Display Settings:

Format

Send to:

Choose Destination
HomoloGene:68248. Gene conserved in Boreoeutheria Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_002273.3          1   MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGF   50
XP_003313733.1       1   MTCGFNSIGCGFRPGNFSCVSACGPRPTRCCITAAPYRGISCYRGLTGGF   50
XP_001093322.1       1   MTCGFISMGCGFRPGNFSCVSACGPRPGRCCITAAPYRGVSCYRGLSGGF   50
NP_001076854.1       1   MTCGFSTVGSGFGSRAFSCVSACGPRPGRCCITAAPYRGISCYRGLTGGF   50
NP_001188252.1       1   MTCG-------FRTGNFSCASACGPRPGRCCISAAPYRGISCYRGLSGGF   43
NP_001008813.1       1   MTCG-------FQTGNFGCASACGPRPGRCCITAAPYRGISCYRGLSGGF   43


NP_002273.3         51   GSHSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEI   100
XP_003313733.1      51   GSHSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEI   100
XP_001093322.1      51   GSHSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEI   100
NP_001076854.1      51   GSRSVCGGFRAGYCSRSFGYRSGGVGGLSPPCITTVSVNESLLTPLNLEI   100
NP_001188252.1      44   GSQSVCGAFRSGSCGRSFGYRSGGICGPSPPCITTVSVNESLLTPLNLEI   93
NP_001008813.1      44   GSRSVCGAFRSGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEI   93


NP_002273.3        101   DPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRE   150
XP_003313733.1     101   DPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRE   150
XP_001093322.1     101   DPNAQCVKQEEKEQIKCLNSRFAAFIDKVRFLEQQNKLLETKLQFFQNRE   150
NP_001076854.1     101   DPNAQCVKQEEKEQIKCLNNRFAAFIDKVRFLEQQNKLLETKLQFYQNRQ   150
NP_001188252.1      94   DPNAQCVKHEEKEQIKCLNSRFAAFIDKVRFLEQQNKLLETKWQFYQNRK   143
NP_001008813.1      94   DPNAQCVKHEEKEQIKCLNSRFAAFIDKVRFLEQQNKLLETKWQFFQNRK   143


NP_002273.3        151   CCQSNLEPLFAGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYE   200
XP_003313733.1     151   CCQSNLEPLFAGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYE   200
XP_001093322.1     151   CCQSNLEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYE   200
NP_001076854.1     151   CCESNLEPLFEGYIETLRREAECVEADSGRLSSELNHVQEVLEGYKKKYE   200
NP_001188252.1     144   CCESNMEPLFEGYIETLRREAECVEADSGRLAAELNHAQESMEGYKKRYE   193
NP_001008813.1     144   CCESNVEPLFEGYIETLRREAECVEADSGRLAAELNHAQEAMEGYKKRYE   193


NP_002273.3        201   EEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE   250
XP_003313733.1     201   EEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE   250
XP_001093322.1     201   EEVTLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE   250
NP_001076854.1     201   EEVALRATAENEFVALKKDVDCAYIRKSDLEANSEALIQEIDFLRRLYEE   250
NP_001188252.1     194   EEVALRATAENEFVALKKDVDCAYLRKSDLEANAEALTQETDFLRRMYDE   243
NP_001008813.1     194   EEVALRATAENEFVALKKDVDCAYLRKSDLEANAEALTQEIDFLRRLYEE   243


NP_002273.3        251   EIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES   300
XP_003313733.1     251   EIRVLQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES   300
XP_001093322.1     251   EIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIVTRSRAEAES   300
NP_001076854.1     251   EIRVLQANISDTSVIVKMDNSRGLNMDNIVAEIKAQYDDIASRSRAEAES   300
NP_001188252.1     244   ETRILHSHISDTSVIVKMDNSRDLNMDCVVAEIKAQYDDIASRSRAEAES   293
NP_001008813.1     244   ETRILHAHISDTSVIVKMDNSRDLNMDCVIAEIKAQYDDIASRSRAEAES   293


NP_002273.3        301   WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSK   350
XP_003313733.1     301   WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSK   350
XP_001093322.1     301   WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSK   350
NP_001076854.1     301   WYRSKCEEIKATVIRHGETLRRTKEEINELNRLIQRLTAEVENAKCQNSK   350
NP_001188252.1     294   WYRTKCEEMKATVIRHGETLRRTREEINELNRMIQRLTAEIENAKCQNTK   343
NP_001008813.1     294   WYRTKCEEIKATVIRHGETLRRTREEINELNRIIQRLTAEIENAKCQNTK   343


NP_002273.3        351   LEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNS   400
XP_003313733.1     351   LEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNS   400
XP_001093322.1     351   LEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNS   400
NP_001076854.1     351   LEAAVTQAEQQGEVALNDARCKLAGLEEALQKAKQDMACLLKEYQEVMNS   400
NP_001188252.1     344   LEAAVTQSEQQGEAALADARCKLAELEGALQKAKQDMACLLKEYQEVMNS   393
NP_001008813.1     344   LEAAVTQSEQQGEAALTDARCKLAELEAALQKAKQDMACLLKEYQEVMNS   393


NP_002273.3        401   KLGLDIEIATYRRLLEGEEQRLCEGVEAVNVCVSSS--------------   436
XP_003313733.1     401   KLGLDIEIATYRRLLEGEEQRLCEGVEAVNVCVSSS--------------   436
XP_001093322.1     401   KLGLDIEIATYRRLLEGEEQRLCEGVEAVNVCVSSS--------------   436
NP_001076854.1     401   KLGLDIEIATYRRLLEGEEQRLCEGVGAVNVCVSSS--------------   436
NP_001188252.1     394   KLGLDVEIITYRRLLEGEEQRLCEGVGAVNVCVSSS--------------   429
NP_001008813.1     394   KLGLDIEIATYRRLLEGEEQRLCEGVGAVNVCFLAPKRRLLYTTYKLKTE   443


NP_002273.3        437   -------RGGV----------------VCGDLCV----------------   447
XP_003313733.1     437   -------RGGV----------------VCGDLCV----------------   447
XP_001093322.1     437   -------RGGV----------------VCGDLCV----------------   447
NP_001076854.1     437   -------RGGV----------------VCGDLCV----------------   447
NP_001188252.1     430   -------RGGV----------------VCGDLCV----------------   440
NP_001008813.1     444   AFCAIPQRAGVNKRTKGRCQQLPWWSCVRGPLCVWFKACDRQCLQCPMQR   493


NP_002273.3        448   ---SGSRPVTG------------SVCSAPCNGNLVVSTG---LCKPCGQL   479
XP_003313733.1     448   ---SGSRPVTG------------SVCSAPCNGNLVVSTG---LCKPCGQL   479
XP_001093322.1     448   ---SGSRPVTG------------SVCSAPCNGNLVVSTG---LCKPCGQL   479
NP_001076854.1     448   ---SGSRPVTG------------SVCSAPCSGNLAVSTG---LCAPCGQL   479
NP_001188252.1     441   ---SGSRPVTG------------SVCSAPCSGNVAVSTG---LCAPCG--   470
NP_001008813.1     494   ECGSEHRPVCTLWKWPLSPGEVLGVKREPSSLAYKADLGGLKVCCPSS--   541


NP_002273.3        480   NTTCGGGSCGQGRH-   493
XP_003313733.1     480   NTTCGGGSCGQGRY-   493
XP_001093322.1     480   NTTCGGGSCSQGRC-   493
NP_001076854.1     480   NTTCGGGSCSLGRC-   493
NP_001188252.1     471   -----SGPCHPGRC-   479
NP_001008813.1     542   -VAAPPATCWQGACC   555


Protein Acc. Gene Organism
NP_002273.3 KRT83 H.sapiens
XP_003313733.1 KRT83 P.troglodytes
XP_001093322.1 KRT83 M.mulatta
NP_001076854.1 KRT83 B.taurus
NP_001188252.1 5430421N21Rik M.musculus
NP_001008813.1 Kb23 R.norvegicus


Support Center