Conserved Protein Domain Family
P-type_ATPase_cation

?
cd07542: P-type_ATPase_cation 
P-type cation-transporting ATPases, similar to human ATPase type 13A2 (ATP13A2) protein and Saccharomyces cerevisiae Ypk9p
Saccharomyces cerevisiae Yph9p localizes to the yeast vacuole and may play a role in sequestering heavy metal ions, its deletion confers sensitivity for growth for cadmium, manganese, nickel or selenium. Human ATP13A2 (PARK9/CLN12) is a lysosomal transporter with zinc as the possible substrate. Mutation in the ATP13A2 gene has been linked to Parkinson's disease and Kufor-Rakeb syndrome, and to neuronal ceroid lipofuscinoses. ATP13A3/AFURS1 is a candidate gene for oculo auriculo vertebral spectrum (OAVS), being one of nine genes included in a 3q29 microduplication in a patient with OAVS. Mutation in the human ATP13A4 may be involved in a speech-language disorder. This subfamily also includes zebrafish ATP13A2 a lysosome-specific transmembrane ATPase protein of unknown function which plays a crucial role during embryonic development, its deletion is lethal. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.
Statistics
?
PSSM-Id: 319842
View PSSM: cd07542
Aligned: 16 rows
Threshold Bit Score: 452.088
Threshold Setting Gi: 6707670
Created: 19-May-2008
Updated: 18-Aug-2016
Structure
?
Aligned Rows:
 
Feature 1: P-type ATPase signature motif, 7 residue positions
Conserved feature residue pattern:D K [TS] G T [LIVM] [TS]Click to see conserved feature residue pattern help
Evidence:
  • Comment:a characteristic P-type ATPase conserved sequence motif: DK[TS]GT[LIV]T, in which D is the reversibly phosphorylated Asp

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  182 GMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVVMSIVSIVSSLYsirkqyvmlh 261
gi 30581066   158 SEISRRLEFYGRNEIVVQLRPILYLLVMEVITPFYVFQIFSVTVWYNDEYAYYASLIVILSLGSIVMDVYqirtqei--r 235
gi 28950349   331 DEKSHRDAVFGGNLIDIEEKSTFRLLADEVFHPFYVFQIASLILWSVDEYYYYAIAIFVMSVGSIVATLIetkstmk--r 408
gi 161076319  326 HEQISRRIVFGDNEITVPLRDFKTLLFLEVLNPFYVFQLFSVILWFTYDYYYYACVILLMSVFGITVSVLqtkknqd--v 403
gi 71999370   189 DDVALRRTYFGPNVMPVKLSPFYELVYKEVLSPFYIFQAISVTVWYIDDYVWYAALIIVMSLYSVIMTLRqtrsqqr--r 266
gi 50258574   579 AVRKQRLVLMGENIIDIASKSVVGLLVDEVLHPFYVFQIASIILWSLDDYYYYAFAIALISITSIMSTLIetkrtie--r 656
gi 71993281   194 QDVIASRKIYNMNALALALTPILVILFKEVLGPFYLFQCFSVALWYSDNYAYYASVIVIITVGSAAVAVYqmraqek--r 271
gi 6707670     12 KLINDRKILYGECNLNIKSDSFIILLFKEIMNPFFIFQIFAMIVWSLDNYIEYTISILFITSISIILELKntiknqk--k 89
gi 6707668    301 DAINDRLCIFGENLIDLELKSVSQLLIDEVLHPFYIFQVFSIILWSMDSYYYYAICILIISVVSILGSLIetrktlr--r 378
gi 2493012    465 GVQEDRELAFGKNQINLRMKTTSEILFNEVLHPFYVFQVFSIILWGIDEYYYYAACIFLISVLSIFDSLNeqkkvsr--n 542
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  262 dmvathSTVRVSVCRvnEEIEEIFSTDLVPGDVMVIpl-nGTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLpnpsvd 340
gi 30581066   236 lrsmvhSTESVEVIRe-GTEMTIGSDQLVPGDILLIpp-hGCLMQCDSVLMNGTVIVNESVLTGESVPITKVALtdetnd 313
gi 28950349   409 lreisrFVCDVRVLRn-GFWRHVSSSDLVPGDIYEVsdpsLSQFPADSLLLGGDCIVNESMLTGESVPVSKTPAtdqslr 487
gi 161076319  404 lqktvyNTGNAWVVDhkGLSKELPTRAIVPGDIIEIps-sGCTLHCDAILISGNCILDESMLTGESVPVTKTPLpskrdm 482
gi 71999370   267 lqsmvvEHDEVQVIRenGRVLTLDSSEIVPGDVLVIpp-qGCMMYCDAVLLNGTCIVNESMLTGESIPITKSAIsddghe 345
gi 50258574   657 mremsrFHCDIKVLId-GEWVMKDCSELVPGDIFDSsdpnLSVFPCDALLLSGDAIVNESMLTGESVPVSKIPAkdetlr 735
gi 71993281   272 irnmvgDTISVIVRRd-GHDITIDASEIVPMDILILps-nTFILPCDCLLMNGTVIVNEAMLTGESVPVTKASLkeadec 349
gi 6707670     90 iknmlnYTCPINVYRy-NTSYIISSSELVPGDIYEIk--nNMTIPCDTIILSGSVTMSEHMLTGESVPIHKERLpfegna 166
gi 6707668    379 mremsrFTCPVRVYRd-GFWTSISSTDLVIGDVFEIsdpeLTIFPADALLLSGDCIVNESMLTGESIPVSKIPAtdqsmk 457
gi 2493012    543 laemshFHCDVRVLRd-KFWTTISSSELVPGDIYEVsdpnITILPCDSILLSSDCIVNESMLTGESVPVSKFPAteetmy 621
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  341 vkgi---------------------------------------------------------------------------- 344
gi 30581066   314 s------------------------------------------------------------------------------- 314
gi 28950349   488 nldl---------------------------------------------------------------------------- 491
gi 161076319  483 i------------------------------------------------------------------------------- 483
gi 71999370   346 k------------------------------------------------------------------------------- 346
gi 50258574   736 alsres-------------------------------------------------------------------------- 741
gi 71993281   350 gp------------------------------------------------------------------------------ 351
gi 6707670    167 iinknnkydsndekddylriynnhasinmikrnhlieetlgkkdreyksnthdlcsmnklcyinntyddvhmknnkmdyn 246
gi 6707668    458 elfs---------------------------------------------------------------------------- 461
gi 2493012    622 qlcdd--------------------------------------------------------------------------- 626
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670    247 nnnnnkkkkkinnlnfvkgtyinsndllyddkigvnifeddvnnmkhkfnqrninyynkdtnnleynnkhryiydcllkk 326
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  345 -------gdelynpethKRHTLFCGTTVIQtrf---------ytGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYR 408
gi 30581066   315 ----------vfnieknSKNVLFCGTQVLQtrf---------yrGKKVKAIVLRTAYSTLKGQLVRSIMYPKPVDFRFTK 375
gi 28950349   492 --------gastvlpevAKHFLFCGTKIIRarrpq----ddhneEAVALALVVRTGFNTTKGALVRSMLFPKPSGFKFYR 559
gi 161076319  484 -----------fdktehARHTLFCGTKVIQtry---------igSKKVLAFVINTGNITAKGELIRSILYPPPVDYKFEQ 543
gi 71999370   347 ----------ifsidkhGKNIIFNGTKVLQtky---------ykGQNVKALVIRTAYSTTKGQLIRAIMYPKPADFKFFR 407
gi 50258574   742 ------kqgsseidsdlAKHYLFSGTKIIRvragakpvwapkseSSIALAMVTRTGFNTTKGALVRSMLFPKPMGFKFYR 815
gi 71993281   352 ---------eirlssehNRHTLFSGTTVLQtrn---------ykGQPVMARVIRTGFSTLKGQLVRSIMYPKPQEKEALK 413
gi 6707670    327 veaisqknkiiysnediNKYMLYGGTYVLSlyninki-kynnkeENRILGLVIKTGFITTKGKIVNNILYHKKKELNLIN 405
gi 6707668    462 --------fsknipaslCKHFLFSGTKIIQvrkpf----vnekeEGASLAMVVRTGFNTTKGALVRSMIFPKPTNFSFYR 529
gi 2493012    627 -------fqstqissfvSKSFLYNGTNIIRari--------apgQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYR 691
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  409 DAYLFLLCLVAVAGIGFIYTIINSILNEvqvgvIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKi-GIFCISPQRIN 487
gi 30581066   376 DLFKFILFLACISGCGFIYTIIVMIMRGntlrrIIVRSLDIITITVPPALPAAMSVGIINAQLRLKKk-EIFCISPSTIN 454
gi 28950349   560 DSFRYISVMACVAMVGFAASFVNFIRLNlswhlIIVRALDLITIVVPPALPATLTIGTNFALGRLKSk-KIFCISPQRVN 638
gi 161076319  544 DSYKFIQFLAIIACVGFIYTLVTKILRGtdpvkIAVESLDLITIVVPPALPAAMTVGRFYAQKRLKTs-EIFCISPRSIN 622
gi 71999370   408 ELMKFIGVLAIVAFFGFMYTSFILFYRGssigkIIIRALDLVTIVVPPALPAVMGIGIFYAQRRLRQk-SIYCISPTTIN 486
gi 50258574   816 DSMNFIGVLAIIAGFGFAISAVQFVRIGihwhtIMLRALDLITIVVPPALPATLTIGTTFAIDRLRKs-GIFCISPNRVN 894
gi 71993281   414 DVMVFILVLGFIALIGFIYTVIEMVSRGeslkhIIIRSLDIITIVVPPALPAAMSVGIINANSRLKKk-KIFCTSPTTVN 492
gi 6707670    406 DSYKFLIILIIYALFSVFILLYITLSNNeytnhIIIKCLDIITDAIPPALPTTLTVGISIAISRLKKkfSISCLCPHKIN 485
gi 6707668    530 DSFRFITAMFIIALIGFVFSSINLLTLGvpiatIIIRALDLITIVVPPALPATLTIGTTFAISRLRKq-GIFCISPQRVN 608
gi 2493012    692 DSFKYIGFMSLIAIFGFCVSCVQFIKLGldkktMILRALDIITIVVPPALPATLTIGTNFALSRLKEk-GIFCISPTRLN 770
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                   #######                                                               
gi 223590262  488 ICGQLNLVCFDKTGTLTEDGLDLWGIQRVENARFLspeenvcne------------------------------------ 531
gi 30581066   455 TCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNQeiqkvkleksnrtefmge--------------------------- 507
gi 28950349   639 VGGKLDIMCFDKTGTLTEEGLDVLGVRVVDRTNNRfsdildnpddlvprqdh---------------------------- 690
gi 161076319  623 VAGSINCCCFDKTGTLTEDGLDMWGVVPKSSTNQFqiplksvdr------------------------------------ 666
gi 71999370   487 TCGAIDVVCFDKTGTLTEDGLDFYALRVVNDAKIGdnivqiaan------------------------------------ 530
gi 50258574   895 IGGKINVVCFDKTGTLTEDGLDVLGARTIDRQNSRfselhsdiadvpi-------------------------------- 942
gi 71993281   493 VCGLINVACFDKTGTLTEDGLDFNCLKAIRKNEDGkpeftsefeeldpv------------------------------- 541
gi 6707670    486 IAGQINTMVFDKTGTLTENNLQFIGIITQNKKNKNmlsdfihikemntesyihskddnmihnknsiiseyyikdnmknlh 565
gi 6707668    609 VSGKLDLISFDKTGTLTEDGLDIMGVSVIEGSELGdlrsnsgnlcskd-------------------------------- 656
gi 2493012    771 ISGKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRgqkfgellsdirqvfpkf--------------------------- 823
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670    566 tsskkksitkersnflvqtikscllkdhyikekkkeyytnntycndlhindstcssyllnsetkdayceyynidhlcdin 645
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670    646 kknmdinsknelmgkysknelmgktiknelmgkysknelmgkysknelmgkysknelmgkysknelmgkysknelmgkti 725
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  532 -------------------------------------------------------------------mlvksqfvaCMAT 544
gi 30581066   508 ----------------------------------------------------------mteltsrnglpfdgdlvkAIAT 529
gi 28950349   691 ------------------------------------------------------------gtgirdssdtlkaalyTMAT 710
gi 161076319  667 --------------------------------------------------------------------lpfdhflfGMVT 678
gi 71999370   531 --------------------------------------------------------------------dscqnvvrAIAT 542
gi 50258574   943 ----------------------------------------------------------------eggvngktpllyALAT 958
gi 71993281   542 ---------------------------------------------------------------klsaenanlnivvAAAS 558
gi 6707670    726 knqvgvdtniyhmncdndynydypcdyncnncndtyhrleyhninkdnsfnippeknksynnisehikinypllfeALAC 805
gi 6707668    657 ----------------------------------------------------------------llsndspsnllyTMAT 672
gi 2493012    824 ----------------------------------------------------------slndcsspldfksrnffmSLLT 845
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  545 CHSLTKIEGVLSGDPLDLKMFEAIGWILEeateeetalhnrimptvvrppkql-----------------lpestpagnq 607
gi 30581066   530 CHSLTRINGVLHGDPLDLILFQKTGWTMEegiegdieeetqrfdnv--------------------------------qp 577
gi 28950349   711 CHSLRSIDDELVGDPLDLKMFEFTRWSFEeghegggatdgeeqgtlqpsiarpp---------------tvdkgytdadr 775
gi 161076319  679 CHSITILNGRMMGDPLDLKMFESTGWELEdsnnipdtekygilyptilrqprgglsgmaetesgskneikrqssvddlla 758
gi 71999370   543 CHTLSKINNELHGDPLDVIMFEQTGYSLEeddseshesiesiqp-----------------------------------i 587
gi 50258574   959 CHALKLIDGEIIGDPLDIKMFEYTGWTLDegqsrpvtkgnaegarpqalvqtvvr-------------ppgtdrwrmeda 1025
gi 71993281   559 CHSLTRIDGTLHGDPLELILVEKSKWIIEeavnsdeetqdfdtvqptv----------------------------lrpp 610
gi 6707670    806 CHTLSKVNNKIMGDVLEILMFNFTNCDMLinnnsfiikekkkncsydfqkid--------------------gdknigan 865
gi 6707668    673 CHMLRYVDGELVGDPLDIKMFKFTHWSYSeenflnkkmsseqaedaayvrtqql----------------ipptvsppwn 736
gi 2493012    846 CHSLRSVDGNLLGDPLDFKMFQFTGWSFEedfqkrafhslyegrheddvfpensei------------ipavvhpdsnnr 913
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  608 emelfelpatyeigIVRQFPFSSALQRMSVVARvlg---------------------------------------drkMD 648
gi 30581066   578 siikptddksaeysVIRQFTFSSSLQRMSVIVFdpred------------------------------------rpdnMM 621
gi 28950349   776 qdatqngrapfelgVLKSFEFVSQLRRASVIVKtfg---------------------------------------qksGD 816
gi 161076319  759 tvgispsqknfdhgIVREFPFTSALQRMSVVTRcls---------------------------------------dqvFN 799
gi 71999370   588 lirppkdsslpdcqIVKQFTFSSGLQRQSVIVTee-----------------------------------------dsMK 626
gi 50258574  1026 lkqgskhahflelgVIRTFDFVSALRRMSVIVKrlk---------------------------------------stcME 1066
gi 71993281   611 peqatyhpenneysVIKQHPFNSALQRMSVIIStpseh------------------------------------sahdMM 654
gi 6707670    866 derchlnnnlvsynILKRFEFQSRLQRMSVIVKstygnnnddnndddnnndddnnddnnnddnnnddnnddnnnnnyyYN 945
gi 6707668    737 spsnnytesdlelgIVRTFEFVSQLRRMAVIVKhgk---------------------------------------fkkMD 777
gi 2493012    914 entftdndphnflgVVRSFEFLSELRRMSVIVKtnn---------------------------------------ddvYW 954
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  649 AYMKGAPEAIaglCKPETVPVDFQNVLEDFTKQGFRVIALAHRKLeskltwhkvqnisrdaIENNMDFMGLIIMQNKLKQ 728
gi 30581066   622 LYSKGSPEMIlslCDPNTVPEDYLLQVNSYAQHGFRLIAVARRPLdlnfnka--skvkrdaVECDLEMLGLIVMENRVKP 699
gi 28950349   817 IFVKGAPECMrdiCKPESFPADYDDQLNYYTHKGYRVIGCATKHIpklswvka-qkmtrhnVESDLDFVGFIIFENKLKP 895
gi 161076319  800 VYCKGSPEMLkklCKPQSLPDNYSQQLSEFAKKGYRIIAIAFKALshkmnytkvqrlsreeVENNMEFLGFVILENRLKP 879
gi 71999370   627 AYCKGSPEMImslCRPETVPENFHDIVEEYSQHGYRLIAVAEKELvvgsevq---ktprqsIECDLTLIGLVALENRLKP 703
gi 50258574  1067 VYVKGAPEVMpeiCDPSSFPHDYDDMLSYYTRNGFRVIAIAGKSIegltwlra-qrmrrdvAESDLQFLGFIVFENKLKP 1145
gi 71993281   655 VFTKGSPEMIaslCIPDTIPEDYMEVVDEYAQRGFRLIAVASKAVhlnfaka--lktprdiMESELEFLGLIVMENRLKD 732
gi 6707670    946 IFCKGSPEKIkelCLKSKIPNNYDEILNKYTKQGMRILSISYKRVkskninl--lnvkrsfVESNLHFLGFLIFTNNMKK 1023
gi 6707668    778 AYVKGAPEIMpsiCKPESFPANYQEVLDYYTHNGFRVIACASKQLenctwaka-qrmkreqVECDLDFCGFIVFENKLKS 856
gi 2493012    955 SFTKGAPEVIseiCNKSTLPADFEEVLRCYTHNGYRVIACAGKTLpkrtwlys-qkvsreeVESNLEFLGFIIFQNKLKK 1033
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  729 ETPAVLEDLHKANIRTVMVTGDSMLTAVSVARDCGMILPQDKVIIAEAl------------------------------- 777
gi 30581066   700 VTLGVINQLNRANIRTVMVTGDNLLTGLSVARECGIIRPSKRAFLVEHvpgeldeygrtki------------------- 760
gi 28950349   896 ATAPVLKELAESNIGSVMVTGDNILTAISVARECSLINKTAHCFVGRFva------------------------------ 945
gi 161076319  880 DTTKVINALNAAKIRTIMITGDNILTAISVARDCGIVSPSQSVITVHAdpigdsaniqtntgtecnfdnssdkhyk---- 955
gi 71999370   704 VTTEVIQKLNEANIRSVMVTGDNLLTALSVARECGIIVPNKSAYLIEHengvvdrrgrtvlt------------------ 765
gi 50258574  1146 GTAPNIHTLRAAHLACRMVTGDNVRTAISVARECGLVSHSASVYIPTFip------------------------------ 1195
gi 71993281   733 VTLSVINELSVANIRCVMVTGDNLLTAMSVARECGIIRPTKKAFLITHs------------------------------- 781
gi 6707670   1024 NAPDIIHNLQTSGCQCIMSTGDNVLTSIHVAKKCGIINSNVESIIIGDvipvvgknnkqkkklvwynhkndtylkghdkt 1103
gi 6707668    857 TTATVIRELNDARIRTVMCTGDNVLTSICVGKRCGMLPEDGYVFLPRFde------------------------------ 906
gi 2493012   1034 ETSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINd------------------------------- 1082
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670   1104 cidneftsiqsqmnsdnicgdnicgdniygdnicgdniygdningdningdniygdningdningdnintydniygdnyn 1183
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670   1184 ldycpteyhkctynnsilyrnnflykkenkkdknyknistlyehrtndiqfdklcdilinkdprnvnivltgkafiflkk 1263
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670   1264 kfysfhlpyyeecknivhyimkkkhkkikniinnhnsnlyyhyniidtfvkrmnkeymcfnkllykiqqkllynlihnly 1343
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670   1344 kkkkymnnyydidevhlignnnnnnnknnskekklplknkmkhirknesndnitfntytsnnihlskykyvhhknyyypd 1423
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                        1450      1460      1470      1480      1490      1500      1510      1520
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670   1424 sctnlrkkknslfynlkkyiyyekkkylqhcllkhdnykkvelprikdinysyqmesiktrnfihslseqfafsnlilsf 1503
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                        1530      1540      1550      1560      1570      1580      1590      1600
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262      --------------------------------------------------------------------------------
gi 30581066       --------------------------------------------------------------------------------
gi 28950349       --------------------------------------------------------------------------------
gi 161076319      --------------------------------------------------------------------------------
gi 71999370       --------------------------------------------------------------------------------
gi 50258574       --------------------------------------------------------------------------------
gi 71993281       --------------------------------------------------------------------------------
gi 6707670   1504 yiiknddnnvynknyiynknyiynknsicnknyicnknyiynknniynknniynkknilthaksvllsgsskkflkffsn 1583
gi 6707668        --------------------------------------------------------------------------------
gi 2493012        --------------------------------------------------------------------------------
                        1610      1620      1630      1640      1650      1660      1670      1680
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  778 -----------------------------------------------------------------pPKDGKVAKINWHya 792
gi 30581066   761 ------------------------------------------------------fvkqsvsssdevIEDDASVSISMCss 786
gi 28950349   946 -----------------------------------------------------------------gHSRDPNAKLQWEsi 960
gi 161076319  956 --------------------------------------lhytldlgsktsraylfkscfnsnlfdpETPEFTAQVGKTif 997
gi 71999370   766 ----------------------------------------------------irekedhhterqpkIVDLTKMTNKDCqf 793
gi 50258574  1196 -----------------------------------------------------------------gTGVHDEARLDWSsv 1210
gi 71993281   782 -----------------------------------------------------------------kTEKDPLGRTKLFik 796
gi 6707670   1584 iirrhklkekknkknikrykmnhvnntskghiilnmcthgfkkdysslknkyrivnnkrymlkndnVYDRHMYNLTDMyr 1663
gi 6707668    907 -----------------------------------------------------------------eSESADEASRQLVwq 921
gi 2493012   1083 -----------------------------------------------------------------tPLHGEPVIVWRDvn 1097
                        1690      1700      1710      1720      1730      1740      1750      1760
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  793 dsltqcshpsaidpeaipvklvhdsle------------------------dlqmtryhfamngksfsvilehfqdlvpk 848
gi 30581066   787 twkgssegdgfsptntevetpnpvtadsl---------------------ghliassyhlaisgptfavivheypelvdq 845
gi 28950349   961 dnpiyqlddrtllplppppegdvslpyd----------------------isnlrnyslavsgdvfrwvidyappevmrr 1018
gi 161076319  998 hmestnslvnestssyaesglptsdslasvktidtwthndaelgikhtpdeswrrqecifamdgktwqivkdyfpeemei 1077
gi 71999370   794 aisgstfsv------------------------------------------------------------vtheypdlldq 813
gi 50258574  1211 dddrlkldewtlkpltnqvgvamdtae------------------------aemhdyqlaltgdvfrwmleyaefetmer 1266
gi 71993281   797 esvsssendidtdsevrafdrkavl----------------------------rtatyqmaiagptysvitheypelvdr 848
gi 6707670   1664 gtqygcskkknkniymnnnnnilknkinr--------------------flehllvdkckrnichkytdikniklsiyey 1723
gi 6707668    922 aienneifldphtlrpnvdfadhepvsie---------------------larlkdfhialtgdvfrwlvdyaplnvfhh 980
gi 2493012   1098 epdkildtktlkpvklgnnsveslrec-------------------------nytlavsgdvfrllfrdeneipeeylne 1152
                        1770      1780      1790      1800      1810      1820      1830      1840
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  849 LMLHGTVFARMAPDQKTQLIEALQNVD--YFVGMCGDGANDCGALKRAHGGISLSe-lEASVASPFTSKTPSISCVPNLI 925
gi 30581066   846 LCSVCDVFARMAPDQKQSLVEQLQQID--YTVAMCGDGANDCAALKAAHAGISLSd-aEASIAAPFTSKVPDIRCVPTVI 922
gi 28950349  1019 MLVTGKVFARMSPDEKHELVEKLQSID--YCCGFCGDGANDCGALKAADVGISLSe-aEASVAAPFTSRVFDIRCVPEVI 1095
gi 161076319 1078 LLTRGSIYARMSPDQKQALVIELQNLD--YCVAMCGDGANDCGALKVAHAGISLSe-tEASIASPFTSRNPTISAVLKVI 1154
gi 71999370   814 LVLVCNVFARMAPEQKQLLVEHLQDVG--QTVAMCGDGANDCAALKAAHAGISLSe-aEASIAAPFTSKVADIRCVITLI 890
gi 50258574  1267 MLVKGVIFARMSPDEKAELVERLQSLG--YTVAFCGDGANDCGALKAADVGVSLSe-aEASVAAPFTSQIPDISCMVEII 1343
gi 71993281   849 ITAMCDVYARMAPDQKAQLIGALQEIG--AKVSMCGDGANDCAALKAAHAGISLSq-aEASIAAPFTSNVPDIRCVPTVI 925
gi 6707670   1724 ILRTCTVYARMKPKDKSDLILSLKKLPnnSYVGMCGDGANDCLALSCADIGISLCnnnESSICSSFTSNKLCLHSIVHIL 1803
gi 6707668    981 ILLKAQIFARMSPSEKNELVSCFQNLN--YCVGFCGDGANDCGALKAADVGISLSe-aEASVAAPFTSKWFEITCVLDVI 1057
gi 2493012   1153 ILLNSSIYARMSPDEKHELMIQLQKLD--YTVGFCGDGANDCGALKAADVGISLSe-aEASVAAPFTSKIFNISCVLDVI 1229
                        1850      1860      1870      1880      1890      1900      1910      1920
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                         
gi 223590262  926 REGRAALITSFCVFKFMALYSIIQYFSVTLLYSIlsnLGDFQFLFIDLAIILVVVFTMSLNPAWKELVAQRPP-SGLISG 1004
gi 30581066   923 SEGRAALVTSFGIFKYMAGYSLTQFVTVMHLYWIsniLTDGQFMYIDMFLITMFALLFGNTPAFYRLAHTPPP-TRLLSI 1001
gi 28950349  1096 REGRAALVTSFSCFKYMSLYSAIQFTSVSFLYASasnLGDFQFLFIDLALILPIAVFMSWAGPFPELCRKRPT-ADLVSR 1174
gi 161076319 1155 KEGRAALVTSFGIFKYMAAYSLVQFISVMILYSIdsnLTDKQYLYVDLGLISIFAFFFGKTESFDGMLVEQVPlSSLISS 1234
gi 71999370   891 SEGRAALVTSYSAFLCMAGYSLTQFISILLLYWIatsYSQMQFLFIDIAIVTNLAFLSSKTRAHKELASTPPP-TSILST 969
gi 50258574  1344 KEGRAALVTSFSCFKYMALYSMIQFMTVTLLYSFassLGDFQFLYIDLFIIIPIAVTMGRTLPYPKIHPKRPT-ASLVSR 1422
gi 71993281   926 KEGRCALVTSYAVSKYMAAYSLNEFLSVMLLYNDgtnISDGQFLYIDLVLITLVALFLGNTEASRKLSGIPPP-RRLATS 1004
gi 6707670   1804 IEGRASLVNSFQLFKFISLYSIMQCSQVLILYSIsnkLTDNQYIFIDIVTILPLSIFMCWTSASEKLSKNIPI-GKLFSF 1882
gi 6707668   1058 KDGRAALVTSFSCFQYMALYSAIQFITVSILYTTnsnLGDFQFLFIDLVIILPIAVFMGRSRPYHRLAHKRPT-ANLVSK 1136
gi 2493012   1230 REGRAALVTSFACFQYMSLYSAIQFITITILYSRgsnLGDFQFLYIDLLLIVPIAICMSWSKSYEKIDKKRPS-ANLVSP 1308
                        1930      1940      1950      1960
                  ....*....|....*....|....*....|....*....|....*..
Feature 1                                                        
gi 223590262 1005 ALLFSVLSQIIICIGFQSLgffwVKQQPWYEVWHPKSDACNTTGSGF 1051
gi 30581066  1002 ASMTSVVGQLIIIGVVQFIvffsTSQQPWFTPYQPPVDDEVEDKRSM 1048
gi 28950349  1175 KVLVPLLGQMFICIFIQTMafiaVREQPWFIPPKVEHEKVNIRNSEN 1221
gi 161076319 1235 TPLASLLLHLTVVTAFQVTcwvhLHQQPWFKAFEPADEDHLGCFENY 1281
gi 71999370   970 ASMVSLFGQLAIGGMAQVAvfclITMQSWFIPFMPTHHDNDEDRKSL 1016
gi 50258574  1423 KVLISIIGQILINAAIQVFvfvwVRKQPWYTKPDTDVDKLETFNFEN 1469
gi 71993281  1005 AFYFSVFGQMFFNIITQTTgyllVRGQSWYVPNPEELDNTTTMIGTT 1051
gi 6707670   1883 PILISIYGQIIIQLFFVMIslvvLMNLSFYKYDKNKVMKEKSDDTYL 1929
gi 6707668   1137 RILSPLIGQIVLICIIQYItlriVRREPWYIPPPANSSDTNITNSDV 1183
gi 2493012   1309 KILVPLLISVFLVFLFQFIpwiiVQKMSWYIKPIVGGDDAVQSSDNT 1355

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap