Conserved Protein Domain Family
PRK13914

?
PRK13914: PRK13914 
invasion associated endopeptidase
Links
?
Statistics
?
PSSM-Id: 237555
View PSSM: PRK13914
Aligned: 9 rows
Threshold Bit Score: 607.954
Threshold Setting Gi: 289433859
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289433859   1 MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQDNGTTVDALKKANKLTTDKIVPGQKLQV---TEVA-S 76 
116871969   1 MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDALKKANNLTSDKIVPGQKLQV---TEVA-S 76 
16799666    1 --MKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQV---NEVAtE 75 
16802625    1 --MKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQVn--NEVAaA 76 
46906827    1 MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQV---NEVAaA 77 
217965324   1 --MKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQVtevNEVAkT 78 
226223211   1 MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQV---NEVAaA 77 
284994048   1 MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQVn--NEVAaA 78 
284800862   1 MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSKGTTVDAIKKANNLTTDKIVPGQKLQVn--NEVAaA 78 
289433859  77 EKTEKSVSATWLNVRSGAGVDNSIVTSLKGGTKVTVESTEANGWNKITYGEGKTGYVNGKYLGNAVTSAPSA-TPEVKQE 155
116871969  77 EKTEKSVSATWLNVRSGAGVDNSIVTSLKGGTKVTVEAAESNGWNKISYGEGKTGYVNGKYLGDAVTSAPVA-KQEVKQE 155
16799666   76 EKAEKSVSATWLNVRSGAGVDHSILTSIKGGTKVTVETTESNGWHKITYNDGKTGYVNGKYLTDKATSTPVV-KQEVKKE 154
16802625   77 EKTEKSVSATWLNVRSGAGVDNSIITSIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKAVSTPVApTQEVKKE 156
46906827   78 EKTEKSVSATWLNVRSGAGVDNSIITSIKGGTKVTVESTESNGWNKITYNDGETGFVNGKYLTDKVASTPVApTQEVKKE 157
217965324  79 EKQEKSVSATWLNVRTGAGVDNSIITSIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKVASTPVTtTQEVKKE 158
226223211  78 EKTEKSVSATWLNVRSGAGVDNSIITSIKGGTKVTVESTESNGWNKITYNDGETGFVNGKYLTDKVASTPVApTQEVKKE 157
284994048  79 EKTEKSVSATWLNVRSGAGVDNSIITSIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKAVSTPVApTQEVKKE 158
284800862  79 EKTEKSVSATWLNVRSGAGVDNSIITSIKGGTKVTVETTESNGWHKITYNDGKTGFVNGKYLTDKAVSTPVApTQEVKKE 158
289433859 156 -ETTQAAPAQQTKTEVKQATPAatTEKDAVETKTTAPAVDTNATTHTVKSGDTIWALSVKYGASVQDLMSWNNLSSSSIY 234
116871969 156 -TTKQTAPAAETKTEVKQSTPA--PTAPKAAETKTAPVVDTNATTHTVKSGDTIWALSVKYGASVQDLMSWNNLSSSSIY 232
16799666  155 -TTQQVKPATEAKTEVKQPTTQqtAPAPKAAETKEAPVVDQNATTHNVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 233
16802625  157 tTTQQAAPAAETKTEVKQTTQAt-TPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 235
46906827  158 tTIQQAAPAAETKTEVKQTTQAt-TPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 236
217965324 159 aTTEQAAPAAETKTEVKQTTQAt-TPAPKAAETKETPVVDKNATTHTVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 237
226223211 158 tTTQQAAPAAETKTEVKQTTQAt-TPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 236
284994048 159 tTTQQAAPAAETKTEVKQTTQAt-TPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 237
284800862 159 tTTQQAAPAAETKTEVKQTTQAt-TPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQDIMSWNNLSSSSIY 237
289433859 235 VGQNIAVKQSaAKNTAPKAEAKTEAPAAEKQtAAPVVKESTNtsttTTVKKETTTEKQTsTTKAPAQAAKp--aPAPAPT 312
116871969 233 VGQKIAVKQSaAKTAAPKAEVKTEAPAVEKEtSTPVVKENTN----TTVKKEVTTQTQTnTTKAPAQAAKpapaPAPAPT 308
16799666  234 VGQKLAIKQP-TKTVAPKAETKTQAPAAEKQ-TAPAVKENSNantaTTEKKETATEQQT-TTKAPTQAAK----PAPAPS 306
16802625  236 VGQKLAIKQT-ANTATPKAEVKTEAPAAEKQ-AAPVVKENTNtntaTTEKKETATQQQT-APKAPTEAAK----PAPAPS 308
46906827  237 VGQKLAIKQT-ANTVTPKAEVKKEAPAAEKQ-AAPVVKENTNtntnTTTEKKETTQQQT-APKAPTEAAK----PAPAPS 309
217965324 238 VGQKLAIKQT-ANTATPKAEVKTEAPAAEKQ-AAPAVKENTNtntaTTEKKETTTQQQT-APKAPTEAAK----PAPAPA 310
226223211 237 VGQKLAIKQT-ANTATPKAEVKKEAPAAEKQ-AAPVVKENTNtntnATTEKKETTQQQT-APKAPTEAAK----PAPAPS 309
284994048 238 VGQKLAIKQT-ANTATPKAEVKTEAPAAEKQ-AAPVVKENTNtntaTTEKKETATQQQT-APKTPTEAAK----PAPAPS 310
284800862 238 VGQKLAIKQT-ANTATPKAEVKTEAPAAEKQ-AAPVVKENTNtntaTTEKKETATQQQT-APKTPTEAAK----PAPAPS 310
289433859 313 VNTNASSYTVKsgdtlgkiastfgttvskik---alngltsdnlqvgdvlkvkgTVPATNTNTATAPTTNTNNNTSSSNT 389
116871969 309 VNTNASTYTVKsgdslskiantfgtsvskikalnnltsdnlqvgtvlkvkgtvpTTNTNNNSNTTAPTTNTSNNNTSSNT 388
16799666  307 TNTNK-------------------------------------------------TNTTNNNTNASTPSKNTNTNTNTNT- 336
16802625  309 TNTNANKTNTNt-----------------------------------------nTNTNTNNTNTNTPSKNTNTNSNTNTN 347
46906827  310 TNTNANK-----------------------------------------------TNTNTNNTNTSTPSKNTNTNTNSNTN 342
217965324 311 PSTNTNA-----------------------------------------------NKTNTNNTNTSTPSKNTNTNT----- 338
226223211 310 TNTNANK-----------------------------------------------TNTNTNNTNTSTPSKNTNTNTNSNTN 342
284994048 311 TNTNANKTNTN-------------------------------------------TNTNTNNTNTNTPSKNTNTNSNTNTN 347
284800862 311 TNTNANKTNTN-------------------------------------------TNTNTNNTNTNTPSKNTNTNSNTNTN 347
289433859 390 STPs--kNNNTNQSSSN---SSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGFTSYVFAQSGITLPRTSGAQYASTTKV 464
116871969 389 STPskntNTNTNQGSSN---SASASALIAEAQKHLGKAYSWGGNGPTTFDCSGFTSYVFAKSGISLPRTSGAQYASTSRI 465
16799666  337 -------NTNTNQGSTN---NASASALIAEAQKHLGKAYSWGGNGPTTFDCSGFTKYVFAKSGISLPRTSGAQYASTTRI 406
16802625  348 TNS----NTNANQGSSNnnsNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISLPRTSGAQYASTTRI 423
46906827  343 TNS----NTNANQGSSNnnsNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISLPRTSGAQYASTTRI 418
217965324 339 -------NTNANQGSSNnnsNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISLPRTSGAQYASTTRI 411
226223211 343 TNS----NTNANQGSSNnnsNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISLPRTSGAQYASTTRI 418
284994048 348 TNS----NTNANQGSSNnnsNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISLPRTSGAQYASTTRI 423
284800862 348 TNS----NTNANQGSSNnnsNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAKAGISLPRTSGAQYASTTRI 423
289433859 465 SESEAQPGDLVFFDYGSGIAHVGIYVGNGQMINAQDNGVKYDNIHGSGWGQYLVGFGRV 523
116871969 466 SESQAKPGDLVFFDYGSGIAHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 524
16799666  407 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGAGWGKFLVGFGRV 465
16802625  424 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 482
46906827  419 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 477
217965324 412 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 470
226223211 419 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 477
284994048 424 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 482
284800862 424 SESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVKYDNIHGSGWGKYLVGFGRV 482
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap