U.S. flag

An official website of the United States government

Display Settings:

Format

Send to:

Choose Destination
HomoloGene:7751. Gene conserved in Amniota Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_061984.2          1   ------MAISGVPVLGFFI---------------IAVLMSAQESWAIKEE   29
NP_001127811.1       1   ------MAVSGVPVLGFFI---------------IAVLMSAQESWAIKEE   29
NP_001127770.1       1   ------MAISGVPVLGFFI---------------IAVLMSAQESWAIKEE   29
NP_001011723.1       1   ------MTISGVPVLGFFI---------------MAFLMGPQESWAVKEE   29
NP_001012695.1       1   ------MAITRVPILGLFI----------------TVLIGLQESWAIKEN   28
XP_003688998.1       1   MILLVIWGLISDALLSPWHDRTISSQEDDGPLCCVTMLKIHQGTNSAPEE   50
NP_001008847.1       1   ------MATLGDLVIRFFF---------------MAVLMSPQKSWAIREE   29
NP_001231990.1       1   ------MAVLSGAAVPLLL---------------LGVLGGVG---AVLKP   26


NP_061984.2         30   HVIIQAEFYLN---PDQS-GEFMFDFDGDEIFHVDMAKKETVWRLEEFGR   75
NP_001127811.1      30   HVIIQAEFYLN---PDQS-GEFMFDFDGDEIFHVDMAKKETVWRLEEFGR   75
NP_001127770.1      30   HVIIQAEFYLN---PDQS-GEFMFDFDGDEIFHVDMAKKETVWRLEEFGR   75
NP_001011723.1      30   HVIIQAEFYLT---PDPS-GEFMFDFDGDEIFHVDMEKKETVWRLEEFGR   75
NP_001012695.1      29   HVIIQAEFYLK---PEES-AEFMFDFDGDEIFHVDMGKKETVWRLPEFGH   74
XP_003688998.1      51   HTIIQAEFYLL---PDKR-GEFMFDFDGDEIFHVDIEKSETIWRLEEFAK   96
NP_001008847.1      30   HTIIQAEFYLS---PDQN-GEFMFDFDGDEIFHVDIKKSETIWRLEEFAQ   75
NP_001231990.1      27   HVLLQAEFYQRSEGPDKAWAQFGFHFDADELFHVELDAAQTVWRLPEFGR   76


NP_061984.2         76   FASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELR   125
NP_001127811.1      76   FASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELR   125
NP_001127770.1      76   FASFEAQGALANIAVDKANLEIMTKRSNNTPITNVPPEVTVLTNSPVELG   125
NP_001011723.1      76   FASFEAQGALANIAVDKANLDTMIKRSNHTPNTNVPPEVTVLSNTPVELG   125
NP_001012695.1      75   FASFEAQGALANMAVMKANLDIMIKRSNNTPNTNVPPEVTLLPNKPVELG   124
XP_003688998.1      97   FASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLG   146
NP_001008847.1      76   FASFEAQGALANIAVDKANLDIMIKRSNNTPDANVIPEVTVLPKSPVNLG   125
NP_001231990.1      77   FASFEAQGALQNMAVGKQNLEVMIGNSNRSQQDFVTPELALFPAEAVSLE   126


NP_061984.2        126   EPNVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHY   175
NP_001127811.1     126   EPNILICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHY   175
NP_001127770.1     126   EPNVLICFIDKFSPPVVKVTWLKNGKPVTTGVSETVFLPREDHLFRKFHY   175
NP_001011723.1     126   EPNILICFIDKFSPPVINVTWLRNGNPVTTGVSETIFLPREDHLFRKFHY   175
NP_001012695.1     125   EPNTLICFIDKFSPPVISVTWLRNGKPVTDGVSQTVFLPRNDHLFRKFHY   174
XP_003688998.1     147   EPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHF   196
NP_001008847.1     126   EPNILICFIDKFSPPAVNVTWLRNGQPVTKGVSETVFLPREDHLFRKFHY   175
NP_001231990.1     127   EPNVLICYADKFWPPVATMEWRRSGAVVSEGVYDSVYYGRPDLLFRKFSY   176


NP_061984.2        176   LPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLT   225
NP_001127811.1     176   LPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLT   225
NP_001127770.1     176   LPFLPSTEDIYDCKVEHWGLDAPLLKHWEFDAPSPLPETTENVVCALGLI   225
NP_001011723.1     176   LPFLPSAEDVYDCKVEHWGLDEPLLKHWEFEPPTPLPETTENVVCALGLI   225
NP_001012695.1     175   LPFLPTTEDVYDCKVEHLGLNEPLLKHWEYEAPAPLPETTENAVCALGLI   224
XP_003688998.1     197   LTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVVCALGLF   246
NP_001008847.1     176   LTFLPSTEDYYDCEVDHWGLEEPLRKHWEFEEKTLLPETKENVLCVLGLF   225
NP_001231990.1     177   LPFVPQRGDVYSCAVRHWGAEGPVQRMWDPEVPEPPSESSATLWCAVGLA   226


NP_061984.2        226   VGLVGIIIGTIFIIKGLRKSNAAERR-GPL   254
NP_001127811.1     226   VGLVGIIIGTIFIIKGVRKSNAAERR-GPL   254
NP_001127770.1     226   VGLVGIIVGTVFIIKGVRKSNAAERR-GPL   254
NP_001011723.1     226   VGLVGIITGTIFIIKGMRKVKAGERR-GPL   254
NP_001012695.1     225   VALVGIIAGTIFIIKGVRKANTVERR-GPL   253
XP_003688998.1     247   VGLVGIVVGIILIMKGIKKRNVVERRQGAL   276
NP_001008847.1     226   VGLVGIVVGIVLIIKGLRKRNAVERRQGAL   255
NP_001231990.1     227   VGIAGIAAGTALILRAVRR-NAANRQPGLL   255


Protein Acc. Gene Organism
NP_061984.2 HLA-DRA H.sapiens
NP_001127811.1 PATR-DRA P.troglodytes
NP_001127770.1 MAMU-DRA M.mulatta
NP_001011723.1 DLA-DRA C.lupus
NP_001012695.1 BOLA-DRA B.taurus
XP_003688998.1 H2-Ea-ps M.musculus
NP_001008847.1 RT1-Da R.norvegicus
NP_001231990.1 BLA G.gallus


Support Center