2     593   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKD------------   630
XP_001118181.2     600   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKD------------   637
XP_005620092.1     664   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASFYD   713
NP_777259.1        584   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKD------------   621
NP_780469.1        584   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKD------------   621
NP_113708.1        584   VDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWKD------------   621
NP_990805.1        594   VDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELWKDEIQNIQRACFYD   643
XP_005165776.1     597   VDYKADEWLMKNMDPLNDNVATLLHQSTDKFVAELWKDEIQNFQRASFYD   646
NP_523860.2        671   VDYSAAKWLMKNMDPLNENIVSLLQGSQDPFVVNIWKD------------   708
XP_308355.3        626   VDYSATKWLMKNMDPLNENVVSLLQASQDPFVVQIWKD------------   663
NP_508504.2        587   VDYSADQWLMKNMDPLNENVVGLMQNSTDPFVAGIWKD------------   624
XP_004916274.1     591   VDYKADEWLMKNMDPLNDNVATLLHQSTDKYTAELWKDDIQNIHAVYFFD   640


NP_001242941.1     644   SVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLT   693
XP_001166541.2     631   ---------VDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLT   671
XP_001118181.2     638   ---------VDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLT   678
XP_005620092.1     714   SVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLT   763
NP_777259.1        622   ---------VDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLT   662
NP_780469.1        622   ---------VDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKESLT   662
NP_113708.1        622   ---------VDRIVGLDQVTGMTETAFGSAYKTKKGMFRNVGQLYKESLT   662
NP_990805.1        644   NITGLHDPPVDRIVGLDQVTGITETAFGSAYKTKKGMFRTVGQLYKESLT   693
XP_005165776.1     647   -VSSLHESPVDRIVGLDQVAGMNETAFGAAYKTKKGMFRTVGQLYKESLT   695
NP_523860.2        709   ----------AEIVGMAQ-QALTDTQFGA--RTRKGMFRTVSHLYKEQLA   745
XP_308355.3        664   ----------AEIVGMAQ-QALTDTQFGA--RTRKGMFRTVSHLYKEQLA   700
NP_508504.2        625   ----------AEFAGICA-AEMNETAFGM--RSRKGMFRTVSQLHKEQLT   661
XP_004916274.1     641   NYAVLPQGSVDRIVGLDQVSGMGEMSFGSSYKTKKGMFRTVGQLYKESLS   690


NP_001242941.1     694   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   743
XP_001166541.2     672   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   721
XP_001118181.2     679   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   728
XP_005620092.1     764   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   813
NP_777259.1        663   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   712
NP_780469.1        663   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   712
NP_113708.1        663   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   712
NP_990805.1        694   KLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICR   743
XP_005165776.1     696   KLMATLRNTNPNFVRCIIPNHEKRAGKLEPHLVLDQLRCNGVLEGIRICR   745
NP_523860.2        746   KLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICR   795
XP_308355.3        701   KLMDTLRNTNPNFVRCIIPNHEKRAGKIDAPLVLDQLRCNGVLEGIRICR   750
NP_508504.2        662   KLMTTLRNTSPHFVRCIIPNHEKKSGKINSNLVLEQLRCNGVLEGIRICR   711
XP_004916274.1     691   KLMSTLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICR   740


NP_001242941.1     744   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   793
XP_001166541.2     722   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   771
XP_001118181.2     729   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   778
XP_005620092.1     814   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   863
NP_777259.1        713   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   762
NP_780469.1        713   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   762
NP_113708.1        713   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   762
NP_990805.1        744   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   793
XP_005165776.1     746   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYR   795
NP_523860.2        796   QGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKKACEKMIQALELDSNLYR   845
XP_308355.3        751   QGFPNRIPFQEFRQRYELLTPNVIPKGFMDGKRACEQMIKSLELDSNLYR   800
NP_508504.2        712   QGFPNRVPFQEFRHRYEILTPDVIPKNFIDGKESVRKMITALDIDTNLYR   761
XP_004916274.1     741   QGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACAIMIRALELDPNLYR   790


NP_001242941.1     794   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   835
XP_001166541.2     772   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   813
XP_001118181.2     779   IGQSKIFFRCGQCGYMAEWQQDDVQGSIR-EESQCRNWCQGPEFFLLFFR   827
XP_005620092.1     864   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   905
NP_777259.1        763   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   804
NP_780469.1        763   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   804
NP_113708.1        763   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   804
NP_990805.1        794   IGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGY--------LARK   835
XP_005165776.1     796   IGQSKIFFRTGVLAHLEEERDLKITDIIIYFQSVCRGY--------LARK   837
NP_523860.2        846   VGQSKIFFRAGVLAHLEEERDFKISDLIVNFQAFCRGF--------LARR   887
XP_308355.3        801   IGQSKIFFRAGVLAHLEEERDYKITDLIVNFQAFCRGF--------LARR   842
NP_508504.2        762   IGQSKVFFRTGVLAHLEEERDLKLTALIMNFQAQCRGF--------LSRR   803
XP_004916274.1     791   IGQSKIFFRAGVLAHLEEERDLKITDIIVFFQAAARGY--------LARR   832


NP_001242941.1     836   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   885
XP_001166541.2     814   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   863
XP_001118181.2     828   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   877
XP_005620092.1     906   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   955
NP_777259.1        805   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   854
NP_780469.1        805   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   854
NP_113708.1        805   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   854
NP_990805.1        836   AFAKKQQQLSALKILQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEEL   885
XP_005165776.1     838   AFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQEEEM   887
NP_523860.2        888   NYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKL   937
XP_308355.3        843   NYQKRLQQLNAIRIIQRNCAAYLKLRNWQWWRLYTKVKPLLEVTKQEEKL   892
NP_508504.2        804   LYTRRQQQSSAIRIIQRNGLAYLKLRNWQWWRLFTKVKPLLQVTRTDDEI   853
XP_004916274.1     833   AFYKKQQQMSALKVVQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQDEVM   882


NP_001242941.1     886   QAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA   935
XP_001166541.2     864   QAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA   913
XP_001118181.2     878   QAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA   927
XP_005620092.1     956   QAKDEELLKVKERQTKVEGELEEMERKHQQLLEEKNILTEQLQAETELFA   1005
NP_777259.1        855   QAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA   904
NP_780469.1        855   QAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA   904
NP_113708.1        855   QAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAETELFA   904
NP_990805.1        886   QAKDEELMKVKEKQTKVEAELEEMERKHQQLLEEKNILAEQLQAETELFA   935
XP_005165776.1     888   QAKDEELIKVKERQVKVENELVEMERKHQQLLEEKNILAEQLQAETELFA   937
NP_523860.2        938   VQKEDELKQVREKLDTLAKNTQEYERKYQQALVEKTTLAEQLQAEIELCA   987
XP_308355.3        893   VQKEDELRQIRDKLENLSKNSQEYEKKYQQAMEEKTHLAEQLQAEIELCA   942
NP_508504.2        854   RAKDDELRATKERLLKMEHDFRENEKKLDQVIVERAVIQEQLQQESENSA   903
XP_004916274.1     883   QAKVVELQKVKDTQVKTESELKEMANKYQQLFEEKSILAEQLQAETELFA   932


NP_001242941.1     936   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQD   985
XP_001166541.2     914   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQD   963
XP_001118181.2     928   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQD   977
XP_005620092.1    1006   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQD   1055
NP_777259.1        905   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQD   954
NP_780469.1        905   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQD   954
NP_113708.1        905   EAEEMRARLAAKKQELEEILHDLESRVEGEEERNQILQNEKKKMQAHIQD   954
NP_990805.1        936   EAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQGHIQD   985
XP_005165776.1     938   EAEEMRARLVAKKQELEEILHDLESRVEEEEERNQSLQNEKKKMQSHIQD   987
NP_523860.2        988   EAEESRSRLMARKQELEDMMQELETRIEEEEERVLALGGEKKKLELNIQD   1037
XP_308355.3        943   EAEEGRARLVARKQELEELMQDLESRIEEEEERVNALTSEKKKLQINIQD   992
NP_508504.2        904   ELDDIRGRLQTRNQELEYIVNDMRDRLSEEEQQNEKNNDERRKQMETVRD   953
XP_004916274.1     933   EAEEMRARLASKKQELEEILHDLEARVEEEEERTLQLQNEKKKMHQHIQD   982


NP_001242941.1     986   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLM   1035
XP_001166541.2     964   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLM   1013
XP_001118181.2     978   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLM   1027
XP_005620092.1    1056   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLM   1105
NP_777259.1        955   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLM   1004
NP_780469.1        955   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLM   1004
NP_113708.1        955   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLM   1004
NP_990805.1        986   LEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFLKEKKLM   1035
XP_005165776.1     988   LEEQLDEEEAARQKLQLEKVTAEAKIKKMEEDILLLEDQNSKFLKEKKLL   1037
NP_523860.2       1038   LEEQLEEEEAARQKLQLEKVQLDAKIKKYEEDLALTDDQNQKLLKEKKLL   1087
XP_308355.3        993   LEEQLEEEEAARQKLQLEKVQLDAKLKKMEEDVALIEDQNHKLVKEKKLL   1042
NP_508504.2        954   LEEQLEQEEQARQKLLLDKTNVDQRLRNLEERLVELQDAYDKLLKEKRLL   1003
XP_004916274.1     983   LEEQLEEEEGARQKLQLEKVTTESRLKKMEEDILLLEDQNAKLAKERKLL   1032


NP_001242941.1    1036   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1085
XP_001166541.2    1014   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1063
XP_001118181.2    1028   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1077
XP_005620092.1    1106   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1155
NP_777259.1       1005   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1054
NP_780469.1       1005   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1054
NP_113708.1       1005   EDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELE   1054
NP_990805.1       1036   EDRIAECTSQLAEEEEKAKNLAKLKNKQEMMITDLEERLKKEEKTRQELE   1085
XP_005165776.1    1038   EDRVGEMTSQLAEEEEKAKNLGKVKNKQEMMMVDLEERLKKEEKTRQELE   1087
NP_523860.2       1088   EERANDLSQTLAEEEEKAKHLAKLKAKHEATISELEERLHKDQQQRQESD   1137
XP_308355.3       1043   EERANDLSQTLAEEEEKAKHLAKLKVKHESTIAELEERLLKDHQQRQEAD   1092
NP_508504.2       1004   EEKVEGLTTQLLDHEERAKHGVKAKGRLENQLHELEQDLNRERQYKSELE   1053
XP_004916274.1    1033   DDRIGEFTSTMAEEEEKVKSLNKLRNKYEAVIADLEDRLKKEEKGRQEME   1082


NP_001242941.1    1086   KAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETL   1135
XP_001166541.2    1064   KAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETL   1113
XP_001118181.2    1078   KAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETL   1127
XP_005620092.1    1156   KAKRKLDGETTDLQDQIAELQAQIDELKVQLAKKEEELQGALARGDDETL   1205
NP_777259.1       1055   KAKRKLDGETTDLQDQIAELQAQIDELKIQVAKKEEELQGALARGDDETL   1104
NP_780469.1       1055   KAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETL   1104
NP_113708.1       1055   KAKRKLDGETTDLQDQIAELQAQVDELKVQLTKKEEELQGALARGDDETL   1104
NP_990805.1       1086   KAKRKLDGETTDLQDQIAELQAQIEELKIQLAKKEEELQAALARGDEEAV   1135
XP_005165776.1    1088   KAKRKLDAETTDLQDQIAELQAQIDELKIQLAKKEEELQAVLARGDEEVA   1137
NP_523860.2       1138   RSKRKIETEVADLKEQLNERRVQVDEMQAQLAKREEELTQTLLRIDEESA   1187
XP_308355.3       1093   RSKRKIETEVADLKEQINERRMQIEEMQQQLVKREEELAQTLVRIDEESA   1142
NP_508504.2       1054   QHKRKLLAELEDSKDHLAEKMGKVEELNNQLMKRDEELQHQLTRYDEESA   1103
XP_004916274.1    1083   KMKRKLDGETTDLQDQLLELQQQIEELKQQLARKEEELQAALARVDDEVG   1132


NP_001242941.1    1136   HKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1185
XP_001166541.2    1114   HKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1163
XP_001118181.2    1128   HKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1177
XP_005620092.1    1206   HKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1255
NP_777259.1       1105   HKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1154
NP_780469.1       1105   HKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1154
NP_113708.1       1105   HKNNALKVARELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTE   1154
NP_990805.1       1136   QKNNALKVIRELQAQIAELQEDLESEKASRNKAEKQKRDLSEELEALKTE   1185
XP_005165776.1    1138   QKNNALKQLRELQAQLAELQEDLESEKAARNKAEKLKRDLSEELEALKTE   1187
NP_523860.2       1188   TKATAQKAQRELESQLAEIQEDLEAEKAARAKAEKVRRDLSEELEALKNE   1237
XP_308355.3       1143   AKAAAQKTQRELESQLAEIQEDLEAEKLARSKAEKQKRDLNEELEALKNE   1192
NP_508504.2       1104   NVTLMQKQMRDMQTTIDELREDMETERNARNKAEMTRREVVAQLEKVKGD   1153
XP_004916274.1    1133   QKNNLLKQLRDLQSQLAELHEDLESEKAARAKAEKQRRDLGEELEALKTE   1182


NP_001242941.1    1186   LEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATA   1235
XP_001166541.2    1164   LEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATA   1213
XP_001118181.2    1178   LEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQRHATA   1227
XP_005620092.1    1256   LEDTLDTTAAQQELRTKREQEVAELKKALEEETRSHEAQIQDMRQRHATA   1305
NP_777259.1       1155   LEDTLDTTAAQQELRTKREQEVAELKKALEEETKSHEAQIQDMRQRHATA   1204
NP_780469.1       1155   LEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATA   1204
NP_113708.1       1155   LEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQRHATA   1204
NP_990805.1       1186   LEDTLDTTAAQQELRTKREQEVAELKKAIEEETKNHEAQIQEIRQRHATA   1235
XP_005165776.1    1188   LEDTLDTTAAQQELRSKREQEVAELKKAIDDETRNHESQIQEMRQRHGTA   1237
NP_523860.2       1238   LLDSLDTTAAQQELRSKREQELATLKKSLEEETVNHEGVLADMRHKHSQE   1287
XP_308355.3       1193   LLDSLDTTAAQQELRSKREQEVATLKKTLEDESANHESTLMDMRHKHAQE   1242
NP_508504.2       1154   VLDKVDEATMLQDLMSRKDEEVNATKRAIEQIQHTMEGKIEEQKAKFSRQ   1203
XP_004916274.1    1183   LEDTLDSTAAQQELRAKREQEVTDLKKTIEEDVKVRDAQVTEMRQRHNQV   1232


NP_001242941.1    1236   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1285
XP_001166541.2    1214   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1263
XP_001118181.2    1228   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1277
XP_005620092.1    1306   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1355
NP_777259.1       1205   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1254
NP_780469.1       1205   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1254
NP_113708.1       1205   LEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKR   1254
NP_990805.1       1236   LEELSEQLEQAKRFKANLEKNKQGLESDNKELACEVKVLQQVKAESEHKR   1285
XP_005165776.1    1238   LEEISEQLEQAKRVKGNLEKNKQTLESDNKELTNEVKSLQQAKSESEHKR   1287
NP_523860.2       1288   LNSINDQLENLRKAKTVLEKAKGTLEAENADLATELRSVNSSRQENDRRR   1337
XP_308355.3       1243   ISSINEQLENLKKMKGGLEKSKQQLEAENADLATELRNVNQSRQENDRRR   1292
NP_508504.2       1204   VEELHDQIEQHKKQRSQLEKQQNQADQERADMAQEIALLQASRADIDKKR   1253
XP_004916274.1    1233   VEEISEQLEQARRFKGNLEKVKQTLESENTDLIKEVKNLQAAKQDSEQRR   1282


NP_001242941.1    1286   KKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGI   1335
XP_001166541.2    1264   KKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGI   1313
XP_001118181.2    1278   KKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGI   1327
XP_005620092.1    1356   KKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSSLLEEAEKKGI   1405
NP_777259.1       1255   KKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGI   1304
NP_780469.1       1255   KKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGI   1304
NP_113708.1       1255   KKLDAQVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGM   1304
NP_990805.1       1286   KKLDAQVQELTAKVTEGERLRVELAEKANKLQNELDNVSSLLEEAEKKGI   1335
XP_005165776.1    1288   KKLEAQLQEVMARFSEGEKVKGELADRTHKIQTELDNVSCLLEDAEKKGI   1337
NP_523860.2       1338   KQAESQIAELQVKLAEIERARSELQEKCTKLQQEAENITNQLEEAELKAS   1387
XP_308355.3       1293   KQAETQIAELQVKLADVDRVRVELQDKVTKLQQESENITQQLDEAELKAS   1342
NP_508504.2       1254   KIHEAHLMEIQANLAESDEHKRTLIDQLERSRDELDHLNRVREEEEHAFA   1303
XP_004916274.1    1283   KKLEQQVSEFQIRTNESEKVKFELAEKLQKLQAELDGVSGALGSTEGKSI   1332


NP_001242941.1    1336   KFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEE   1385
XP_001166541.2    1314   KFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEE   1363
XP_001118181.2    1328   KFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEE   1377
XP_005620092.1    1406   KFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEE   1455
NP_777259.1       1305   KFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEERSSLQEQQEE   1354
NP_780469.1       1305   KFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEE   1354
NP_113708.1       1305   KFAKDAAGLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEE   1354
NP_990805.1       1336   KFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNNLQEQQEE   1385
XP_005165776.1    1338   KLTKDVSSLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNNLLEQQEE   1387
NP_523860.2       1388   AAVKSASNMESQLTEAQQLLEEETRQKLGLSSKLRQIESEKEALQEQLEE   1437
XP_308355.3       1343   AAIKSAGNLESQLTEAQQLLEEETRQKLALSSKLRQIESEKEALQEQLEE   1392
NP_508504.2       1304   NMQRRLATAEGQIQELNEQIQEETRLKIANINRARQLEDEKNALLDEKEE   1353
XP_004916274.1    1333   KLTKDLSTVQSQLQDTQELLQEETRQKLNFSSRVRQLEEEKNNLMENLEE   1382


NP_001242941.1    1386   EEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEAL   1435
XP_001166541.2    1364   EEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEAL   1413
XP_001118181.2    1378   EEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEAL   1427
XP_005620092.1    1456   EEEARKNLEKQVLVLQSQLADTKKKVDDDLGTIESLEEARKKLLKDVEAL   1505
NP_777259.1       1355   EEEARRSLEKQLQALQAQLTDTKKKVDDDLGTIENLEEAKKKLLKDVEVL   1404
NP_780469.1       1355   EEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDVEAL   1404
NP_113708.1       1355   EEEARKNLEKQVLALQSQLADTKKKVDDDLGTIEGLEEAKKKLLKDVEAL   1404
NP_990805.1       1386   EEEARKNLEKQMLALQAQLAEAKKKVDDDLGTIEGLEENKKKLLKDMESL   1435
XP_005165776.1    1388   EEESRKNLEKQLATLQAQLVETKKKLEDDVGALEGLEEVKRKLQKDMEVT   1437
NP_523860.2       1438   DDEAKRNYERKLAEVTTQMQEIKKKAEEDADLAKELEEGKKRLNKDIEAL   1487
XP_308355.3       1393   DEEAKTNYEKKLAELNFTIQEMKKRSEEDSDIAKELEESKKKMNKDIETL   1442
NP_508504.2       1354   AEGLRAHLEKEIHAARQGAGEARRKAEESVN--QQLEELRKKNLRDVEHL   1401
XP_004916274.1    1383   EESAKAQLSRQLQALQQQLLESKKRMEDQGGMVEAMEEAKKKSYKELEFL   1432


NP_001242941.1    1436   SQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFD   1485
XP_001166541.2    1414   SQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFD   1463
XP_001118181.2    1428   SQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFD   1477
XP_005620092.1    1506   GQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQRQIASNLEKKQKKFD   1555
NP_777259.1       1405   SQRLEEKALAYDKLEKTKTRLQQELDDLLVDLDHQRQIVSNLEKKQKKFD   1454
NP_780469.1       1405   SQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFD   1454
NP_113708.1       1405   SQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQRQIVSNLEKKQKKFD   1454
NP_990805.1       1436   SQRLEEKAMAYDKLEKTKNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFD   1485
XP_005165776.1    1438   SQKLEEKAIAFDKLEKTKNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFD   1487
NP_523860.2       1488   ERQVKELIAQNDRLDKSKKKIQSELEDATIELEAQRTKVLELEKKQKNFD   1537
XP_308355.3       1443   QRQIQELQAANDRLDKSKKKIQSELEDATIELDTQRTKVLELEKKQKNFD   1492
NP_508504.2       1402   QKQLEESEVAKERILQSKKKIQQELEDSSMELENVRASHRDSEKRQKKFE   1451
XP_004916274.1    1433   QQRFDEKHQINDKLEKTRNRLQQELDDLMVDLDHQRQIVSNLEKKQKKFD   1482


NP_001242941.1    1486   QLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER   1535
XP_001166541.2    1464   QLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER   1513
XP_001118181.2    1478   QLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER   1527
XP_005620092.1    1556   QLLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALETKEEFER   1605
NP_777259.1       1455   QLLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALEAREEAER   1504
NP_780469.1       1455   QLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER   1504
NP_113708.1       1455   QLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER   1504
NP_990805.1       1486   QMLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALEAKEEFER   1535
XP_005165776.1    1488   QMLAEEKTISARYAEERDRAEAEAREKDTKALSMARALDEALEAKEEFER   1537
NP_523860.2       1538   KILAEEKAISEQIAQERDTAEREAREKETKVLSVSRELDEAFDKIEDLEN   1587
XP_308355.3       1493   KVLAEEKAISEQVAQERDAAEREAREKETKVLSLTRELDEAFEKIDELET   1542
NP_508504.2       1452   SQMAEERVAVQKALLDRDAMSQELRDRETRVLSLLNEVDIMKEHLEESDR   1501
XP_004916274.1    1483   QMLAEEKNISARYGEERDRAEAEAREKETKALSLSRALEEAIDLKDELDR   1532


NP_001242941.1    1536   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1585
XP_001166541.2    1514   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1563
XP_001118181.2    1528   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1577
XP_005620092.1    1606   QNKQLRADMEDLISSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1655
NP_777259.1       1505   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1554
NP_780469.1       1505   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1554
NP_113708.1       1505   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDE   1554
NP_990805.1       1536   QNKQLRADMEDLMSSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDE   1585
XP_005165776.1    1538   LNKQLRAEMEDLISSKDDVGKNVHELEKSKRTLEQQVEEMRTQLEELEDE   1587
NP_523860.2       1588   KRKTLQNELDDLANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDD   1637
XP_308355.3       1543   KRKGLQNELDELANTQGTADKNVHELEKAKRALESQLAELKAQNEELEDD   1592
NP_508504.2       1502   VRRSLQQELQDSISNKDDFGKNVHELEKAKRSLEAELNDMRVQMEELEDN   1551
XP_004916274.1    1533   QNKQLRAEMDDLVSSKDDVGKNVHELERSKRALEQQVQEMKTQIEELEDE   1582


NP_001242941.1    1586   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAE   1635
XP_001166541.2    1564   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAE   1613
XP_001118181.2    1578   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAE   1627
XP_005620092.1    1656   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLVKQVRELEAE   1705
NP_777259.1       1555   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAE   1604
NP_780469.1       1555   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAE   1604
NP_113708.1       1555   LQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAE   1604
NP_990805.1       1586   LQATEDAKLRLEVNMQAMKAQFERDLQARDEQNEEKKRMLVKQVRELEAE   1635
XP_005165776.1    1588   LQATEDAKLRLEVNMQAMKAQFDRDLQARDEQNEEKKRALVKQVREMEAE   1637
NP_523860.2       1638   LQLTEDAKLRLEVNMQALRSQFERDLLAKEEGAEEKRRGLVKQLRDLETE   1687
XP_308355.3       1593   LQLTEDAKLRLEVNMQALRAQFERDIQAKEEQSEEKRRGLVKALRDLEAE   1642
NP_508504.2       1552   LQIAEDARLRLEVTNQALKSESDRAISNKDVEAEEKRRGLLKQIRDLENE   1601
XP_004916274.1    1583   LQAIEDGKLRLEVNMQAMKAQFERDLQNRDDSNDEKKKLLFKQVREMEVE   1632


NP_001242941.1    1636   LEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1685
XP_001166541.2    1614   LEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1663
XP_001118181.2    1628   LDDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1677
XP_005620092.1    1706   LEDERKQRALAVASKKKLEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1755
NP_777259.1       1605   LEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1654
NP_780469.1       1605   LEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1654
NP_113708.1       1605   LEDERKQRALAVASKKKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQM   1654
NP_990805.1       1636   LEDERKQRALAVAAKKKMEMDLKDLEGQIEAANKARDEAIKQLRKLQAQM   1685
XP_005165776.1    1638   LEDERKQRALAVAAKKKLEMDLKDVEAQIEAANKARDEAIKQLRKLQAQM   1687
NP_523860.2       1688   LDEERKQRTAAVASKKKLEGDLKEIETTMEMHNKVKEDALKHAKKLQAQV   1737
XP_308355.3       1643   LDEERKQRAAAVAAKKKLEGDLKDMEATLEMNNKVKEDALKQAKKLQAQI   1692
NP_508504.2       1602   LENEKRGKSGAVSHRKKIENQIGELEQQLEVANRLKEEYNKQLKKNQQII   1651
XP_004916274.1    1633   LEEERKQKSQILVAKKKLEMDLQDMESQMDSANKGRDEAVKQLKKLQLQF   1682


NP_001242941.1    1686   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1735
XP_001166541.2    1664   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1713
XP_001118181.2    1678   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1727
XP_005620092.1    1756   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1805
NP_777259.1       1655   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1704
NP_780469.1       1655   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1704
NP_113708.1       1655   KDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARR   1704
NP_990805.1       1686   KDYQRELEEARASRDEIFAQSKESEKKLKGLEAEILQLQEEFAASERARR   1735
XP_005165776.1    1688   KDYQRELEEARTSRDEIFTQSKENEKKLKSLEAEILQLQEDLASSERARR   1737
NP_523860.2       1738   KDALRDAEEAKAAKEELQALSKEAERKVKALEAEVLQLTEDLASSERARR   1787
XP_308355.3       1693   KDAIRDAEEAKAAKEELAAISKESERKVKTLEADLMQLTEDLSSSERARR   1742
NP_508504.2       1652   KEYQIECEEARQAKEDIAALLREADRKFRAVEAEREQLREANEGLMQARK   1701
XP_004916274.1    1683   KEVWREVEETRAARDEIFVQSRDNEKKLKSLEAELLQLQEDLAAAERAKR   1732


NP_001242941.1    1736   HAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1785
XP_001166541.2    1714   HAEQERDELADEITNSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1763
XP_001118181.2    1728   HAEQERDELADEIANSTSGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1777
XP_005620092.1    1806   HAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1855
NP_777259.1       1705   HAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1754
NP_780469.1       1705   HAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1754
NP_113708.1       1705   HAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1754
NP_990805.1       1736   HAEQERDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMEL   1785
XP_005165776.1    1738   HAEQERDELADEISNSASGKAALLDEKRRLEARIAQLEEELEEEQSNMEL   1787
NP_523860.2       1788   AAETERDELAEEIANNANKGSLMIDEKRRLEARIATLEEELEEEQSNSEV   1837
XP_308355.3       1743   AAEGERDELLEEINSNSSKGSLMIDEKRRLEARIAALEEELEEEQSNLEL   1792
NP_508504.2       1702   QLELENDELEEL---RAKGGGISSEEKRRLEAKIAQLEEELEEEQSNCEL   1748
XP_004916274.1    1733   QAQQERDDLADELSNGVSGKSALLDEKRALEMRISQLEEELDEEQSNTEL   1782


NP_001242941.1    1786   LNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1835
XP_001166541.2    1764   LNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1813
XP_001118181.2    1778   LNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1827
XP_005620092.1    1856   LNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1905
NP_777259.1       1755   LNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1804
NP_780469.1       1755   LNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1804
NP_113708.1       1755   LNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAKLQEL   1804
NP_990805.1       1786   LNERFRKTTLQVDTLNSELAGERSAAQKSENARQQLERQNKELKAKLQEL   1835
XP_005165776.1    1788   LNDRFRKTTMQVDTLNTELAGERSAAQKSENARQQLERQNKDLKSKLQEL   1837
NP_523860.2       1838   LLDRSRKAQLQIEQLTTELANEKSNSQKNENGRALLERQNKELKAKLAEI   1887
XP_308355.3       1793   MVDRNRKAQLTIEQLTTELATEKSNSQNNETLKCGLERLNKELKAKLSEQ   1842
NP_508504.2       1749   AIDKQRKAQVQLEQITTDLSMERTLNQKTEAEKQSLERSNRDYKAKITEL   1798
XP_004916274.1    1783   INDRYRKLTLQVETITTELSAERSFSQKAENARQQMERQNKELKVKLNEM   1832


NP_001242941.1    1836   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1885
XP_001166541.2    1814   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1863
XP_001118181.2    1828   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1877
XP_005620092.1    1906   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1955
NP_777259.1       1805   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1854
NP_780469.1       1805   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1854
NP_113708.1       1805   EGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEI   1854
NP_990805.1       1836   EGSVKSKFKATISTLEAKIAQLEEQLEQEAKERAAANKLVRRTEKKLKEV   1885
XP_005165776.1    1838   EGSVKSKFKASIAALEAKILQLEEQLEQEAKERAAANKIVRRTEKKLKEV   1887
NP_523860.2       1888   ETAQRTKVKATIATLEAKIANLEEQLENEGKERLLQQKANRKMDKKIKEL   1937
XP_308355.3       1843   ETALRTKLKAATAASEAKNLNLEKQLENETKERLAVQKANRKLEKRIKEL   1892
NP_508504.2       1799   ESGAQSRARAQMAALEAKVQYLEDQLNVEGQEKTAANRAARRLEKRLNDT   1848
XP_004916274.1    1833   DSTMRSKYKITIASLEAKISQLEEQMEQESKERIIANKLVRRAEKRLKEV   1882


NP_001242941.1    1886   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1935
XP_001166541.2    1864   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1913
XP_001118181.2    1878   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1927
XP_005620092.1    1956   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   2005
NP_777259.1       1855   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1904
NP_780469.1       1855   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1904
NP_113708.1       1855   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1904
NP_990805.1       1886   FMQVEDERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQ   1935
XP_005165776.1    1888   FMQVEDERRHADQYKEQMEKANSRMKQLKRQLEEAEEEATRANASRRKLQ   1937
NP_523860.2       1938   TMNIEDERRHVDQHKEQMDKLNSRIKLLKRNLDETEEELQKEKTQKRKYQ   1987
XP_308355.3       1893   TMNIEDERRHADQYKEQIEKANNRMKTLKRNLDEAEEEIQKEKTLKRKAQ   1942
NP_508504.2       1849   TQQFEDEKRANEQAKELLEKSNLKNRNLRRQLDEAEDEMSRERTKHRNVQ   1898
XP_004916274.1    1883   LLQVEEERRNADQFKEQLEKANIRMKQLKRQLEEAEEEASRANSNRRRLQ   1932


NP_001242941.1    1936   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   1976
XP_001166541.2    1914   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   1954
XP_001118181.2    1928   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   1968
XP_005620092.1    2006   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   2046
NP_777259.1       1905   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   1945
NP_780469.1       1905   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   1945
NP_113708.1       1905   RELDDATEANEGLSREVSTLKNRL-------RRGGPIS-FSSSR-SGRRQ   1945
NP_990805.1       1936   RELDDATEANEGLSREVSTLKNRL-------RRGGPIT-FSSSR-SGRRQ   1976
XP_005165776.1    1938   RELDDATEASEGLSREVNTLKNRL-------RRGGPVS-FSSSR-SGRRQ   1978
NP_523860.2       1988   RECEDMIESQEAMNREINSLKTKL-------RRTGGIG-LSSSRLTGTPS   2029
XP_308355.3       1943   RECEDMLESHEALSREVNALKSKL-------RRGGAMGSLSSTRLT----   1981
NP_508504.2       1899   READDLLDANEQLTRELMNLRGNN-------RRRADMR--------LRRG   1933
XP_004916274.1    1933   RELEDVTESAESMNREVTTLRSRLSKLERQQRKRAPIQ-F-TTR-TIRQV   1979


NP_001242941.1    1977   LHLEGASLELSDDDTESKTSDVNETQPPQSE   2007
XP_001166541.2    1955   LHLEGASLELSDDDTESKTSDVNETQPPQSE   1985
XP_001118181.2    1969   LHIEGASLELSDDDTESKTSDVNETQPPQSE   1999
XP_005620092.1    2047   LHIEGASLELSDDDTESKTSDVNETQPPQSE   2077
NP_777259.1       1946   LHIEGASLELSDDDTESKTSDINETQPPQSE   1976
NP_780469.1       1946   LHIEGASLELSDDDTESKTSDVNDTQPPQSE   1976
NP_113708.1       1946   LHIEGASLELSDDDTESKTSDVNETQPPQSE   1976
NP_990805.1       1977   LHIEGASLELSDDDAESKGSDVNEAQPTPAE   2007
XP_005165776.1    1979   LQMEG---DFSDDDADSKASDLNENQPPPAE   2006
NP_523860.2       2030   SKRAGGGGGGDDSSVQDESLDGEDSAN----   2056
XP_308355.3       1982   PKRE-----NDSISVQDESLDGEDNSN----   2003
NP_508504.2       1934   FDVPGSSDNLAREEENESNVSGSEHGMSVN-   1963
XP_004916274.1    1980   YQLEAVSDEEPESHSGEPSANHQQQQPPQAE   2010


Protein Acc. Gene Organism
NP_001242941.1 MYH10 H.sapiens
XP_001166541.2 MYH10 P.troglodytes
XP_001118181.2 MYH10 M.mulatta
XP_005620092.1 MYH10 C.lupus
NP_777259.1 MYH10 B.taurus
NP_780469.1 Myh10 M.musculus
NP_113708.1 Myh10 R.norvegicus
NP_990805.1 MYH10 G.gallus
XP_005165776.1 myh10 D.rerio
NP_523860.2 zip D.melanogaster
XP_308355.3 AgaP_AGAP007523 A.gambiae
NP_508504.2 nmy-1 C.elegans
XP_004916274.1 LOC100493774 X.tropicalis


Support Center