1MP8,2J0M,3BZ3,2J0L,3CC6


Conserved Protein Domain Family
PTKc_FAK

?
cd05056: PTKc_FAK 
Click on image for an interactive view with Cn3D
Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase
PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) PTK that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions and at growth factor receptors. Through diverse molecular interactions, FAK functions as a biosensor or integrator to control cell motility. It is a key regulator of cell survival, proliferation, migration and invasion, and thus plays an important role in the development and progression of cancer. Src binds to autophosphorylated FAK forming the FAK-Src dual kinase complex, which is activated in a wide variety of tumor cells and generates signals promoting growth and metastasis. FAK is being developed as a target for cancer therapy. The FAK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 133187
View PSSM: cd05056
Aligned: 13 rows
Threshold Bit Score: 512.738
Threshold Setting Gi: 15150650
Created: 17-Jul-2006
Updated: 2-Mar-2014
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                     #####   #                                       # #                
1MP8_A        10 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPALAVAIKTCKNCts-----dSVR 60
gi 20141440  428 YEIQRDRIELGRCIGEGQFGDVHQGVYMSpe------------------------nPAMAVAIKTCKNCts-----dSVR 478
gi 31377437  419 YEIQRDRIELGRCIGEGQFGDVHQGVYISpe------------------------nPSLSVAIKTCKNCts-----dSVR 469
gi 54038645  256 FTISRSDVALGRILGEGFFGEVYDGVYVKpk------------------------gDKINVAVKTCKNDca-----aDVK 306
gi 31873501  410 VGLSRKDISLKRMLGEGFFGEVHEGVYQKkn------------------------gEKVNVAVKTCKECa------pDIR 459
gi 56554785  422 YEVARDDLTLDEIIGQGQFGDVYQGTFKSki-----------------------ssVEIPVAVKTYKIEldkeqedgTRA 478
gi 6016830   450 YELDRSLITPSAKIGVGQFGDVYVGTYTLpklgkgknlagngknsnsdqrnadsrpDVIQVAIKTCKANdd-----pEKT 524
gi 15150650  360 IRLRRELITLKELIGGGQFGNVYKAVYHDle-----------------------kdERIAVAVKVCKTDae-----pADT 411
gi 31377435  431 YEISRELVTLVETIGQGQFGDVHKGIYIDq-------------------------dEKVEVAVKTCKVEst-----qALG 480
2J0M_B         5 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPALAVAIKTCKNCts-----dSVR 55
3BZ3_A         2 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPALAVAIKTCKNCts-----dSVR 52
2J0L_A         5 YEIQRERIELGRCIGEGQFGDVHQGIYMSpe------------------------nPAMAVAIKTCKNCts-----dSVR 55
3CC6_A         7 YGIAREDVVLNRILGEGFFGEVYEGVYTNhk------------------------gEKINVAVKTCKKDct-----lDNK 57
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1             #            #              ####  ##                                       
1MP8_A        61 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYAYQLSTALAYLESKRFVHR 140
gi 20141440  479 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYSYQLSTALAYLESKRFVHR 558
gi 31377437  470 EKFLQEALTMRQFDHPHIVKLIGIITEnPVWIIMELCTLGELRSFLQVRKynLDLSTLILFAYQLSTALAYLESKRFVHR 549
gi 54038645  307 EKFMSEAYLMRNLDHPHIVKLIGIIEDdPIWIVMELYPYGELGQYLEKNKnsLQVLSLILYSLQICKALAYLEGINCVHR 386
gi 31873501  460 EKFVGEAVIMKNLDHPHIVRLIGVIEEdPVWIVMELCQQGELGKYLTKNQqsLTSVTLVLFSLQLCKALVYLQGMNMVHR 539
gi 56554785  479 EKFLEEAYLMQQFDHPHVIKLIGIVSDsPSYIIMELASYGELRSYLQQYRtqTESERLLTYIYQLSTALSYLESRNFVHR 558
gi 6016830   525 ENFLAEAYIMQKFDHPHIIRLIGICSVmPIWIVMELAKLGELRAYLKTNSerLSHGTLLKYCYQLSTALSYLESKKFVHR 604
gi 15150650  412 QLILQESSLMRNFRHSNIIQLIGVCVDqPMWLVLELAPKGELREYLQQEKdwLPLRILTLFCSQICDSLVYLHSTRFVHR 491
gi 31377435  481 ERFLEEAYIMKQFDHPHIIKLIGVCTDpPIWIVMELAPFGEMRMFLQTHKeeLTLASLILYAYQLSMALSYLESKKFVHR 560
2J0M_B        56 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYAYQLSTALAYLESKRFVHR 135
3BZ3_A        53 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKysLDLASLILYAYQLSTALAYLESKRFVHR 132
2J0L_A        56 EKFLQEALTMRQFDHPHIVKLIGVITEnPVWIIMELCTLGELRSFLQVRKfsLDLASLILYAYQLSTALAYLESKRFVHR 135
3CC6_A        58 EKFMSEAVIMKNLDHPHIVKLIGIIEEePTWIIMELYPYGELGHYLERNKnsLKVLTLVLYSLQICKAMAYLESINCVHR 137
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            ## #          #                                                             
1MP8_A       141 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 218
gi 20141440  559 DIAARNVLVSSsDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGVKPF 636
gi 31377437  550 DIAARNVLVSSiDCVKLGDFGLSRYMEDS-SYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMFGIKPF 627
gi 54038645  387 DIAVRNILVASpECVKLGDFGLSRYLEEE-EYYKAS-VTRLPIKWMAPESINFRRFTSASDVWMFGVCMWEILSFGKQPF 464
gi 31873501  540 DIAVRNVLVATpECVKLGDFGLSRYIEDE-EYYKAS-VTRLPIKWMAPESINFRRFTAASDVWMFAVCVWEIMNRGKQPF 617
gi 56554785  559 DIAARNILAADpHTIKLADFGLSRWIDEEqSYYKAS-KGKLPIKWMAPESINFRRFSSASDVWMFGVCCWEILMYGVKPF 637
gi 6016830   605 DIAARNVLVSSpTCVKLADFGLSRWVSDQ-SYYHSTpTVALPIKWMSPESINFRRFTTASDVWMFGVCIWEILMLGVKPF 683
gi 15150650  492 DIAARNILVCSpQCVKLADFGLSRALDYD-AVYTAS-RGKLPIKWLAPESVNYRQFSMASDVWMFGVCMWEIFSLGVKPW 569
gi 31377435  561 DIAARNLLVVAkDNVKLGDFGLSRLLHDH-SYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGVKPF 638
2J0M_B       136 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 213
3BZ3_A       133 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TYYKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 210
2J0L_A       136 DIAARNVLVSSnDCVKLGDFGLSRYMEDS-TXXKAS-KGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPF 213
3CC6_A       138 DIAVRNILVASpECVKLGDFGLSRYIEDE-DYYKAS-VTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPF 215
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
Feature 1                                                                      
1MP8_A       219 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 279
gi 20141440  637 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 697
gi 31377437  628 QGVKNNDVIGRIENGERLAMPQNCPPTLYSLMTK-CWAYDPSKRPRFTELKTQLSTILDEEK 688
gi 54038645  465 FWLENKDVISVIEKGDRLPKPEMCPPTLYTLMTR-CWTYDPFERPKFTELVCSLSDIYQTEK 525
gi 31873501  618 HWLDNRDVINQLEQGNRLPKPEQCPPALYSLMTR-CWSYDPRERPTFTELACNISDVHQMEK 678
gi 56554785  638 QGVPNEKVIGKIENGERLPLPPNCAPTLYHLMTE-SWHYEPSKRPTFQELKSRLSQIKYEES 698
gi 6016830   684 QGVKNSDVILKLENGERLPLPPNCPPRLYSLMSQ-CWAYEPLKRPNFKRIKETLHEILIEDS 744
gi 15150650  570 AGVTNSDVIMHIEQGSRPPCPEKCPTALYNFIRSkMWAIEPHKRPTVDQIYAIIEDVRQQII 631
gi 31377435  639 QGVKNNEVIGRIENGERLPMPAACPPTLYSVMTL-CWSYEPSKRPNFKDLKTRLNEILEEEK 699
2J0M_B       214 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 274
3BZ3_A       211 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 271
2J0L_A       214 QGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTK-CWAYDPSRRPRFTELKAQLSTILEEEK 274
3CC6_A       216 FWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR-CWDYDPSDRPRFTELVCSLSDVYQMEK 276

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap