NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS56901.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56901.1 Public Mus musculus 13 Hmgcs1 23 108 98 CCDS HistoryNCBI Gene:208715Re-query CCDS DB by CCDS ID:56901.1Re-query CCDS DB by GeneID:208715See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56901.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000179869.2 ENSMUSP00000136944.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000179869.2Link to Ensembl Protein Viewer:ENSMUSP00000136944.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000179869Re-query CCDS DB by Protein ID:ENSMUSP00000136944
Original member Current member EBI ENSMUST00000224188.1 ENSMUSP00000153064.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000224188.1Link to Ensembl Protein Viewer:ENSMUSP00000153064.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000224188Re-query CCDS DB by Protein ID:ENSMUSP00000153064
Original member Current member NCBI NM_001291439.1 NP_001278368.1 Accepted alive Link to Nucleotide Sequence:NM_001291439.1Link to Protein Sequence:NP_001278368.1Re-query CCDS DB by Nucleotide ID:NM_001291439Re-query CCDS DB by Protein ID:NP_001278368Link to BLAST:NP_001278368.1
Original member Current member NCBI NM_145942.5 NP_666054.2 Accepted alive Link to Nucleotide Sequence:NM_145942.5Link to Protein Sequence:NP_666054.2Re-query CCDS DB by Nucleotide ID:NM_145942Re-query CCDS DB by Protein ID:NP_666054Link to BLAST:NP_666054.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001278368.1 520 Q8JZK9 520 100% 0 0
NP_666054.2 520 Q8JZK9 520 100% 0 0

Chromosomal Locations for CCDS 56901.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 119699674 119700121 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119700508 119700633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119701076 119701240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119702535 119702700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119703520 119703690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119704425 119704531 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119705057 119705182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119705348 119705511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 119706389 119706478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1563 nt):
ATGCCTGGGTCACTTCCTTTGAATGCAGAGGCTTGCTGGCCAAAAGATGTGGGAATCGTTGCCCTTGAAA
TC
TACTTTCCTTCTCAATATGTCGATCAAGCTGAGTTGGAAAAATACGATGGTGTAGATGCTGGAAAGTA
T
ACCATCGGCCTGGGCCAGGCCAGGATGGGCTTCTGCACGGATCGTGAAGACATCAACTCTCTTTGCCTG
ACT
GTGGTTCAGAAACTGATGGAGAGACATAGCCTTTCCTATGATTGCATTGGGCGGCTAGAAGTTGGAA
CA
GAGACAATCATCGACAAATCGAAATCAGTGAAGTCTAATTTGATGCAGCTGTTTGAGGAGTCTGGGAA
T
ACAGATATAGAAGGAATAGATACAACCAATGCATGCTATGGGGGCACAGCTGCAGTCTTCAATGCCGTG
AAC
TGGGTCGAATCCAGCTCTTGGGATGGACGATATGCTCTGGTAGTTGCAGGAGACATTGCTATATATG
CC
ACAGGAAATGCCAGACCTACAGGTGGAGTTGGAGCTGTGGCCCTGCTAATTGGGCCAAACGCTCCTCT
A
ATTTTTGACCGAGGGCTCCGTGGGACACACATGCAGCATGCCTATGACTTTTACAAGCCTGACATGCTC
TCC
GAGTACCCTGTGGTCGACGGAAAGCTCTCCATACAGTGCTACCTCAGCGCCCTGGACCGCTGCTATT
CT
GTCTACCGCAAAAAGATCCGTGCCCAGTGGCAGAAAGAGGGAAAGGATAAAGATTTTACCCTGAATGA
T
TTTGGCTTCATGATCTTTCACTCACCATATTGTAAACTGGTGCAGAAATCTCTAGCTCGGATGTTCCTG
AAT
GACTTTCTTAATGATCAAAACAGAGATAAAAACAGTATTTACAGTGGACTGGAAGCCTTTGGGGACG
TT
AAATTAGAAGATACTTACTTTGACAGAGATGTAGAAAAGGCATTTATGAAGGCTAGTTCTGAGCTATT
C
AACCAGAAAACAAAGGCGTCTTTGCTTGTGTCTAATCAGAATGGAAATATGTACACATCCTCTGTCTAT
GGT
TCCCTGGCTTCTGTCCTGGCACAGTACTCACCTCAGCAGTTGGCAGGGAAGAGGGTTGGAGTGTTCT
CT
TACGGTTCTGGCTTGGCTGCCACGCTGTACTCCCTTAAAGTCACACAAGACGCCACACCAGGATCTGC
C
CTTGATAAAATAACAGCAAGTTTATGTGACCTTAAATCAAGGCTTGACTCGAGAACTTGTGTGGCACCG
GAT
GTCTTTGCTGAAAACATGAAGCTCAGAGAGGACACACATCACTTAGCCAACTATATTCCCCAGTGTT
CA
ATAGACTCACTCTTTGAAGGAACGTGGTATCTGGTCAGAGTGGATGAAAAACACAGAAGGACTTACGC
C
CGGCGCCCCTTCACAAATGACCACAGTTTGGATGAAGGAATGGGGCTCGTGCATAGTAACACAGCAACA
GAG
CATATTCCAAGCCCTGCTAAGAAAGTGCCAAGACTCCCTGCAACCTCGGCCGAATCTGAATCAGCTG
TC
ATCAGTAACGGGGAGCACTGA


Translation (520 aa):
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQARMGFCTDREDINSLCL
T
VVQKLMERHSLSYDCIGRLEVGTETIIDKSKSVKSNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAV
N
WVESSSWD
GRYALVVAGDIAIYATGNARPTGGVGAVALLIGPNAPLIFDRGLRGTHMQHAYDFYKPDML
S
EYPVVDGKLSIQCYLSALDRCYSVYRKKIRAQWQK
EGKDKDFTLNDFGFMIFHSPYCKLVQKSLARMFL
N
DFLNDQNRDKNSIYSGLEAF
GDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVY
G
SLASVLA
QYSPQQLAGKRVGVFSYGSGLAATLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTCVAP
D
VFAENMKLREDTHHL
ANYIPQCSIDSLFEGTWYLVRVDEKHRRTYARRPFTNDHSLDEGMGLVHSNTAT
E
HIPSPAKKVPRLPATSAESESAVISNGEH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser