2BWJ,3ADK


Conserved Protein Domain Family
aden_kin_iso1

?
TIGR01360: aden_kin_iso1 
Click on image for an interactive view with Cn3D
adenylate kinase, isozyme 1 subfamily
Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Statistics
?
PSSM-Id: 130427
View PSSM: TIGR01360
Aligned: 6 rows
Threshold Bit Score: 344.877
Threshold Setting Gi: 13873330
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BWJ_A        10 RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLG 89
gi 125149      7 KHHKIIFVVGGPGSGKGTQCEKIVHKYGYTHLSTGDLLRAEVSSGSERGKKLQAIMEKGELVPLDTVLDMLRDAMLAKAD 86
gi 13873330    2 ADIPIIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKG 81
gi 257051028 374 RKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLG 453
gi 20455034   18 AGVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIE 97
3ADK_A         7 KKSKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSARGKMLSEIMEKGQLVPLETVLDMLRDAMVAKVD 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2BWJ_A        90 D-TRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQMSRSSL--PVDDTTKTIAKRLEAYYRASIPVIA 166
gi 125149     87 T-SKGFLIDGYPREVKQGEEFEKKIAPPTLLLYVDAGKETMVKRLLKRGETSG--RVDDNEETIKKRLETYYKATEPVIA 163
gi 13873330   82 S-SKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAvkRDDDNEKTIRARLLTFKQNTNAILE 160
gi 257051028 454 D-TRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSL--PVDDTTKTIAKRLEAYYRASIPVIA 530
gi 20455034   98 KgSKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHRAQTSG--RADDNADTIKKRLHTFVTSTAPVVD 175
3ADK_A        87 T-SKGFLIDGYPREVKQGEEFERKIGQPTLLLYVDAGPETMTKRLLKRGETSG--RVDDNEETIKKRLETYYKATEPVIA 163
                        170       180       190
                 ....*....|....*....|....*....|.
2BWJ_A       167 YYETKTQLHKINAEGTPEDVFLQLCTAIDSI 197
gi 125149    164 FYKGRGIVRQLNAEGTVDEVFQQVCSYLDKL 194
gi 13873330  161 LYEP--KTLTINAERDVDDIFLEVVQAIDCV 189
gi 257051028 531 YYETKTQLHKINAEGTPEDVFLQLCTAIDSI 561
gi 20455034  176 YYESKGKLVRINAEGSVDDIFAVVVANLDKA 206
3ADK_A       164 FYEKRGIVRKVNAEGSVDDVFSQVCTHLDTL 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap