Display Settings:

Format

Send to:

Choose Destination
HomoloGene:84591. Gene conserved in Euteleostomi Download , Links

Multiple Sequence Alignment
Generated by MUSCLE [see reference] version 3.6 (using option: -maxiters 2).

NP_898829.1          1   MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNS   50
XP_001148504.1       1   MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNS   50
XP_001092480.1       1   ----------------MTMETVESQHDGSITASLTESKSAHMQTQTGQNS   34
NP_001003221.1       1   ----------------MTMDTMESQQDGSVTDSVAENESAHMQNQTGQNS   34
NP_001029882.2       1   MSKCGRKKYMKTNLRQMTMETIDSQQDGSLPDSVAESESAHMQTQTGQNS   50
NP_001258435.1       1   MSKCGRKKYMRTNVRQMTMETVESQQDRSVTRSVAEHSSAHM--QTGQIS   48
NP_001104330.1       1   MSKCGRKKYMRTNVRQMTMETVESQQDRSVTHSVAEHSSAHM--QTGQIS   48
NP_001265061.1       1   MTKCA-KKHDKTAGRRMTMEMVESQQDDNAVDSMSDRDAVHNRSQPDKRE   49
XP_683024.3          1   ----------------METATVAQQE-----ASATEKATSQVNEGVSVVS   29


NP_898829.1         51   IPALAQ--------------------------------------------   56
XP_001148504.1      51   IPALAQ--------------------------------------------   56
XP_001092480.1      35   IPALAQVSVAGSGTGRGSPAVILVQLPLGQTIHVQGVIQTPQPSVIQSPQ   84
NP_001003221.1      35   IPTLTQVSVAGSGTGRGSPAVTLVQLPSGQTVHVQGIIQTPQPSVIQSPQ   84
NP_001029882.2      51   IPTLAQVSVAGSSTGRGSPAVTLVQLPSGQTVHVQGVIQTPQPSVIQSPQ   100
NP_001258435.1      49   VPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQ   98
NP_001104330.1      49   VPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQ   98
NP_001265061.1      50   ISSVSQ--------------------------------------------   55
XP_683024.3         30   LPN-------------------------GQTLQLQGVIQTTQPSVIQSPQ   54


NP_898829.1         57   ----------VAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS   96
XP_001148504.1      57   ----------VAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS   96
XP_001092480.1      85   IHTVQLNFLPVATIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS   134
NP_001003221.1      85   IQTVQ-----VATIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS   129
NP_001029882.2     101   IQTVQ-----VATIAETDESAESEGVIDSHKRREILSRRPSYRKILNELS   145
NP_001258435.1      99   IQTVQ-----VATIAETDDSADSE-VIDSHKRREILSRRPSYRKILNELS   142
NP_001104330.1      99   IQTVQ-----VATIAETDDSADSE-VIDSHKRREILSRRPSYRKILNELS   142
NP_001265061.1      56   ----------VASIA--DDSAESEEITDTQKRREILSRRPSYRKILNELS   93
XP_683024.3         55   IQTVQ-----VAA----DTAGAGTTPSDPQKRREILSRRPSYRKIFNELS   95


NP_898829.1         97   SDVPGVPKIEEERSEEEGTPP--SIATMAVPTSIYQTSTGQYIAIAQGGT   144
XP_001148504.1      97   SDVPGVPKIEEERSEEEGTPP--SIATMAVPTSIYQTSTGQYIAIAQGGT   144
XP_001092480.1     135   SDVPGVPKIEEEKSEEEGTPP--NIATMAVPTSIYQTSTGQYIAIAQGGT   182
NP_001003221.1     130   SDVPGVPKIEEEKSEEEGTPP--NIATMAVPTSIYQTSTGQYIAIAQGGT   177
NP_001029882.2     146   SDVPGVPKIEEEKSEEEGTPP--NIAAMAVPTSIYQTSTGQYIAIAQGGT   193
NP_001258435.1     143   SDVPGIPKIEEEKSEEEGTPP--NIATMAVPTSIYQTSTGQYIAIAQGGT   190
NP_001104330.1     143   SDVPGIPKIEEEKSEEEGTPP--NIATMAVPTSIYQTSTGQYIAIAQGGT   190
NP_001265061.1      94   SDTPAIPRIEEEKSEEEGA----GISPLSMPSSLYHSSTGQFIAITPGGT   139
XP_683024.3         96   SDARVVPKIDEEEKVEEEAPPTSSVAMVTTPSSIYQTSSGQYIAITQGGA   145


NP_898829.1        145   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   194
XP_001148504.1     145   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   194
XP_001092480.1     183   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   232
NP_001003221.1     178   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   227
NP_001029882.2     194   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   243
NP_001258435.1     191   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   240
NP_001104330.1     191   IQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGS   240
NP_001265061.1     140   IQISSPPSDGAQGLQTLTMTNSGTPQPGATIVQYTAQSSDGTQQFFVPGS   189
XP_683024.3        146   IQLAGPGGEALQGVQALTLPSPATPQPGATILQYGAQPGDHGQQLLLTAG   195


NP_898829.1        195   QVVVQ------------AATGDMPTYQIRAPTAALPQGVVMAASPGSLHS   232
XP_001148504.1     195   QVVVP------------AATGDMPTYQIRAPTAALPQGVVMAASPGSLHS   232
XP_001092480.1     233   QVVVQ------------AATGDMPTYQIRAPTAALPQGVVMAASPGSLHS   270
NP_001003221.1     228   QVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHS   277
NP_001029882.2     244   QVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHS   293
NP_001258435.1     241   QVVVQ------------AATGDMPTYQIRAPTTALPQGVVMAASPGSLHS   278
NP_001104330.1     241   QVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHS   290
NP_001265061.1     190   QLVVQ------------AATGDMPSYQLRTPTTNLPQGVVMAASPGALHS   227
XP_683024.3        196   QVLVQ------------AATGDMPAYQIRSPSSGLPPGVVMASSPGAMHS   233


NP_898829.1        233   PQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKT   282
XP_001148504.1     233   PQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKK   282
XP_001092480.1     271   PQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKT   320
NP_001003221.1     278   PQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKT   327
NP_001029882.2     294   PQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKK   343
NP_001258435.1     279   PQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKT   328
NP_001104330.1     291   PQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKT   340
NP_001265061.1     228   PQQLAEEATRKRELRLMKNREAAKECRRRKKEYIKCLESRVAVLEVQNQK   277
XP_683024.3        234   PQPNAEEATRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKT   283


NP_898829.1        283   LIEELKALKDLYCHKVE-   299
XP_001148504.1     283   LIEELETLKDICSPKTDY   300
XP_001092480.1     321   LIEELKALKDLYCHKVE-   337
NP_001003221.1     328   LIEELKALKDLYCHKAE-   344
NP_001029882.2     344   LIEELETLKDICSPKTD-   360
NP_001258435.1     329   LIEELKALKDLYCHKAE-   345
NP_001104330.1     341   LIEELKALKDLYCHKAE-   357
NP_001265061.1     278   LIEELETLKDICSSKTD-   294
XP_683024.3        284   LIEELKALKDIYCHKPE-   300


Protein Acc. Gene Organism
NP_898829.1 CREM H.sapiens
XP_001148504.1 CREM P.troglodytes
XP_001092480.1 CREM M.mulatta
NP_001003221.1 CREM C.lupus
NP_001029882.2 CREM B.taurus
NP_001258435.1 Crem M.musculus
NP_001104330.1 Crem R.norvegicus
NP_001265061.1 CREM G.gallus
XP_683024.3 crema D.rerio


Support Center